4BJ9A

Crystal structure of human tankyrase 2 in complex with eb-47
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
207
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Evaluation and Structural Basis for the Inhibition of Tankyrases by Parp Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 207
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bj9A00
4UNDA 3GOYA 4GV7A 4R5WA 4UVTA 5ETYA 4PNTA 4L0BA 4KZUA 4L33A 1GS0A 3GEYA 4PY4A 4TOSA 4UVYA 3SE2A 4BU3A 4L10A 4L31A 4L7PA 4GV0A 4UVSA 4UI4A 4J3LA 4RV6A 1WOKA 4F1QA 4UVOA 4TORA 4N4TA 3L3LA 3L3MA 4HLGA 4BFPA 5C5PA 4HHZA 4R6EA 4L7OA 4BU9A 4HLMA 4BUAA 4UVWA 4UVXA 4ZZZA 4PMLA 4OPXC 4UFUA 4BU6A 4J21A 4W5SA 2PAXA 4UI8A 4L6ZA 5FPFA 5AKWA 4PJTA 4LI7A 4AVUA 4UVVA 4UUHA 5FPGA 4BJBA 4UVUA 3FHBA 4BJCA 4UVNA 4BUDA 4BS4A 4L7NA 4PAXA 3UH4A 4TVJA 3P0PA 1A26A 4K4EA 4UVLA 1PAXA 4GV4A 4HKKA 3SMJA 2X5YA 4HLKA 2RD6A 4BU7A 4UHGA 3KR8A 2PQFA 4MSGA 4MT9A 4UXBA 3GN7A 5DCZA 5AL2A 4M7BA 3C4HA 4PNQA 4TK0A 4L70A 3GJWA 5C5QA 4N3RA 4BUIA 4LI8A 4UI3A 4XHUA 5A00A 3PAXA 5ECEA 4F0EA 4ZZXA 5AEHA 4UX4A 3U9YA 4L09A 3MHJA 4J3MA 4KRSA 5LXPA 5C5RA 4BU8A 4HLFA 4UW1A 4BUWA 4UFYA 4K4FA 4BUYA 4W5IA 4L34A 4U6AA 5AL5A 4L2KA 3SMIA 2PAWA 4L7UA 4BUSA 4HYFA 4DVIA 5AL1A 4AVWA 3CE0A 1UK1A 3MHKA 4MSKA 5AL3A 4L32A 4UI5A 4L2FA 4F1LA 4TJYA 4TKIA 4TK5A 4GV2A 4L0SA 3KR7A 4HKIA 4HL5A 4IUEA 4PNLA 4BUEA 5ADRA 4BUVA 4HLHA 3HKVA 4J1ZA 4OQBC 4L7RA 4BUTA 4BUXA 3P0NA 2RCWA 4HHYA 5EBTA 4UVPA 4BU5A 4L0IA 5LX6A 4PNMA 4UVZA 4BJ9A 4TKGA 5ADTA 4HKNA 4LI6A 5ADSA 4TJWA 4OA7A 3P0QA 1UK0A 3UDDA 4ZZYA 1EFYA 4HMHA 3U9HA 4W6EA 4L0VA 4UI6A 5AL4A 3UH2A 4X52A 5AKUA 4TKFA 4I9IA 3KCZA 4OQAC 4L6SA 4KZQA 4TJUA 3BLJA 4PNNA 4L0TA 4N4VA 2RF5A 3C49A 4BUUA 4UI7A 4L2GA 4PNSA 4L7LA 3W51A 5LYHA 4DQYC 3KJDA 3UA9A 4PJVA 4PNRA 4KZLA 5ADQA 4BUFA 4J22A
chains in the Genus database with same CATH superfamily
4UNDA 1KHFA 3GOYA 3MOFA 4GV7A 4R5WA 4UVTA 5ETYA 4PNTA 3SE2A 2QF2A 1OS1A 4L0BA 1GS0A 2ZCIA 3DT4A 3GEYA 4L33A 4KZUA 4GNLA 4L10A 4PY4A 4GMWA 4TOSA 4L31A 4L7PA 4GV0A 2PY7X 4UVSA 4UI4A 4J3LA 1YTMA 4RV6A 1WOKA 2FAHA 4F1QA 2PC9A 4UVOA 4GMZA 1K3DA 3MOEA 4N4TA 4TORA 3L3LA 3L3MA 4HLGA 4UVYA 4BFPA 5C5PA 4GNQA 4HHZA 1M51A 4R6EA 5FH3A 4L7OA 4BU9A 1K3CA 4HLMA 4UVWA 4BUAA 4UVXA 4ZZZA 4PMLA 4OPXC 4UFUA 4WPUA 4BU6A 4J21A 4W5SA 2PAXA 2GMVA 4UI8A 1YVYA 2RK7A 4L6ZA 3MOHA 5FPFA 5AKWA 4PJTA 4LI7A 4YWBA 4YWDA 4AVUA 4UVVA 4UUHA 5FPGA 1YGGA 4BJBA 2OLQA 4UVUA 3FHBA 4BJCA 4UVNA 4YW8A 4BS4A 4BUDA 4L7NA 4PAXA 3UH4A 4TVJA 3P0PA 1A26A 4K4EA 4UVLA 1PAXA 4GV4A 4HKKA 3SMJA 2X5YA 4HLKA 3DTBA 4RCGA 2RD6A 4WPTA 4BU7A 4UHGA 4R43A 3KR8A 2PQFA 2RK8A 4MSGA 4MT9A 3GN7A 4UXBA 2OLRA 5DCZA 5AL2A 4M7BA 4BUYA 3C4HA 4PNQA 4TK0A 4L70A 3GJWA 5C5QA 4N3RA 4BU3A 4BUIA 4LI8A 5FH5A 4UI3A 4XHUA 5A00A 4GMMA 3PAXA 5ECEA 4F0EA 2PXZX 4ZZXA 5AEHA 4GMUA 4UX4A 3U9YA 1AQ2A 4L09A 2RKEA 3MHJA 4J3MA 4KRSA 5LXPA 5C5RA 4BU8A 4HLFA 2RKDA 4UW1A 4YW9A 1KHEA 4K4FA 4UFYA 4W5IA 4L34A 4U6AA 5FH1A 1AYLA 4L2KA 5AL5A 3SMIA 2PAWA 4WIUA 4L7UA 4BUSA 4HYFA 4DVIA 5AL1A 4AVWA 3CE0A 2RKAA 1UK1A 3MHKA 4MSKA 1J3BA 5AL3A 1KHGA 4L32A 4UI5A 4L2FA 4BUWA 4F1LA 4TJYA 4TKIA 4TK5A 4GV2A 4L0SA 3KR7A 4HKIA 4HL5A 4IUEA 4PNLA 4BUEA 5ADRA 4BUVA 2QZYA 4HLHA 3HKVA 4J1ZA 5FH0A 4L7RA 4BUTA 4BUXA 4OQBC 4WIEA 3P0NA 2RCWA 4HHYA 5EBTA 1NHXA 4UVPA 4L0IA 4BU5A 5LX6A 3DT2A 4PNMA 4UVZA 4BJ9A 5I67A 4TKGA 5ADTA 4HKNA 1II2A 2QF1A 4LI6A 4TJWA 2QEYA 5ADSA 4OA7A 3P0QA 1UK0A 5FH4A 3UDDA 4ZZYA 4GNMA 1EFYA 4HMHA 3U9HA 4W6EA 4L0VA 4UI6A 5AL4A 3UH2A 4X52A 4WPVA 5AKUA 4TKFA 4I9IA 3KCZA 4OQAC 4L6SA 4KZQA 4TJUA 3DT7A 3BLJA 1KHBA 4PNNA 4L0TA 4N4VA 2RF5A 3C49A 4BUUA 4UI7A 4L2GA 4PNSA 2FAFA 4L7LA 5FH2A 3W51A 5LYHA 2QEWA 4WOUA 4WL8A 4OX2A 4DQYC 3KJDA 1YLHA 4PJVA 3UA9A 4PNRA 4KZLA 4GNPA 5ADQA 1XKVA 4GNOA 4BUFA 1OENA 4J22A
chains in the Genus database with same CATH topology
4UNDA 1KHFA 3GOYA 3MOFA 4GV7A 4R5WA 4UVTA 5ETYA 4PNTA 3SE2A 2QF2A 1OS1A 4L0BA 1GS0A 2ZCIA 3DT4A 3GEYA 4L33A 4KZUA 4GNLA 4L10A 4PY4A 4GMWA 4TOSA 4L31A 4L7PA 4GV0A 2PY7X 4UVSA 4UI4A 4J3LA 1YTMA 4RV6A 1WOKA 2FAHA 4F1QA 2PC9A 4UVOA 4GMZA 1K3DA 3MOEA 4N4TA 4TORA 3L3LA 3L3MA 4HLGA 4UVYA 4BFPA 5C5PA 4GNQA 4HHZA 1M51A 4R6EA 5FH3A 4L7OA 4BU9A 1K3CA 4HLMA 4UVWA 4BUAA 4UVXA 4ZZZA 4PMLA 4OPXC 4UFUA 4WPUA 4BU6A 4J21A 4W5SA 2PAXA 2GMVA 4UI8A 1YVYA 2RK7A 4L6ZA 3MOHA 5FPFA 5AKWA 4PJTA 4LI7A 4YWBA 4YWDA 4AVUA 4UVVA 4UUHA 5FPGA 1YGGA 4BJBA 2OLQA 4UVUA 3FHBA 4BJCA 4UVNA 4YW8A 4BS4A 4BUDA 4L7NA 4PAXA 3UH4A 4TVJA 3P0PA 1A26A 4K4EA 4UVLA 1PAXA 4GV4A 4HKKA 3SMJA 2X5YA 4HLKA 3DTBA 4RCGA 2RD6A 4WPTA 4BU7A 4UHGA 4R43A 3KR8A 2PQFA 2RK8A 4MSGA 4MT9A 3GN7A 4UXBA 2OLRA 5DCZA 5AL2A 4M7BA 4BUYA 3C4HA 4PNQA 4TK0A 4L70A 3GJWA 5C5QA 4N3RA 4BU3A 4BUIA 4LI8A 5FH5A 4UI3A 4XHUA 5A00A 4GMMA 3PAXA 5ECEA 4F0EA 2PXZX 4ZZXA 5AEHA 4GMUA 4UX4A 3U9YA 1AQ2A 4L09A 2RKEA 3MHJA 4J3MA 4KRSA 5LXPA 5C5RA 4BU8A 4HLFA 2RKDA 4UW1A 4YW9A 1KHEA 4K4FA 4UFYA 4W5IA 4L34A 4U6AA 5FH1A 1AYLA 4L2KA 5AL5A 3SMIA 2PAWA 4WIUA 4L7UA 4BUSA 4HYFA 4DVIA 5AL1A 4AVWA 3CE0A 2RKAA 1UK1A 3MHKA 4MSKA 1J3BA 5AL3A 1KHGA 4L32A 4UI5A 4L2FA 4BUWA 4F1LA 4TJYA 4TKIA 4TK5A 4GV2A 4L0SA 3KR7A 4HKIA 4HL5A 4IUEA 4PNLA 4BUEA 5ADRA 4BUVA 2QZYA 4HLHA 3HKVA 4J1ZA 5FH0A 4L7RA 4BUTA 4BUXA 4OQBC 4WIEA 3P0NA 2RCWA 4HHYA 5EBTA 1NHXA 4UVPA 4L0IA 4BU5A 5LX6A 3DT2A 4PNMA 4UVZA 4BJ9A 5I67A 4TKGA 5ADTA 4HKNA 1II2A 2QF1A 4LI6A 4TJWA 2QEYA 5ADSA 4OA7A 3P0QA 1UK0A 5FH4A 3UDDA 4ZZYA 4GNMA 1EFYA 4HMHA 3U9HA 4W6EA 4L0VA 4UI6A 5AL4A 3UH2A 4X52A 4WPVA 5AKUA 4TKFA 4I9IA 3KCZA 4OQAC 4L6SA 4KZQA 4TJUA 3DT7A 3BLJA 1KHBA 4PNNA 4L0TA 4N4VA 2RF5A 3C49A 4BUUA 4UI7A 4L2GA 4PNSA 2FAFA 4L7LA 5FH2A 3W51A 5LYHA 2QEWA 4WOUA 4WL8A 4OX2A 4DQYC 3KJDA 1YLHA 4PJVA 3UA9A 4PNRA 4KZLA 4GNPA 5ADQA 1XKVA 4GNOA 4BUFA 1OENA 4J22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UND A;  3GOY A;  4GV7 A;  4R5W A;  4UVT A;  5ETY A;  4PNT A;  4L0B A;  4KZU A;  4L33 A;  1GS0 A;  3GEY A;  4PY4 A;  4TOS A;  4UVY A;  3SE2 A;  4BU3 A;  4L10 A;  4L31 A;  4L7P A;  4GV0 A;  4UVS A;  4UI4 A;  4J3L A;  4RV6 A;  1WOK A;  4F1Q A;  4UVO A;  4TOR A;  4N4T A;  3L3L A;  3L3M A;  4HLG A;  4BFP A;  5C5P A;  4HHZ A;  4R6E A;  4L7O A;  4BU9 A;  4HLM A;  4BUA A;  4UVW A;  4UVX A;  4ZZZ A;  4PML A;  4OPX C;  4UFU A;  4BU6 A;  4J21 A;  4W5S A;  2PAX A;  4UI8 A;  4L6Z A;  5FPF A;  5AKW A;  4PJT A;  4LI7 A;  4AVU A;  4UVV A;  4UUH A;  5FPG A;  4BJB A;  4UVU A;  3FHB A;  4BJC A;  4UVN A;  4BUD A;  4BS4 A;  4L7N A;  4PAX A;  3UH4 A;  4TVJ A;  3P0P A;  1A26 A;  4K4E A;  4UVL A;  1PAX A;  4GV4 A;  4HKK A;  3SMJ A;  2X5Y A;  4HLK A;  2RD6 A;  4BU7 A;  4UHG A;  3KR8 A;  2PQF A;  4MSG A;  4MT9 A;  4UXB A;  3GN7 A;  5DCZ A;  5AL2 A;  4M7B A;  3C4H A;  4PNQ A;  4TK0 A;  4L70 A;  3GJW A;  5C5Q A;  4N3R A;  4BUI A;  4LI8 A;  4UI3 A;  4XHU A;  5A00 A;  3PAX A;  5ECE A;  4F0E A;  4ZZX A;  5AEH A;  4UX4 A;  3U9Y A;  4L09 A;  3MHJ A;  4J3M A;  4KRS A;  5LXP A;  5C5R A;  4BU8 A;  4HLF A;  4UW1 A;  4BUW A;  4UFY A;  4K4F A;  4BUY A;  4W5I A;  4L34 A;  4U6A A;  5AL5 A;  4L2K A;  3SMI A;  2PAW A;  4L7U A;  4BUS A;  4HYF A;  4DVI A;  5AL1 A;  4AVW A;  3CE0 A;  1UK1 A;  3MHK A;  4MSK A;  5AL3 A;  4L32 A;  4UI5 A;  4L2F A;  4F1L A;  4TJY A;  4TKI A;  4TK5 A;  4GV2 A;  4L0S A;  3KR7 A;  4HKI A;  4HL5 A;  4IUE A;  4PNL A;  4BUE A;  5ADR A;  4BUV A;  4HLH A;  3HKV A;  4J1Z A;  4OQB C;  4L7R A;  4BUT A;  4BUX A;  3P0N A;  2RCW A;  4HHY A;  5EBT A;  4UVP A;  4BU5 A;  4L0I A;  5LX6 A;  4PNM A;  4UVZ A;  4BJ9 A;  4TKG A;  5ADT A;  4HKN A;  4LI6 A;  5ADS A;  4TJW A;  4OA7 A;  3P0Q A;  1UK0 A;  3UDD A;  4ZZY A;  1EFY A;  4HMH A;  3U9H A;  4W6E A;  4L0V A;  4UI6 A;  5AL4 A;  3UH2 A;  4X52 A;  5AKU A;  4TKF A;  4I9I A;  3KCZ A;  4OQA C;  4L6S A;  4KZQ A;  4TJU A;  3BLJ A;  4PNN A;  4L0T A;  4N4V A;  2RF5 A;  3C49 A;  4BUU A;  4UI7 A;  4L2G A;  4PNS A;  4L7L A;  3W51 A;  5LYH A;  4DQY C;  3KJD A;  3UA9 A;  4PJV A;  4PNR A;  4KZL A;  5ADQ A;  4BUF A;  4J22 A; 
#chains in the Genus database with same CATH topology
 4UND A;  1KHF A;  3GOY A;  3MOF A;  4GV7 A;  4R5W A;  4UVT A;  5ETY A;  4PNT A;  3SE2 A;  2QF2 A;  1OS1 A;  4L0B A;  1GS0 A;  2ZCI A;  3DT4 A;  3GEY A;  4L33 A;  4KZU A;  4GNL A;  4L10 A;  4PY4 A;  4GMW A;  4TOS A;  4L31 A;  4L7P A;  4GV0 A;  2PY7 X;  4UVS A;  4UI4 A;  4J3L A;  1YTM A;  4RV6 A;  1WOK A;  2FAH A;  4F1Q A;  2PC9 A;  4UVO A;  4GMZ A;  1K3D A;  3MOE A;  4N4T A;  4TOR A;  3L3L A;  3L3M A;  4HLG A;  4UVY A;  4BFP A;  5C5P A;  4GNQ A;  4HHZ A;  1M51 A;  4R6E A;  5FH3 A;  4L7O A;  4BU9 A;  1K3C A;  4HLM A;  4UVW A;  4BUA A;  4UVX A;  4ZZZ A;  4PML A;  4OPX C;  4UFU A;  4WPU A;  4BU6 A;  4J21 A;  4W5S A;  2PAX A;  2GMV A;  4UI8 A;  1YVY A;  2RK7 A;  4L6Z A;  3MOH A;  5FPF A;  5AKW A;  4PJT A;  4LI7 A;  4YWB A;  4YWD A;  4AVU A;  4UVV A;  4UUH A;  5FPG A;  1YGG A;  4BJB A;  2OLQ A;  4UVU A;  3FHB A;  4BJC A;  4UVN A;  4YW8 A;  4BS4 A;  4BUD A;  4L7N A;  4PAX A;  3UH4 A;  4TVJ A;  3P0P A;  1A26 A;  4K4E A;  4UVL A;  1PAX A;  4GV4 A;  4HKK A;  3SMJ A;  2X5Y A;  4HLK A;  3DTB A;  4RCG A;  2RD6 A;  4WPT A;  4BU7 A;  4UHG A;  4R43 A;  3KR8 A;  2PQF A;  2RK8 A;  4MSG A;  4MT9 A;  3GN7 A;  4UXB A;  2OLR A;  5DCZ A;  5AL2 A;  4M7B A;  4BUY A;  3C4H A;  4PNQ A;  4TK0 A;  4L70 A;  3GJW A;  5C5Q A;  4N3R A;  4BU3 A;  4BUI A;  4LI8 A;  5FH5 A;  4UI3 A;  4XHU A;  5A00 A;  4GMM A;  3PAX A;  5ECE A;  4F0E A;  2PXZ X;  4ZZX A;  5AEH A;  4GMU A;  4UX4 A;  3U9Y A;  1AQ2 A;  4L09 A;  2RKE A;  3MHJ A;  4J3M A;  4KRS A;  5LXP A;  5C5R A;  4BU8 A;  4HLF A;  2RKD A;  4UW1 A;  4YW9 A;  1KHE A;  4K4F A;  4UFY A;  4W5I A;  4L34 A;  4U6A A;  5FH1 A;  1AYL A;  4L2K A;  5AL5 A;  3SMI A;  2PAW A;  4WIU A;  4L7U A;  4BUS A;  4HYF A;  4DVI A;  5AL1 A;  4AVW A;  3CE0 A;  2RKA A;  1UK1 A;  3MHK A;  4MSK A;  1J3B A;  5AL3 A;  1KHG A;  4L32 A;  4UI5 A;  4L2F A;  4BUW A;  4F1L A;  4TJY A;  4TKI A;  4TK5 A;  4GV2 A;  4L0S A;  3KR7 A;  4HKI A;  4HL5 A;  4IUE A;  4PNL A;  4BUE A;  5ADR A;  4BUV A;  2QZY A;  4HLH A;  3HKV A;  4J1Z A;  5FH0 A;  4L7R A;  4BUT A;  4BUX A;  4OQB C;  4WIE A;  3P0N A;  2RCW A;  4HHY A;  5EBT A;  1NHX A;  4UVP A;  4L0I A;  4BU5 A;  5LX6 A;  3DT2 A;  4PNM A;  4UVZ A;  4BJ9 A;  5I67 A;  4TKG A;  5ADT A;  4HKN A;  1II2 A;  2QF1 A;  4LI6 A;  4TJW A;  2QEY A;  5ADS A;  4OA7 A;  3P0Q A;  1UK0 A;  5FH4 A;  3UDD A;  4ZZY A;  4GNM A;  1EFY A;  4HMH A;  3U9H A;  4W6E A;  4L0V A;  4UI6 A;  5AL4 A;  3UH2 A;  4X52 A;  4WPV A;  5AKU A;  4TKF A;  4I9I A;  3KCZ A;  4OQA C;  4L6S A;  4KZQ A;  4TJU A;  3DT7 A;  3BLJ A;  1KHB A;  4PNN A;  4L0T A;  4N4V A;  2RF5 A;  3C49 A;  4BUU A;  4UI7 A;  4L2G A;  4PNS A;  2FAF A;  4L7L A;  5FH2 A;  3W51 A;  5LYH A;  2QEW A;  4WOU A;  4WL8 A;  4OX2 A;  4DQY C;  3KJD A;  1YLH A;  4PJV A;  3UA9 A;  4PNR A;  4KZL A;  4GNP A;  5ADQ A;  1XKV A;  4GNO A;  4BUF A;  1OEN A;  4J22 A; 
#chains in the Genus database with same CATH homology
 4UND A;  1KHF A;  3GOY A;  3MOF A;  4GV7 A;  4R5W A;  4UVT A;  5ETY A;  4PNT A;  3SE2 A;  2QF2 A;  1OS1 A;  4L0B A;  1GS0 A;  2ZCI A;  3DT4 A;  3GEY A;  4L33 A;  4KZU A;  4GNL A;  4L10 A;  4PY4 A;  4GMW A;  4TOS A;  4L31 A;  4L7P A;  4GV0 A;  2PY7 X;  4UVS A;  4UI4 A;  4J3L A;  1YTM A;  4RV6 A;  1WOK A;  2FAH A;  4F1Q A;  2PC9 A;  4UVO A;  4GMZ A;  1K3D A;  3MOE A;  4N4T A;  4TOR A;  3L3L A;  3L3M A;  4HLG A;  4UVY A;  4BFP A;  5C5P A;  4GNQ A;  4HHZ A;  1M51 A;  4R6E A;  5FH3 A;  4L7O A;  4BU9 A;  1K3C A;  4HLM A;  4UVW A;  4BUA A;  4UVX A;  4ZZZ A;  4PML A;  4OPX C;  4UFU A;  4WPU A;  4BU6 A;  4J21 A;  4W5S A;  2PAX A;  2GMV A;  4UI8 A;  1YVY A;  2RK7 A;  4L6Z A;  3MOH A;  5FPF A;  5AKW A;  4PJT A;  4LI7 A;  4YWB A;  4YWD A;  4AVU A;  4UVV A;  4UUH A;  5FPG A;  1YGG A;  4BJB A;  2OLQ A;  4UVU A;  3FHB A;  4BJC A;  4UVN A;  4YW8 A;  4BS4 A;  4BUD A;  4L7N A;  4PAX A;  3UH4 A;  4TVJ A;  3P0P A;  1A26 A;  4K4E A;  4UVL A;  1PAX A;  4GV4 A;  4HKK A;  3SMJ A;  2X5Y A;  4HLK A;  3DTB A;  4RCG A;  2RD6 A;  4WPT A;  4BU7 A;  4UHG A;  4R43 A;  3KR8 A;  2PQF A;  2RK8 A;  4MSG A;  4MT9 A;  3GN7 A;  4UXB A;  2OLR A;  5DCZ A;  5AL2 A;  4M7B A;  4BUY A;  3C4H A;  4PNQ A;  4TK0 A;  4L70 A;  3GJW A;  5C5Q A;  4N3R A;  4BU3 A;  4BUI A;  4LI8 A;  5FH5 A;  4UI3 A;  4XHU A;  5A00 A;  4GMM A;  3PAX A;  5ECE A;  4F0E A;  2PXZ X;  4ZZX A;  5AEH A;  4GMU A;  4UX4 A;  3U9Y A;  1AQ2 A;  4L09 A;  2RKE A;  3MHJ A;  4J3M A;  4KRS A;  5LXP A;  5C5R A;  4BU8 A;  4HLF A;  2RKD A;  4UW1 A;  4YW9 A;  1KHE A;  4K4F A;  4UFY A;  4W5I A;  4L34 A;  4U6A A;  5FH1 A;  1AYL A;  4L2K A;  5AL5 A;  3SMI A;  2PAW A;  4WIU A;  4L7U A;  4BUS A;  4HYF A;  4DVI A;  5AL1 A;  4AVW A;  3CE0 A;  2RKA A;  1UK1 A;  3MHK A;  4MSK A;  1J3B A;  5AL3 A;  1KHG A;  4L32 A;  4UI5 A;  4L2F A;  4BUW A;  4F1L A;  4TJY A;  4TKI A;  4TK5 A;  4GV2 A;  4L0S A;  3KR7 A;  4HKI A;  4HL5 A;  4IUE A;  4PNL A;  4BUE A;  5ADR A;  4BUV A;  2QZY A;  4HLH A;  3HKV A;  4J1Z A;  5FH0 A;  4L7R A;  4BUT A;  4BUX A;  4OQB C;  4WIE A;  3P0N A;  2RCW A;  4HHY A;  5EBT A;  1NHX A;  4UVP A;  4L0I A;  4BU5 A;  5LX6 A;  3DT2 A;  4PNM A;  4UVZ A;  4BJ9 A;  5I67 A;  4TKG A;  5ADT A;  4HKN A;  1II2 A;  2QF1 A;  4LI6 A;  4TJW A;  2QEY A;  5ADS A;  4OA7 A;  3P0Q A;  1UK0 A;  5FH4 A;  3UDD A;  4ZZY A;  4GNM A;  1EFY A;  4HMH A;  3U9H A;  4W6E A;  4L0V A;  4UI6 A;  5AL4 A;  3UH2 A;  4X52 A;  4WPV A;  5AKU A;  4TKF A;  4I9I A;  3KCZ A;  4OQA C;  4L6S A;  4KZQ A;  4TJU A;  3DT7 A;  3BLJ A;  1KHB A;  4PNN A;  4L0T A;  4N4V A;  2RF5 A;  3C49 A;  4BUU A;  4UI7 A;  4L2G A;  4PNS A;  2FAF A;  4L7L A;  5FH2 A;  3W51 A;  5LYH A;  2QEW A;  4WOU A;  4WL8 A;  4OX2 A;  4DQY C;  3KJD A;  1YLH A;  4PJV A;  3UA9 A;  4PNR A;  4KZL A;  4GNP A;  5ADQ A;  1XKV A;  4GNO A;  4BUF A;  1OEN A;  4J22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...