4AVUA

Crystal structure of human tankyrase 2 in complex with 6(5h)- phenanthridinone
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Evaluation and Structural Basis for the Inhibition of Tankyrases by Parp Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4avuA00
4OQBC 3FHBA 4RV6A 5A00A 2X5YA 4HKNA 4TJYA 3GN7A 5ADSA 4OA7A 4HLKA 4UX4A 4HLHA 4TK5A 4L7LA 2RF5A 5ETYA 4R5WA 2RD6A 4L31A 4BUEA 4BUIA 5LYHA 4ZZXA 4GV7A 4W5SA 3HKVA 4UI8A 4KZLA 4KZQA 4TKGA 5DCZA 3UH4A 3KJDA 4L2FA 4W5IA 3UDDA 4GV2A 4BUSA 4LI6A 4L2GA 4J3MA 4L7RA 4W6EA 4ZZZA 5ADRA 4HL5A 4UVNA 3GOYA 3GEYA 3UA9A 4PNNA 5AEHA 5LXPA 4K4FA 5AL4A 3BLJA 3SE2A 4HKKA 3L3LA 4J21A 2PAXA 2RCWA 4UI3A 4L0SA 4UVLA 4TJWA 4UXBA 4HHYA 4BUWA 4L7UA 1UK1A 4TJUA 3GJWA 4HMHA 3SMJA 4PMLA 5C5PA 4GV0A 5FPFA 4KZUA 3W51A 4BUAA 3L3MA 3P0NA 4K4EA 4TOSA 3U9YA 4OQAC 4BUDA 4MSGA 4PNTA 4UVZA 4PY4A 5C5QA 4PJVA 4BJCA 4PNSA 3C4HA 4HYFA 5AKWA 3U9HA 4L7PA 3KR7A 4DQYC 4GV4A 4L6SA 4M7BA 2PAWA 5AL5A 3SMIA 2PQFA 4UVPA 1UK0A 5FPGA 4BU9A 4L0TA 4PNMA 4PAXA 4UVXA 4PNLA 4MT9A 4XHUA 4BU5A 3KCZA 3KR8A 4BUTA 4UVSA 5ADQA 5AL3A 4UVOA 3MHKA 4L0IA 4UVTA 4AVUA 4L70A 4J1ZA 4UW1A 4UVYA 4BS4A 1GS0A 4UI6A 4LI7A 4F1LA 4UI4A 4PNQA 4OPXC 4N4VA 4UFUA 4BJBA 4R6EA 4L10A 4L34A 4U6AA 4UI7A 1WOKA 4BUXA 5AKUA 4BU6A 4L7NA 4L0BA 4HHZA 3P0QA 4TKIA 3C49A 5LX6A 4ZZYA 4J3LA 4L09A 4L32A 4F1QA 4UVWA 5C5RA 3PAXA 5AL2A 4DVIA 4HLFA 4UFYA 4HLMA 4X52A 1A26A 5ECEA 4L2KA 3UH2A 4BJ9A 3MHJA 4KRSA 4BUYA 4N3RA 4UHGA 1EFYA 4L6ZA 4BUFA 3P0PA 4I9IA 4L0VA 5ADTA 4HLGA 4TK0A 4BU7A 4BU8A 4UNDA 1PAXA 4F0EA 4PJTA 4BU3A 4L33A 5EBTA 4BUVA 4TKFA 4IUEA 4MSKA 4TVJA 3CE0A 4J22A 4UUHA 4AVWA 4UI5A 4PNRA 4N4TA 4UVUA 5AL1A 4BUUA 4LI8A 4TORA 4UVVA 4HKIA 4BFPA 4L7OA
chains in the Genus database with same CATH superfamily
4OQBC 3FHBA 4RV6A 5A00A 2X5YA 1AQ2A 4HKNA 4TJYA 3GN7A 5ADSA 4OA7A 4HLKA 4UX4A 4YW9A 4HLHA 4TK5A 4L7LA 2RF5A 4GNPA 5ETYA 1KHEA 4GNQA 4R5WA 1YTMA 4YW8A 2RD6A 4L31A 4BUEA 2QEYA 4BUIA 5LYHA 2RKAA 4ZZXA 1NHXA 4GV7A 4W5SA 3HKVA 4UI8A 1AYLA 2RKDA 4KZLA 4KZQA 2PY7X 4TKGA 1K3CA 5DCZA 5I67A 2QZYA 3UH4A 1YLHA 1II2A 1KHGA 3KJDA 4L2FA 4W5IA 4GV2A 3UDDA 4BUSA 2QEWA 4WPVA 4GNMA 2FAFA 4LI6A 3DT7A 2RKEA 3MOEA 4L2GA 4J3MA 4L7RA 4W6EA 4RCGA 4ZZZA 5ADRA 5FH3A 4HL5A 4OX2A 4UVNA 4R43A 3GOYA 3GEYA 3UA9A 2PC9A 1YGGA 4PNNA 5FH4A 5AEHA 5LXPA 4K4FA 5AL4A 3BLJA 3SE2A 4HKKA 3L3LA 4J21A 2PAXA 2RCWA 4GNLA 4UI3A 1J3BA 4L0SA 4UVLA 4TJWA 2OLRA 4HHYA 4UXBA 4BUWA 4L7UA 1UK1A 1KHFA 4TJUA 3DTBA 3GJWA 4HMHA 4WIEA 4WOUA 3SMJA 4PMLA 5C5PA 4GV0A 5FPFA 2OLQA 4KZUA 3W51A 4BUAA 3L3MA 3P0NA 1OENA 2GMVA 4K4EA 4TOSA 5FH2A 3U9YA 4WIUA 4OQAC 4BUDA 4MSGA 4PNTA 4UVZA 4WPTA 4PY4A 5C5QA 4PJVA 4BJCA 4PNSA 2ZCIA 3C4HA 4HYFA 5AKWA 3U9HA 4L7PA 3KR7A 4DQYC 4GV4A 2QF1A 4L6SA 4M7BA 2PAWA 3MOFA 1K3DA 5AL5A 3SMIA 2PQFA 4UVPA 1UK0A 5FPGA 4BU9A 4L0TA 4PNMA 3DT4A 4PAXA 4PNLA 4MT9A 4UVXA 4XHUA 3KCZA 3KR8A 4BU5A 4BUTA 4UVSA 5ADQA 2FAHA 1XKVA 5AL3A 2RK8A 4UVOA 3MHKA 4HKIA 4L0IA 4UVTA 3MOHA 4AVUA 4L70A 4J1ZA 4UW1A 4UVYA 4BS4A 1YVYA 1GS0A 4UI6A 4LI7A 4F1LA 4UI4A 4PNQA 4OPXC 1KHBA 4N4VA 4UFUA 4BJBA 1M51A 4R6EA 4WPUA 4L10A 4L34A 4U6AA 4UI7A 1WOKA 4BUXA 5AKUA 4BU6A 4L7NA 4L0BA 3P0QA 4HHZA 2QF2A 4TKIA 3C49A 5LX6A 4ZZYA 4J3LA 4L09A 4L32A 4F1QA 4UVWA 4GMZA 5C5RA 3PAXA 5AL2A 4DVIA 4HLFA 4UFYA 4HLMA 4X52A 1A26A 5ECEA 4L2KA 3UH2A 4BJ9A 3MHJA 4KRSA 4BUYA 4YWBA 5FH5A 4N3RA 1OS1A 1EFYA 2RK7A 4L6ZA 5FH1A 4UHGA 4YWDA 4BUFA 3P0PA 4I9IA 4L0VA 5ADTA 4HLGA 2PXZX 5FH0A 3DT2A 4TK0A 4BU7A 4BU8A 4UNDA 1PAXA 4F0EA 4PJTA 4BU3A 4L33A 5EBTA 4BUVA 4TKFA 4WL8A 4IUEA 4MSKA 4TVJA 3CE0A 4J22A 4UUHA 4GMUA 4AVWA 4UI5A 4PNRA 4N4TA 4UVUA 5AL1A 4BUUA 4GMMA 4LI8A 4GNOA 4TORA 4UVVA 4GMWA 4BFPA 4L7OA
chains in the Genus database with same CATH topology
4OQBC 3FHBA 4RV6A 5A00A 2X5YA 1AQ2A 4HKNA 4TJYA 3GN7A 5ADSA 4OA7A 4HLKA 4UX4A 4YW9A 4HLHA 4TK5A 4L7LA 2RF5A 4GNPA 5ETYA 1KHEA 4GNQA 4R5WA 1YTMA 4YW8A 2RD6A 4L31A 4BUEA 2QEYA 4BUIA 5LYHA 2RKAA 4ZZXA 1NHXA 4GV7A 4W5SA 3HKVA 4UI8A 1AYLA 2RKDA 4KZLA 4KZQA 2PY7X 4TKGA 1K3CA 5DCZA 5I67A 2QZYA 3UH4A 1YLHA 1II2A 1KHGA 3KJDA 4L2FA 4W5IA 4GV2A 3UDDA 4BUSA 2QEWA 4WPVA 4GNMA 2FAFA 4LI6A 3DT7A 2RKEA 3MOEA 4L2GA 4J3MA 4L7RA 4W6EA 4RCGA 4ZZZA 5ADRA 5FH3A 4HL5A 4OX2A 4UVNA 4R43A 3GOYA 3GEYA 3UA9A 2PC9A 1YGGA 4PNNA 5FH4A 5AEHA 5LXPA 4K4FA 5AL4A 3BLJA 3SE2A 4HKKA 3L3LA 4J21A 2PAXA 2RCWA 4GNLA 4UI3A 1J3BA 4L0SA 4UVLA 4TJWA 2OLRA 4HHYA 4UXBA 4BUWA 4L7UA 1UK1A 1KHFA 4TJUA 3DTBA 3GJWA 4HMHA 4WIEA 4WOUA 3SMJA 4PMLA 5C5PA 4GV0A 5FPFA 2OLQA 4KZUA 3W51A 4BUAA 3L3MA 3P0NA 1OENA 2GMVA 4K4EA 4TOSA 5FH2A 3U9YA 4WIUA 4OQAC 4BUDA 4MSGA 4PNTA 4UVZA 4WPTA 4PY4A 5C5QA 4PJVA 4BJCA 4PNSA 2ZCIA 3C4HA 4HYFA 5AKWA 3U9HA 4L7PA 3KR7A 4DQYC 4GV4A 2QF1A 4L6SA 4M7BA 2PAWA 3MOFA 1K3DA 5AL5A 3SMIA 2PQFA 4UVPA 1UK0A 5FPGA 4BU9A 4L0TA 4PNMA 3DT4A 4PAXA 4PNLA 4MT9A 4UVXA 4XHUA 3KCZA 3KR8A 4BU5A 4BUTA 4UVSA 5ADQA 2FAHA 1XKVA 5AL3A 2RK8A 4UVOA 3MHKA 4HKIA 4L0IA 4UVTA 3MOHA 4AVUA 4L70A 4J1ZA 4UW1A 4UVYA 4BS4A 1YVYA 1GS0A 4UI6A 4LI7A 4F1LA 4UI4A 4PNQA 4OPXC 1KHBA 4N4VA 4UFUA 4BJBA 1M51A 4R6EA 4WPUA 4L10A 4L34A 4U6AA 4UI7A 1WOKA 4BUXA 5AKUA 4BU6A 4L7NA 4L0BA 3P0QA 4HHZA 2QF2A 4TKIA 3C49A 5LX6A 4ZZYA 4J3LA 4L09A 4L32A 4F1QA 4UVWA 4GMZA 5C5RA 3PAXA 5AL2A 4DVIA 4HLFA 4UFYA 4HLMA 4X52A 1A26A 5ECEA 4L2KA 3UH2A 4BJ9A 3MHJA 4KRSA 4BUYA 4YWBA 5FH5A 4N3RA 1OS1A 1EFYA 2RK7A 4L6ZA 5FH1A 4UHGA 4YWDA 4BUFA 3P0PA 4I9IA 4L0VA 5ADTA 4HLGA 2PXZX 5FH0A 3DT2A 4TK0A 4BU7A 4BU8A 4UNDA 1PAXA 4F0EA 4PJTA 4BU3A 4L33A 5EBTA 4BUVA 4TKFA 4WL8A 4IUEA 4MSKA 4TVJA 3CE0A 4J22A 4UUHA 4GMUA 4AVWA 4UI5A 4PNRA 4N4TA 4UVUA 5AL1A 4BUUA 4GMMA 4LI8A 4GNOA 4TORA 4UVVA 4GMWA 4BFPA 4L7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQB C;  3FHB A;  4RV6 A;  5A00 A;  2X5Y A;  4HKN A;  4TJY A;  3GN7 A;  5ADS A;  4OA7 A;  4HLK A;  4UX4 A;  4HLH A;  4TK5 A;  4L7L A;  2RF5 A;  5ETY A;  4R5W A;  2RD6 A;  4L31 A;  4BUE A;  4BUI A;  5LYH A;  4ZZX A;  4GV7 A;  4W5S A;  3HKV A;  4UI8 A;  4KZL A;  4KZQ A;  4TKG A;  5DCZ A;  3UH4 A;  3KJD A;  4L2F A;  4W5I A;  3UDD A;  4GV2 A;  4BUS A;  4LI6 A;  4L2G A;  4J3M A;  4L7R A;  4W6E A;  4ZZZ A;  5ADR A;  4HL5 A;  4UVN A;  3GOY A;  3GEY A;  3UA9 A;  4PNN A;  5AEH A;  5LXP A;  4K4F A;  5AL4 A;  3BLJ A;  3SE2 A;  4HKK A;  3L3L A;  4J21 A;  2PAX A;  2RCW A;  4UI3 A;  4L0S A;  4UVL A;  4TJW A;  4UXB A;  4HHY A;  4BUW A;  4L7U A;  1UK1 A;  4TJU A;  3GJW A;  4HMH A;  3SMJ A;  4PML A;  5C5P A;  4GV0 A;  5FPF A;  4KZU A;  3W51 A;  4BUA A;  3L3M A;  3P0N A;  4K4E A;  4TOS A;  3U9Y A;  4OQA C;  4BUD A;  4MSG A;  4PNT A;  4UVZ A;  4PY4 A;  5C5Q A;  4PJV A;  4BJC A;  4PNS A;  3C4H A;  4HYF A;  5AKW A;  3U9H A;  4L7P A;  3KR7 A;  4DQY C;  4GV4 A;  4L6S A;  4M7B A;  2PAW A;  5AL5 A;  3SMI A;  2PQF A;  4UVP A;  1UK0 A;  5FPG A;  4BU9 A;  4L0T A;  4PNM A;  4PAX A;  4UVX A;  4PNL A;  4MT9 A;  4XHU A;  4BU5 A;  3KCZ A;  3KR8 A;  4BUT A;  4UVS A;  5ADQ A;  5AL3 A;  4UVO A;  3MHK A;  4L0I A;  4UVT A;  4AVU A;  4L70 A;  4J1Z A;  4UW1 A;  4UVY A;  4BS4 A;  1GS0 A;  4UI6 A;  4LI7 A;  4F1L A;  4UI4 A;  4PNQ A;  4OPX C;  4N4V A;  4UFU A;  4BJB A;  4R6E A;  4L10 A;  4L34 A;  4U6A A;  4UI7 A;  1WOK A;  4BUX A;  5AKU A;  4BU6 A;  4L7N A;  4L0B A;  4HHZ A;  3P0Q A;  4TKI A;  3C49 A;  5LX6 A;  4ZZY A;  4J3L A;  4L09 A;  4L32 A;  4F1Q A;  4UVW A;  5C5R A;  3PAX A;  5AL2 A;  4DVI A;  4HLF A;  4UFY A;  4HLM A;  4X52 A;  1A26 A;  5ECE A;  4L2K A;  3UH2 A;  4BJ9 A;  3MHJ A;  4KRS A;  4BUY A;  4N3R A;  4UHG A;  1EFY A;  4L6Z A;  4BUF A;  3P0P A;  4I9I A;  4L0V A;  5ADT A;  4HLG A;  4TK0 A;  4BU7 A;  4BU8 A;  4UND A;  1PAX A;  4F0E A;  4PJT A;  4BU3 A;  4L33 A;  5EBT A;  4BUV A;  4TKF A;  4IUE A;  4MSK A;  4TVJ A;  3CE0 A;  4J22 A;  4UUH A;  4AVW A;  4UI5 A;  4PNR A;  4N4T A;  4UVU A;  5AL1 A;  4BUU A;  4LI8 A;  4TOR A;  4UVV A;  4HKI A;  4BFP A;  4L7O A; 
#chains in the Genus database with same CATH topology
 4OQB C;  3FHB A;  4RV6 A;  5A00 A;  2X5Y A;  1AQ2 A;  4HKN A;  4TJY A;  3GN7 A;  5ADS A;  4OA7 A;  4HLK A;  4UX4 A;  4YW9 A;  4HLH A;  4TK5 A;  4L7L A;  2RF5 A;  4GNP A;  5ETY A;  1KHE A;  4GNQ A;  4R5W A;  1YTM A;  4YW8 A;  2RD6 A;  4L31 A;  4BUE A;  2QEY A;  4BUI A;  5LYH A;  2RKA A;  4ZZX A;  1NHX A;  4GV7 A;  4W5S A;  3HKV A;  4UI8 A;  1AYL A;  2RKD A;  4KZL A;  4KZQ A;  2PY7 X;  4TKG A;  1K3C A;  5DCZ A;  5I67 A;  2QZY A;  3UH4 A;  1YLH A;  1II2 A;  1KHG A;  3KJD A;  4L2F A;  4W5I A;  4GV2 A;  3UDD A;  4BUS A;  2QEW A;  4WPV A;  4GNM A;  2FAF A;  4LI6 A;  3DT7 A;  2RKE A;  3MOE A;  4L2G A;  4J3M A;  4L7R A;  4W6E A;  4RCG A;  4ZZZ A;  5ADR A;  5FH3 A;  4HL5 A;  4OX2 A;  4UVN A;  4R43 A;  3GOY A;  3GEY A;  3UA9 A;  2PC9 A;  1YGG A;  4PNN A;  5FH4 A;  5AEH A;  5LXP A;  4K4F A;  5AL4 A;  3BLJ A;  3SE2 A;  4HKK A;  3L3L A;  4J21 A;  2PAX A;  2RCW A;  4GNL A;  4UI3 A;  1J3B A;  4L0S A;  4UVL A;  4TJW A;  2OLR A;  4HHY A;  4UXB A;  4BUW A;  4L7U A;  1UK1 A;  1KHF A;  4TJU A;  3DTB A;  3GJW A;  4HMH A;  4WIE A;  4WOU A;  3SMJ A;  4PML A;  5C5P A;  4GV0 A;  5FPF A;  2OLQ A;  4KZU A;  3W51 A;  4BUA A;  3L3M A;  3P0N A;  1OEN A;  2GMV A;  4K4E A;  4TOS A;  5FH2 A;  3U9Y A;  4WIU A;  4OQA C;  4BUD A;  4MSG A;  4PNT A;  4UVZ A;  4WPT A;  4PY4 A;  5C5Q A;  4PJV A;  4BJC A;  4PNS A;  2ZCI A;  3C4H A;  4HYF A;  5AKW A;  3U9H A;  4L7P A;  3KR7 A;  4DQY C;  4GV4 A;  2QF1 A;  4L6S A;  4M7B A;  2PAW A;  3MOF A;  1K3D A;  5AL5 A;  3SMI A;  2PQF A;  4UVP A;  1UK0 A;  5FPG A;  4BU9 A;  4L0T A;  4PNM A;  3DT4 A;  4PAX A;  4PNL A;  4MT9 A;  4UVX A;  4XHU A;  3KCZ A;  3KR8 A;  4BU5 A;  4BUT A;  4UVS A;  5ADQ A;  2FAH A;  1XKV A;  5AL3 A;  2RK8 A;  4UVO A;  3MHK A;  4HKI A;  4L0I A;  4UVT A;  3MOH A;  4AVU A;  4L70 A;  4J1Z A;  4UW1 A;  4UVY A;  4BS4 A;  1YVY A;  1GS0 A;  4UI6 A;  4LI7 A;  4F1L A;  4UI4 A;  4PNQ A;  4OPX C;  1KHB A;  4N4V A;  4UFU A;  4BJB A;  1M51 A;  4R6E A;  4WPU A;  4L10 A;  4L34 A;  4U6A A;  4UI7 A;  1WOK A;  4BUX A;  5AKU A;  4BU6 A;  4L7N A;  4L0B A;  3P0Q A;  4HHZ A;  2QF2 A;  4TKI A;  3C49 A;  5LX6 A;  4ZZY A;  4J3L A;  4L09 A;  4L32 A;  4F1Q A;  4UVW A;  4GMZ A;  5C5R A;  3PAX A;  5AL2 A;  4DVI A;  4HLF A;  4UFY A;  4HLM A;  4X52 A;  1A26 A;  5ECE A;  4L2K A;  3UH2 A;  4BJ9 A;  3MHJ A;  4KRS A;  4BUY A;  4YWB A;  5FH5 A;  4N3R A;  1OS1 A;  1EFY A;  2RK7 A;  4L6Z A;  5FH1 A;  4UHG A;  4YWD A;  4BUF A;  3P0P A;  4I9I A;  4L0V A;  5ADT A;  4HLG A;  2PXZ X;  5FH0 A;  3DT2 A;  4TK0 A;  4BU7 A;  4BU8 A;  4UND A;  1PAX A;  4F0E A;  4PJT A;  4BU3 A;  4L33 A;  5EBT A;  4BUV A;  4TKF A;  4WL8 A;  4IUE A;  4MSK A;  4TVJ A;  3CE0 A;  4J22 A;  4UUH A;  4GMU A;  4AVW A;  4UI5 A;  4PNR A;  4N4T A;  4UVU A;  5AL1 A;  4BUU A;  4GMM A;  4LI8 A;  4GNO A;  4TOR A;  4UVV A;  4GMW A;  4BFP A;  4L7O A; 
#chains in the Genus database with same CATH homology
 4OQB C;  3FHB A;  4RV6 A;  5A00 A;  2X5Y A;  1AQ2 A;  4HKN A;  4TJY A;  3GN7 A;  5ADS A;  4OA7 A;  4HLK A;  4UX4 A;  4YW9 A;  4HLH A;  4TK5 A;  4L7L A;  2RF5 A;  4GNP A;  5ETY A;  1KHE A;  4GNQ A;  4R5W A;  1YTM A;  4YW8 A;  2RD6 A;  4L31 A;  4BUE A;  2QEY A;  4BUI A;  5LYH A;  2RKA A;  4ZZX A;  1NHX A;  4GV7 A;  4W5S A;  3HKV A;  4UI8 A;  1AYL A;  2RKD A;  4KZL A;  4KZQ A;  2PY7 X;  4TKG A;  1K3C A;  5DCZ A;  5I67 A;  2QZY A;  3UH4 A;  1YLH A;  1II2 A;  1KHG A;  3KJD A;  4L2F A;  4W5I A;  4GV2 A;  3UDD A;  4BUS A;  2QEW A;  4WPV A;  4GNM A;  2FAF A;  4LI6 A;  3DT7 A;  2RKE A;  3MOE A;  4L2G A;  4J3M A;  4L7R A;  4W6E A;  4RCG A;  4ZZZ A;  5ADR A;  5FH3 A;  4HL5 A;  4OX2 A;  4UVN A;  4R43 A;  3GOY A;  3GEY A;  3UA9 A;  2PC9 A;  1YGG A;  4PNN A;  5FH4 A;  5AEH A;  5LXP A;  4K4F A;  5AL4 A;  3BLJ A;  3SE2 A;  4HKK A;  3L3L A;  4J21 A;  2PAX A;  2RCW A;  4GNL A;  4UI3 A;  1J3B A;  4L0S A;  4UVL A;  4TJW A;  2OLR A;  4HHY A;  4UXB A;  4BUW A;  4L7U A;  1UK1 A;  1KHF A;  4TJU A;  3DTB A;  3GJW A;  4HMH A;  4WIE A;  4WOU A;  3SMJ A;  4PML A;  5C5P A;  4GV0 A;  5FPF A;  2OLQ A;  4KZU A;  3W51 A;  4BUA A;  3L3M A;  3P0N A;  1OEN A;  2GMV A;  4K4E A;  4TOS A;  5FH2 A;  3U9Y A;  4WIU A;  4OQA C;  4BUD A;  4MSG A;  4PNT A;  4UVZ A;  4WPT A;  4PY4 A;  5C5Q A;  4PJV A;  4BJC A;  4PNS A;  2ZCI A;  3C4H A;  4HYF A;  5AKW A;  3U9H A;  4L7P A;  3KR7 A;  4DQY C;  4GV4 A;  2QF1 A;  4L6S A;  4M7B A;  2PAW A;  3MOF A;  1K3D A;  5AL5 A;  3SMI A;  2PQF A;  4UVP A;  1UK0 A;  5FPG A;  4BU9 A;  4L0T A;  4PNM A;  3DT4 A;  4PAX A;  4PNL A;  4MT9 A;  4UVX A;  4XHU A;  3KCZ A;  3KR8 A;  4BU5 A;  4BUT A;  4UVS A;  5ADQ A;  2FAH A;  1XKV A;  5AL3 A;  2RK8 A;  4UVO A;  3MHK A;  4HKI A;  4L0I A;  4UVT A;  3MOH A;  4AVU A;  4L70 A;  4J1Z A;  4UW1 A;  4UVY A;  4BS4 A;  1YVY A;  1GS0 A;  4UI6 A;  4LI7 A;  4F1L A;  4UI4 A;  4PNQ A;  4OPX C;  1KHB A;  4N4V A;  4UFU A;  4BJB A;  1M51 A;  4R6E A;  4WPU A;  4L10 A;  4L34 A;  4U6A A;  4UI7 A;  1WOK A;  4BUX A;  5AKU A;  4BU6 A;  4L7N A;  4L0B A;  3P0Q A;  4HHZ A;  2QF2 A;  4TKI A;  3C49 A;  5LX6 A;  4ZZY A;  4J3L A;  4L09 A;  4L32 A;  4F1Q A;  4UVW A;  4GMZ A;  5C5R A;  3PAX A;  5AL2 A;  4DVI A;  4HLF A;  4UFY A;  4HLM A;  4X52 A;  1A26 A;  5ECE A;  4L2K A;  3UH2 A;  4BJ9 A;  3MHJ A;  4KRS A;  4BUY A;  4YWB A;  5FH5 A;  4N3R A;  1OS1 A;  1EFY A;  2RK7 A;  4L6Z A;  5FH1 A;  4UHG A;  4YWD A;  4BUF A;  3P0P A;  4I9I A;  4L0V A;  5ADT A;  4HLG A;  2PXZ X;  5FH0 A;  3DT2 A;  4TK0 A;  4BU7 A;  4BU8 A;  4UND A;  1PAX A;  4F0E A;  4PJT A;  4BU3 A;  4L33 A;  5EBT A;  4BUV A;  4TKF A;  4WL8 A;  4IUE A;  4MSK A;  4TVJ A;  3CE0 A;  4J22 A;  4UUH A;  4GMU A;  4AVW A;  4UI5 A;  4PNR A;  4N4T A;  4UVU A;  5AL1 A;  4BUU A;  4GMM A;  4LI8 A;  4GNO A;  4TOR A;  4UVV A;  4GMW A;  4BFP A;  4L7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...