The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
208
|
structure length |
198
|
Chain Sequence |
RPIEEKLEVIPVFLITNYNSSPYIFQENEKQVCYMFLCPYDAENMLNDMIKYNGMKYNGNIKIHNITMKKAYELMKEFLQLEKMQNIYWKLISSKRQLQNALYYLSFTKKSELMYPVFYAENLYIQKDGSNIIPLFFDLEDLKEAIEEQKNKALSKVDYKIKVLNMVDLIFTEDHKKFGFVPSTQSVKYLDKLNIGTK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Tic22 is an essential chaperone required for protein import into the apicoplast.
pubmed doi rcsb |
| molecule keywords |
Apicoplast TIC22, putative
|
| molecule tags |
Transport protein
|
| source organism |
Plasmodium falciparum 3d7
|
| total genus |
46
|
| structure length |
198
|
| sequence length |
208
|
| ec nomenclature | |
| pdb deposition date | 2012-03-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04278 | Tic22 | Tic22-like family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Trna Endonuclease; Chain: A, domain 1 | Trna Endonuclease; Chain: A, domain 1 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Trna Endonuclease; Chain: A, domain 1 | Trna Endonuclease; Chain: A, domain 1 |
#chains in the Genus database with same CATH superfamily 4EV1 A; 4E6Z A; #chains in the Genus database with same CATH topology 2GJW A; 2OST A; 5FDK A; 2BH2 A; 3IEY A; 3BT7 A; 4LQE A; 2FLC A; 3AJV A; 2JJQ A; 2WCZ A; 1F1Z A; 3DNX A; 3P1Z A; 4QBN A; 1A79 A; 4E6Z A; 2IXS A; 1IPI A; 1R0V A; 2FCO A; 1HH1 A; 2GW6 A; 1GEF A; 3IF0 X; 4DAP A; 2WJ0 A; 2INB A; 3IEY B; 2VLD A; 2CV8 A; 1Y1O A; 2EO0 A; 2VS1 A; 2ZYZ A; 1ZP7 A; 3AJV B; 4DA2 A; 4TKK A; 1YNM A; 3P1Z B; 4EV1 A; 2FKH B; 2WCW A; 4ZQU A; 2WIW A; 1OB9 A; 4QBO A; 2FL3 A; 2W8M A; 4DAV A; 2Z0R A; 1RZN A; 2ZYZ B; 1XMX A; 2WIZ A; 1OB8 A; 1UWV A; 2CZR A; 3FOV A; 4G6V A; 4TKD A; 1RLV A; 2DBS A; 2OKF A; 2FKC A; 1T0F A; 4QBL A; 3P1Y A; 4G6U A; 1Y88 A; 1R11 A; #chains in the Genus database with same CATH homology 2GJW A; 2OST A; 5FDK A; 2BH2 A; 3IEY A; 3BT7 A; 4LQE A; 2FLC A; 3AJV A; 2JJQ A; 2WCZ A; 1F1Z A; 3DNX A; 3P1Z A; 4QBN A; 1A79 A; 4E6Z A; 2IXS A; 1IPI A; 1R0V A; 2FCO A; 1HH1 A; 2GW6 A; 1GEF A; 3IF0 X; 4DAP A; 2WJ0 A; 2INB A; 3IEY B; 2VLD A; 2CV8 A; 1Y1O A; 2EO0 A; 2VS1 A; 2ZYZ A; 1ZP7 A; 3AJV B; 4DA2 A; 4TKK A; 1YNM A; 3P1Z B; 4EV1 A; 2FKH B; 2WCW A; 4ZQU A; 2WIW A; 1OB9 A; 4QBO A; 2FL3 A; 2W8M A; 4DAV A; 2Z0R A; 1RZN A; 2ZYZ B; 1XMX A; 2WIZ A; 1OB8 A; 1UWV A; 2CZR A; 3FOV A; 4G6V A; 4TKD A; 1RLV A; 2DBS A; 2OKF A; 2FKC A; 1T0F A; 4QBL A; 3P1Y A; 4G6U A; 1Y88 A; 1R11 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
