4BFPA

Crystal structure of human tankyrase 2 in complex with wiki4
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Structural Basis and Selectivity of Tankyrase Inhibition by a Wnt Signaling Inhibitor Wiki4
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bfpA00
4L6ZA 5AL5A 4BUSA 4L0SA 4MSKA 4W5IA 4N4VA 3HKVA 4TVJA 4J3MA 4L33A 5FPFA 4UVLA 3UH2A 4UVTA 4L34A 4BJBA 4PNNA 4TK0A 3PAXA 3KR8A 4L09A 4M7BA 3GN7A 4UFYA 3SMJA 4BU3A 3W51A 3U9HA 4TORA 4ZZZA 4UI3A 4UVPA 4BUEA 3FHBA 2X5YA 4L2FA 4L32A 4HLFA 4BUAA 4L7NA 3MHKA 4PJVA 4HKIA 4HYFA 4AVUA 4L7RA 1GS0A 4PAXA 3P0QA 4TOSA 4OA7A 4ZZYA 5LYHA 2PAWA 1WOKA 4L0TA 4PNLA 4BUDA 4F1QA 4R5WA 4HMHA 4UVUA 5ADSA 4K4EA 4PY4A 3CE0A 4KZQA 4TKIA 4TJWA 4UVOA 5AEHA 4N3RA 3MHJA 3GEYA 3KR7A 4MSGA 5FPGA 4BS4A 4PNMA 4N4TA 4L0IA 4HHYA 4UNDA 4L0VA 3L3LA 4L2KA 4PNQA 4TKGA 3UDDA 4LI7A 4OQBC 4X52A 3GJWA 4UX4A 2RCWA 4PNTA 4BUVA 4XHUA 5EBTA 4BJ9A 4LI8A 5ADRA 4RV6A 3UH4A 3GOYA 4LI6A 5AKUA 4L7PA 4HKKA 3BLJA 4R6EA 4BU9A 4GV2A 3U9YA 4BU6A 4U6AA 4UFUA 4UUHA 5AKWA 4K4FA 4KRSA 4UW1A 5C5PA 4HKNA 2PQFA 4BUIA 4DQYC 5AL3A 1UK0A 5AL2A 5AL4A 5C5QA 5ECEA 4BU7A 1EFYA 4L7UA 4BUYA 3SMIA 4UHGA 4UVNA 4HL5A 4L0BA 4UXBA 1A26A 4L7OA 4KZLA 3UA9A 4I9IA 4L70A 4TJYA 4F0EA 5DCZA 4W6EA 4MT9A 4BJCA 4L10A 4ZZXA 4BU8A 4UVSA 3SE2A 4UVWA 3P0PA 4PJTA 4DVIA 4BU5A 4HLHA 3L3MA 5AL1A 5ADQA 4F1LA 4J1ZA 4PNSA 5LX6A 3KCZA 5A00A 5ETYA 4BFPA 4UVXA 4UI5A 4L7LA 4UI8A 4PNRA 4BUUA 5LXPA 4UI6A 3C4HA 4GV0A 4BUFA 4L31A 4AVWA 4HLMA 2RD6A 4J21A 4HHZA 3KJDA 4HLKA 4J22A 4UVZA 4GV7A 4IUEA 5ADTA 4J3LA 4HLGA 3C49A 4TK5A 4W5SA 2RF5A 4OQAC 4L2GA 4BUWA 1PAXA 4TKFA 4PMLA 4UVVA 5C5RA 4KZUA 4BUTA 4BUXA 4UI4A 4UVYA 4OPXC 4GV4A 4UI7A 4TJUA 3P0NA 2PAXA 4L6SA 1UK1A
chains in the Genus database with same CATH superfamily
4L6ZA 5AL5A 4BUSA 4L0SA 4MSKA 5FH4A 2FAHA 4N4VA 4W5IA 3HKVA 4GNQA 4TVJA 1AQ2A 1YLHA 4J3MA 4L33A 4WPVA 5FPFA 4WIEA 4GMZA 4UVLA 3UH2A 3MOFA 4L34A 4UVTA 4PNNA 4BJBA 3PAXA 4TK0A 3KR8A 4L09A 1KHBA 4M7BA 2FAFA 1K3CA 5FH1A 3GN7A 4UFYA 3SMJA 4BU3A 3W51A 3U9HA 4TORA 4YW9A 4ZZZA 4UI3A 4UVPA 4BUEA 1II2A 3FHBA 2X5YA 4L2FA 4L32A 2QEWA 4HLFA 4BUAA 4L7NA 2OLRA 3MHKA 4PJVA 5FH0A 4HKIA 4HYFA 4AVUA 2RK7A 4GMMA 4L7RA 2QZYA 1GS0A 3P0QA 4PAXA 4OA7A 4TOSA 4ZZYA 2RKAA 5LYHA 2PAWA 1WOKA 4L0TA 4PNLA 4BUDA 4WL8A 4F1QA 4R5WA 4HMHA 4UVUA 5ADSA 4K4EA 4PY4A 2RKEA 3CE0A 4KZQA 4TKIA 1K3DA 2PY7X 4TJWA 4N3RA 4UVOA 5AEHA 3DT4A 3MHJA 4YWDA 1M51A 3GEYA 3DT7A 3KR7A 4MSGA 5FPGA 4BS4A 4PNMA 4N4TA 4L0IA 4HHYA 1KHGA 4GMUA 4UNDA 4L0VA 3L3LA 4L2KA 4PNQA 4TKGA 2GMVA 3UDDA 4LI7A 4OQBC 4X52A 1KHEA 3GJWA 4UX4A 2RCWA 1XKVA 1YVYA 3DTBA 4PNTA 4WIUA 4XHUA 4LI8A 3MOHA 5EBTA 4BJ9A 4BUVA 4RV6A 3UH4A 5ADRA 3GOYA 4LI6A 5AKUA 1YTMA 4L7PA 4HKKA 3BLJA 4R6EA 4BU9A 4GV2A 4GMWA 3U9YA 2PXZX 4GNMA 4U6AA 4UFUA 4UUHA 5AKWA 4GNOA 4K4FA 4YW8A 4KRSA 4BU6A 4UW1A 5C5PA 4HKNA 1NHXA 2PQFA 4BUIA 4DQYC 1YGGA 3MOEA 1UK0A 4WPTA 5AL3A 5AL2A 5AL4A 5C5QA 2PC9A 5ECEA 4BU7A 1EFYA 4L7UA 4WOUA 1OENA 4YWBA 4BUYA 3SMIA 4UHGA 4UVNA 4HL5A 4L0BA 4UXBA 1A26A 4L7OA 4KZLA 3UA9A 4I9IA 4L70A 4OX2A 4TJYA 4F0EA 5I67A 5DCZA 2QF2A 1KHFA 2QF1A 4MT9A 4W6EA 4BJCA 4L10A 4ZZXA 4BU8A 1AYLA 4UVSA 3SE2A 4UVWA 3P0PA 4PJTA 2RK8A 4DVIA 2ZCIA 4HLHA 4BU5A 3L3MA 2OLQA 5AL1A 4GNLA 4RCGA 4F1LA 5ADQA 4J1ZA 2RKDA 4PNSA 5LX6A 3KCZA 5A00A 5ETYA 4BFPA 4UVXA 4UI5A 5FH5A 4L7LA 4UI8A 4PNRA 1OS1A 4BUUA 5LXPA 4UI6A 3C4HA 4GV0A 5FH2A 4BUFA 4L31A 4GNPA 4R43A 4AVWA 4HLMA 2RD6A 4J21A 4HHZA 1J3BA 2QEYA 3KJDA 4HLKA 4J22A 4UVZA 4GV7A 4IUEA 5ADTA 3DT2A 4J3LA 4HLGA 3C49A 4TK5A 4W5SA 2RF5A 4WPUA 4OQAC 4L2GA 5FH3A 4BUWA 1PAXA 4TKFA 4PMLA 4UVVA 5C5RA 4KZUA 4BUTA 4BUXA 4UI4A 4UVYA 4OPXC 4GV4A 4UI7A 4TJUA 3P0NA 2PAXA 4L6SA 1UK1A
chains in the Genus database with same CATH topology
4L6ZA 5AL5A 4BUSA 4L0SA 4MSKA 5FH4A 2FAHA 4N4VA 4W5IA 3HKVA 4GNQA 4TVJA 1AQ2A 1YLHA 4J3MA 4L33A 4WPVA 5FPFA 4WIEA 4GMZA 4UVLA 3UH2A 3MOFA 4L34A 4UVTA 4PNNA 4BJBA 3PAXA 4TK0A 3KR8A 4L09A 1KHBA 4M7BA 2FAFA 1K3CA 5FH1A 3GN7A 4UFYA 3SMJA 4BU3A 3W51A 3U9HA 4TORA 4YW9A 4ZZZA 4UI3A 4UVPA 4BUEA 1II2A 3FHBA 2X5YA 4L2FA 4L32A 2QEWA 4HLFA 4BUAA 4L7NA 2OLRA 3MHKA 4PJVA 5FH0A 4HKIA 4HYFA 4AVUA 2RK7A 4GMMA 4L7RA 2QZYA 1GS0A 3P0QA 4PAXA 4OA7A 4TOSA 4ZZYA 2RKAA 5LYHA 2PAWA 1WOKA 4L0TA 4PNLA 4BUDA 4WL8A 4F1QA 4R5WA 4HMHA 4UVUA 5ADSA 4K4EA 4PY4A 2RKEA 3CE0A 4KZQA 4TKIA 1K3DA 2PY7X 4TJWA 4N3RA 4UVOA 5AEHA 3DT4A 3MHJA 4YWDA 1M51A 3GEYA 3DT7A 3KR7A 4MSGA 5FPGA 4BS4A 4PNMA 4N4TA 4L0IA 4HHYA 1KHGA 4GMUA 4UNDA 4L0VA 3L3LA 4L2KA 4PNQA 4TKGA 2GMVA 3UDDA 4LI7A 4OQBC 4X52A 1KHEA 3GJWA 4UX4A 2RCWA 1XKVA 1YVYA 3DTBA 4PNTA 4WIUA 4XHUA 4LI8A 3MOHA 5EBTA 4BJ9A 4BUVA 4RV6A 3UH4A 5ADRA 3GOYA 4LI6A 5AKUA 1YTMA 4L7PA 4HKKA 3BLJA 4R6EA 4BU9A 4GV2A 4GMWA 3U9YA 2PXZX 4GNMA 4U6AA 4UFUA 4UUHA 5AKWA 4GNOA 4K4FA 4YW8A 4KRSA 4BU6A 4UW1A 5C5PA 4HKNA 1NHXA 2PQFA 4BUIA 4DQYC 1YGGA 3MOEA 1UK0A 4WPTA 5AL3A 5AL2A 5AL4A 5C5QA 2PC9A 5ECEA 4BU7A 1EFYA 4L7UA 4WOUA 1OENA 4YWBA 4BUYA 3SMIA 4UHGA 4UVNA 4HL5A 4L0BA 4UXBA 1A26A 4L7OA 4KZLA 3UA9A 4I9IA 4L70A 4OX2A 4TJYA 4F0EA 5I67A 5DCZA 2QF2A 1KHFA 2QF1A 4MT9A 4W6EA 4BJCA 4L10A 4ZZXA 4BU8A 1AYLA 4UVSA 3SE2A 4UVWA 3P0PA 4PJTA 2RK8A 4DVIA 2ZCIA 4HLHA 4BU5A 3L3MA 2OLQA 5AL1A 4GNLA 4RCGA 4F1LA 5ADQA 4J1ZA 2RKDA 4PNSA 5LX6A 3KCZA 5A00A 5ETYA 4BFPA 4UVXA 4UI5A 5FH5A 4L7LA 4UI8A 4PNRA 1OS1A 4BUUA 5LXPA 4UI6A 3C4HA 4GV0A 5FH2A 4BUFA 4L31A 4GNPA 4R43A 4AVWA 4HLMA 2RD6A 4J21A 4HHZA 1J3BA 2QEYA 3KJDA 4HLKA 4J22A 4UVZA 4GV7A 4IUEA 5ADTA 3DT2A 4J3LA 4HLGA 3C49A 4TK5A 4W5SA 2RF5A 4WPUA 4OQAC 4L2GA 5FH3A 4BUWA 1PAXA 4TKFA 4PMLA 4UVVA 5C5RA 4KZUA 4BUTA 4BUXA 4UI4A 4UVYA 4OPXC 4GV4A 4UI7A 4TJUA 3P0NA 2PAXA 4L6SA 1UK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6Z A;  5AL5 A;  4BUS A;  4L0S A;  4MSK A;  4W5I A;  4N4V A;  3HKV A;  4TVJ A;  4J3M A;  4L33 A;  5FPF A;  4UVL A;  3UH2 A;  4UVT A;  4L34 A;  4BJB A;  4PNN A;  4TK0 A;  3PAX A;  3KR8 A;  4L09 A;  4M7B A;  3GN7 A;  4UFY A;  3SMJ A;  4BU3 A;  3W51 A;  3U9H A;  4TOR A;  4ZZZ A;  4UI3 A;  4UVP A;  4BUE A;  3FHB A;  2X5Y A;  4L2F A;  4L32 A;  4HLF A;  4BUA A;  4L7N A;  3MHK A;  4PJV A;  4HKI A;  4HYF A;  4AVU A;  4L7R A;  1GS0 A;  4PAX A;  3P0Q A;  4TOS A;  4OA7 A;  4ZZY A;  5LYH A;  2PAW A;  1WOK A;  4L0T A;  4PNL A;  4BUD A;  4F1Q A;  4R5W A;  4HMH A;  4UVU A;  5ADS A;  4K4E A;  4PY4 A;  3CE0 A;  4KZQ A;  4TKI A;  4TJW A;  4UVO A;  5AEH A;  4N3R A;  3MHJ A;  3GEY A;  3KR7 A;  4MSG A;  5FPG A;  4BS4 A;  4PNM A;  4N4T A;  4L0I A;  4HHY A;  4UND A;  4L0V A;  3L3L A;  4L2K A;  4PNQ A;  4TKG A;  3UDD A;  4LI7 A;  4OQB C;  4X52 A;  3GJW A;  4UX4 A;  2RCW A;  4PNT A;  4BUV A;  4XHU A;  5EBT A;  4BJ9 A;  4LI8 A;  5ADR A;  4RV6 A;  3UH4 A;  3GOY A;  4LI6 A;  5AKU A;  4L7P A;  4HKK A;  3BLJ A;  4R6E A;  4BU9 A;  4GV2 A;  3U9Y A;  4BU6 A;  4U6A A;  4UFU A;  4UUH A;  5AKW A;  4K4F A;  4KRS A;  4UW1 A;  5C5P A;  4HKN A;  2PQF A;  4BUI A;  4DQY C;  5AL3 A;  1UK0 A;  5AL2 A;  5AL4 A;  5C5Q A;  5ECE A;  4BU7 A;  1EFY A;  4L7U A;  4BUY A;  3SMI A;  4UHG A;  4UVN A;  4HL5 A;  4L0B A;  4UXB A;  1A26 A;  4L7O A;  4KZL A;  3UA9 A;  4I9I A;  4L70 A;  4TJY A;  4F0E A;  5DCZ A;  4W6E A;  4MT9 A;  4BJC A;  4L10 A;  4ZZX A;  4BU8 A;  4UVS A;  3SE2 A;  4UVW A;  3P0P A;  4PJT A;  4DVI A;  4BU5 A;  4HLH A;  3L3M A;  5AL1 A;  5ADQ A;  4F1L A;  4J1Z A;  4PNS A;  5LX6 A;  3KCZ A;  5A00 A;  5ETY A;  4BFP A;  4UVX A;  4UI5 A;  4L7L A;  4UI8 A;  4PNR A;  4BUU A;  5LXP A;  4UI6 A;  3C4H A;  4GV0 A;  4BUF A;  4L31 A;  4AVW A;  4HLM A;  2RD6 A;  4J21 A;  4HHZ A;  3KJD A;  4HLK A;  4J22 A;  4UVZ A;  4GV7 A;  4IUE A;  5ADT A;  4J3L A;  4HLG A;  3C49 A;  4TK5 A;  4W5S A;  2RF5 A;  4OQA C;  4L2G A;  4BUW A;  1PAX A;  4TKF A;  4PML A;  4UVV A;  5C5R A;  4KZU A;  4BUT A;  4BUX A;  4UI4 A;  4UVY A;  4OPX C;  4GV4 A;  4UI7 A;  4TJU A;  3P0N A;  2PAX A;  4L6S A;  1UK1 A; 
#chains in the Genus database with same CATH topology
 4L6Z A;  5AL5 A;  4BUS A;  4L0S A;  4MSK A;  5FH4 A;  2FAH A;  4N4V A;  4W5I A;  3HKV A;  4GNQ A;  4TVJ A;  1AQ2 A;  1YLH A;  4J3M A;  4L33 A;  4WPV A;  5FPF A;  4WIE A;  4GMZ A;  4UVL A;  3UH2 A;  3MOF A;  4L34 A;  4UVT A;  4PNN A;  4BJB A;  3PAX A;  4TK0 A;  3KR8 A;  4L09 A;  1KHB A;  4M7B A;  2FAF A;  1K3C A;  5FH1 A;  3GN7 A;  4UFY A;  3SMJ A;  4BU3 A;  3W51 A;  3U9H A;  4TOR A;  4YW9 A;  4ZZZ A;  4UI3 A;  4UVP A;  4BUE A;  1II2 A;  3FHB A;  2X5Y A;  4L2F A;  4L32 A;  2QEW A;  4HLF A;  4BUA A;  4L7N A;  2OLR A;  3MHK A;  4PJV A;  5FH0 A;  4HKI A;  4HYF A;  4AVU A;  2RK7 A;  4GMM A;  4L7R A;  2QZY A;  1GS0 A;  3P0Q A;  4PAX A;  4OA7 A;  4TOS A;  4ZZY A;  2RKA A;  5LYH A;  2PAW A;  1WOK A;  4L0T A;  4PNL A;  4BUD A;  4WL8 A;  4F1Q A;  4R5W A;  4HMH A;  4UVU A;  5ADS A;  4K4E A;  4PY4 A;  2RKE A;  3CE0 A;  4KZQ A;  4TKI A;  1K3D A;  2PY7 X;  4TJW A;  4N3R A;  4UVO A;  5AEH A;  3DT4 A;  3MHJ A;  4YWD A;  1M51 A;  3GEY A;  3DT7 A;  3KR7 A;  4MSG A;  5FPG A;  4BS4 A;  4PNM A;  4N4T A;  4L0I A;  4HHY A;  1KHG A;  4GMU A;  4UND A;  4L0V A;  3L3L A;  4L2K A;  4PNQ A;  4TKG A;  2GMV A;  3UDD A;  4LI7 A;  4OQB C;  4X52 A;  1KHE A;  3GJW A;  4UX4 A;  2RCW A;  1XKV A;  1YVY A;  3DTB A;  4PNT A;  4WIU A;  4XHU A;  4LI8 A;  3MOH A;  5EBT A;  4BJ9 A;  4BUV A;  4RV6 A;  3UH4 A;  5ADR A;  3GOY A;  4LI6 A;  5AKU A;  1YTM A;  4L7P A;  4HKK A;  3BLJ A;  4R6E A;  4BU9 A;  4GV2 A;  4GMW A;  3U9Y A;  2PXZ X;  4GNM A;  4U6A A;  4UFU A;  4UUH A;  5AKW A;  4GNO A;  4K4F A;  4YW8 A;  4KRS A;  4BU6 A;  4UW1 A;  5C5P A;  4HKN A;  1NHX A;  2PQF A;  4BUI A;  4DQY C;  1YGG A;  3MOE A;  1UK0 A;  4WPT A;  5AL3 A;  5AL2 A;  5AL4 A;  5C5Q A;  2PC9 A;  5ECE A;  4BU7 A;  1EFY A;  4L7U A;  4WOU A;  1OEN A;  4YWB A;  4BUY A;  3SMI A;  4UHG A;  4UVN A;  4HL5 A;  4L0B A;  4UXB A;  1A26 A;  4L7O A;  4KZL A;  3UA9 A;  4I9I A;  4L70 A;  4OX2 A;  4TJY A;  4F0E A;  5I67 A;  5DCZ A;  2QF2 A;  1KHF A;  2QF1 A;  4MT9 A;  4W6E A;  4BJC A;  4L10 A;  4ZZX A;  4BU8 A;  1AYL A;  4UVS A;  3SE2 A;  4UVW A;  3P0P A;  4PJT A;  2RK8 A;  4DVI A;  2ZCI A;  4HLH A;  4BU5 A;  3L3M A;  2OLQ A;  5AL1 A;  4GNL A;  4RCG A;  4F1L A;  5ADQ A;  4J1Z A;  2RKD A;  4PNS A;  5LX6 A;  3KCZ A;  5A00 A;  5ETY A;  4BFP A;  4UVX A;  4UI5 A;  5FH5 A;  4L7L A;  4UI8 A;  4PNR A;  1OS1 A;  4BUU A;  5LXP A;  4UI6 A;  3C4H A;  4GV0 A;  5FH2 A;  4BUF A;  4L31 A;  4GNP A;  4R43 A;  4AVW A;  4HLM A;  2RD6 A;  4J21 A;  4HHZ A;  1J3B A;  2QEY A;  3KJD A;  4HLK A;  4J22 A;  4UVZ A;  4GV7 A;  4IUE A;  5ADT A;  3DT2 A;  4J3L A;  4HLG A;  3C49 A;  4TK5 A;  4W5S A;  2RF5 A;  4WPU A;  4OQA C;  4L2G A;  5FH3 A;  4BUW A;  1PAX A;  4TKF A;  4PML A;  4UVV A;  5C5R A;  4KZU A;  4BUT A;  4BUX A;  4UI4 A;  4UVY A;  4OPX C;  4GV4 A;  4UI7 A;  4TJU A;  3P0N A;  2PAX A;  4L6S A;  1UK1 A; 
#chains in the Genus database with same CATH homology
 4L6Z A;  5AL5 A;  4BUS A;  4L0S A;  4MSK A;  5FH4 A;  2FAH A;  4N4V A;  4W5I A;  3HKV A;  4GNQ A;  4TVJ A;  1AQ2 A;  1YLH A;  4J3M A;  4L33 A;  4WPV A;  5FPF A;  4WIE A;  4GMZ A;  4UVL A;  3UH2 A;  3MOF A;  4L34 A;  4UVT A;  4PNN A;  4BJB A;  3PAX A;  4TK0 A;  3KR8 A;  4L09 A;  1KHB A;  4M7B A;  2FAF A;  1K3C A;  5FH1 A;  3GN7 A;  4UFY A;  3SMJ A;  4BU3 A;  3W51 A;  3U9H A;  4TOR A;  4YW9 A;  4ZZZ A;  4UI3 A;  4UVP A;  4BUE A;  1II2 A;  3FHB A;  2X5Y A;  4L2F A;  4L32 A;  2QEW A;  4HLF A;  4BUA A;  4L7N A;  2OLR A;  3MHK A;  4PJV A;  5FH0 A;  4HKI A;  4HYF A;  4AVU A;  2RK7 A;  4GMM A;  4L7R A;  2QZY A;  1GS0 A;  3P0Q A;  4PAX A;  4OA7 A;  4TOS A;  4ZZY A;  2RKA A;  5LYH A;  2PAW A;  1WOK A;  4L0T A;  4PNL A;  4BUD A;  4WL8 A;  4F1Q A;  4R5W A;  4HMH A;  4UVU A;  5ADS A;  4K4E A;  4PY4 A;  2RKE A;  3CE0 A;  4KZQ A;  4TKI A;  1K3D A;  2PY7 X;  4TJW A;  4N3R A;  4UVO A;  5AEH A;  3DT4 A;  3MHJ A;  4YWD A;  1M51 A;  3GEY A;  3DT7 A;  3KR7 A;  4MSG A;  5FPG A;  4BS4 A;  4PNM A;  4N4T A;  4L0I A;  4HHY A;  1KHG A;  4GMU A;  4UND A;  4L0V A;  3L3L A;  4L2K A;  4PNQ A;  4TKG A;  2GMV A;  3UDD A;  4LI7 A;  4OQB C;  4X52 A;  1KHE A;  3GJW A;  4UX4 A;  2RCW A;  1XKV A;  1YVY A;  3DTB A;  4PNT A;  4WIU A;  4XHU A;  4LI8 A;  3MOH A;  5EBT A;  4BJ9 A;  4BUV A;  4RV6 A;  3UH4 A;  5ADR A;  3GOY A;  4LI6 A;  5AKU A;  1YTM A;  4L7P A;  4HKK A;  3BLJ A;  4R6E A;  4BU9 A;  4GV2 A;  4GMW A;  3U9Y A;  2PXZ X;  4GNM A;  4U6A A;  4UFU A;  4UUH A;  5AKW A;  4GNO A;  4K4F A;  4YW8 A;  4KRS A;  4BU6 A;  4UW1 A;  5C5P A;  4HKN A;  1NHX A;  2PQF A;  4BUI A;  4DQY C;  1YGG A;  3MOE A;  1UK0 A;  4WPT A;  5AL3 A;  5AL2 A;  5AL4 A;  5C5Q A;  2PC9 A;  5ECE A;  4BU7 A;  1EFY A;  4L7U A;  4WOU A;  1OEN A;  4YWB A;  4BUY A;  3SMI A;  4UHG A;  4UVN A;  4HL5 A;  4L0B A;  4UXB A;  1A26 A;  4L7O A;  4KZL A;  3UA9 A;  4I9I A;  4L70 A;  4OX2 A;  4TJY A;  4F0E A;  5I67 A;  5DCZ A;  2QF2 A;  1KHF A;  2QF1 A;  4MT9 A;  4W6E A;  4BJC A;  4L10 A;  4ZZX A;  4BU8 A;  1AYL A;  4UVS A;  3SE2 A;  4UVW A;  3P0P A;  4PJT A;  2RK8 A;  4DVI A;  2ZCI A;  4HLH A;  4BU5 A;  3L3M A;  2OLQ A;  5AL1 A;  4GNL A;  4RCG A;  4F1L A;  5ADQ A;  4J1Z A;  2RKD A;  4PNS A;  5LX6 A;  3KCZ A;  5A00 A;  5ETY A;  4BFP A;  4UVX A;  4UI5 A;  5FH5 A;  4L7L A;  4UI8 A;  4PNR A;  1OS1 A;  4BUU A;  5LXP A;  4UI6 A;  3C4H A;  4GV0 A;  5FH2 A;  4BUF A;  4L31 A;  4GNP A;  4R43 A;  4AVW A;  4HLM A;  2RD6 A;  4J21 A;  4HHZ A;  1J3B A;  2QEY A;  3KJD A;  4HLK A;  4J22 A;  4UVZ A;  4GV7 A;  4IUE A;  5ADT A;  3DT2 A;  4J3L A;  4HLG A;  3C49 A;  4TK5 A;  4W5S A;  2RF5 A;  4WPU A;  4OQA C;  4L2G A;  5FH3 A;  4BUW A;  1PAX A;  4TKF A;  4PML A;  4UVV A;  5C5R A;  4KZU A;  4BUT A;  4BUX A;  4UI4 A;  4UVY A;  4OPX C;  4GV4 A;  4UI7 A;  4TJU A;  3P0N A;  2PAX A;  4L6S A;  1UK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...