The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
93
|
structure length |
93
|
Chain Sequence |
ATKEGRVQKYAKERFEALGGLVRKLSYEGRSGAPDLLVILPRGVIWFVEVKKDENTKPDPHQLREHERFRKRGANVFVVGSFKQVDKLIEHYY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
FAN1 activity on asymmetric repair intermediates is mediated by an atypical monomeric virus-type replication-repair nuclease domain.
pubmed doi rcsb |
| molecule keywords |
Nuclease
|
| molecule tags |
Hydrolase
|
| source organism |
Salmonella phage setp3
|
| total genus |
29
|
| structure length |
93
|
| sequence length |
93
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2014-05-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08774 | VRR_NUC | VRR-NUC domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Trna Endonuclease; Chain: A, domain 1 | Trna Endonuclease; Chain: A, domain 1 |
#chains in the Genus database with same CATH superfamily 2WIW A; 1GEF A; 2GJW A; 4QBO A; 2OKF A; 3AJV A; 3P1Z B; 2WIZ A; 2WCZ A; 1T0F A; 1HH1 A; 1Y88 A; 1ZP7 A; 2EO0 A; 2ZYZ B; 2CV8 A; 4QBL A; 1Y1O A; 4TKK A; 2INB A; 2VLD A; 1A79 A; 1R0V A; 3P1Y A; 3P1Z A; 2WJ0 A; 2GW6 A; 3DNX A; 2FCO A; 4TKD A; 1OB9 A; 1F1Z A; 1OB8 A; 2ZYZ A; 1XMX A; 4QBN A; 1RLV A; 3IEY A; 3AJV B; 1RZN A; 2OST A; 2WCW A; 1R11 A; 5FDK A; 1IPI A; 3FOV A; #chains in the Genus database with same CATH topology 2FL3 A; 2WIW A; 2CZR A; 1GEF A; 2FKH B; 4G6U A; 4EV1 A; 4LQE A; 2BH2 A; 2GJW A; 4QBO A; 2JJQ A; 2OKF A; 1UWV A; 2Z0R A; 3AJV A; 3P1Z B; 4ZQU A; 2WIZ A; 2WCZ A; 1YNM A; 1T0F A; 2FKC A; 1HH1 A; 1Y88 A; 1ZP7 A; 2EO0 A; 2ZYZ B; 2CV8 A; 2IXS A; 3IF0 X; 4QBL A; 1Y1O A; 4E6Z A; 3BT7 A; 4TKK A; 4G6V A; 2INB A; 2VLD A; 3IEY B; 1A79 A; 1R0V A; 3P1Y A; 3P1Z A; 2WJ0 A; 2GW6 A; 3DNX A; 2FCO A; 4TKD A; 1OB9 A; 1F1Z A; 1OB8 A; 2W8M A; 2ZYZ A; 1XMX A; 4QBN A; 1RLV A; 4DAV A; 4DA2 A; 4DAP A; 3IEY A; 2DBS A; 2VS1 A; 1RZN A; 3AJV B; 2OST A; 2WCW A; 2FLC A; 1R11 A; 5FDK A; 1IPI A; 3FOV A; #chains in the Genus database with same CATH homology 2FL3 A; 2WIW A; 2CZR A; 1GEF A; 2FKH B; 4G6U A; 4EV1 A; 4LQE A; 2BH2 A; 2GJW A; 4QBO A; 2JJQ A; 2OKF A; 1UWV A; 2Z0R A; 3AJV A; 3P1Z B; 4ZQU A; 2WIZ A; 2WCZ A; 1YNM A; 1T0F A; 2FKC A; 1HH1 A; 1Y88 A; 1ZP7 A; 2EO0 A; 2ZYZ B; 2CV8 A; 2IXS A; 3IF0 X; 4QBL A; 1Y1O A; 4E6Z A; 3BT7 A; 4TKK A; 4G6V A; 2INB A; 2VLD A; 3IEY B; 1A79 A; 1R0V A; 3P1Y A; 3P1Z A; 2WJ0 A; 2GW6 A; 3DNX A; 2FCO A; 4TKD A; 1OB9 A; 1F1Z A; 1OB8 A; 2W8M A; 2ZYZ A; 1XMX A; 4QBN A; 1RLV A; 4DAV A; 4DA2 A; 4DAP A; 3IEY A; 2DBS A; 2VS1 A; 1RZN A; 3AJV B; 2OST A; 2WCW A; 2FLC A; 1R11 A; 5FDK A; 1IPI A; 3FOV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
