4BJBA

Crystal structure of human tankyrase 2 in complex with pj-34
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
210
structure length
200
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDEMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Evaluation and Structural Basis for the Inhibition of Tankyrases by Parp Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 200
sequence length 210
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bjbA00
4BUEA 4HLFA 4UVSA 3PAXA 4HLHA 4R6EA 4BU3A 4TJUA 1GS0A 4HLMA 4L0IA 1WOKA 4L2GA 5AL1A 4L31A 4BUSA 2RD6A 4BS4A 4PMLA 3GJWA 4UVVA 4UVWA 3W51A 4OPXC 4HL5A 4J21A 4GV4A 4GV0A 4TKFA 4HMHA 4PY4A 5DCZA 4MSGA 1PAXA 3KCZA 4KRSA 5AKUA 3L3LA 3SMJA 4OA7A 3UA9A 4UX4A 4PNMA 3SE2A 5FPGA 4L32A 4L70A 3P0QA 4BUTA 4DVIA 3U9HA 1UK1A 3U9YA 3KJDA 3GEYA 4N4VA 4UUHA 5AL3A 4BUFA 4OQAC 4UHGA 4K4FA 4X52A 4GV2A 5ADQA 4PNSA 4K4EA 4UVZA 4M7BA 3HKVA 4W5SA 4GV7A 4UFUA 3BLJA 4UNDA 4UI8A 4BUUA 4J1ZA 5A00A 3MHJA 2PAXA 4KZQA 4TOSA 4UI6A 4UVLA 4BU6A 5LXPA 4L2FA 4HHYA 4UVOA 4ZZZA 4OQBC 4BU7A 4UI7A 2X5YA 4LI6A 4RV6A 4UI5A 4PNLA 5C5PA 5ADRA 4UI4A 4HYFA 5AEHA 4BUYA 4BUAA 4L0TA 4LI7A 4BUWA 4HKIA 4L33A 4R5WA 4UVTA 5AKWA 4UVPA 4BUIA 2PAWA 3MHKA 4UVNA 3P0NA 4BJBA 4PJTA 5AL4A 4W5IA 3SMIA 5LX6A 4L7LA 4F1LA 5ADTA 4BUVA 4HLKA 4J3MA 4BU8A 4PNNA 3GOYA 3C4HA 4L7UA 4UXBA 4UI3A 5C5RA 4BUXA 3C49A 4N3RA 4L0BA 4L10A 4L6SA 4IUEA 4J22A 4KZLA 4L7PA 4UVXA 4BU9A 1A26A 3KR8A 4BJCA 4AVWA 3FHBA 4TK0A 4HLGA 3L3MA 4PAXA 4ZZYA 4UFYA 4TVJA 3P0PA 5ADSA 4L7OA 4L7NA 4TJWA 4HKKA 4BJ9A 4N4TA 4L2KA 4AVUA 4PJVA 4L0SA 4TJYA 4BFPA 4HHZA 2RF5A 3UH4A 4U6AA 4L34A 5LYHA 4KZUA 4PNQA 4BU5A 4W6EA 3UDDA 4F0EA 4L6ZA 3UH2A 4TKGA 5ECEA 5ETYA 3GN7A 4LI8A 4I9IA 4L7RA 4UW1A 4HKNA 5FPFA 3KR7A 1EFYA 2PQFA 4MSKA 4TKIA 4XHUA 4MT9A 5AL2A 4TK5A 4F1QA 4L0VA 4J3LA 2RCWA 4TORA 4BUDA 4DQYC 4UVUA 4ZZXA 4L09A 5EBTA 1UK0A 3CE0A 5C5QA 4PNTA 4PNRA 5AL5A 4UVYA
chains in the Genus database with same CATH superfamily
4BUEA 4YW8A 4HLFA 4UVSA 3PAXA 4HLHA 4R6EA 4BU3A 4TJUA 1GS0A 2FAFA 4HLMA 4L0IA 4GNQA 1WOKA 2QF2A 4L2GA 3MOHA 5AL1A 4L31A 4BUSA 2RD6A 4BS4A 4PMLA 3GJWA 4UVVA 4UVWA 3W51A 4OPXC 4HL5A 4J21A 4GV4A 4GV0A 4TKFA 2GMVA 4HMHA 4PY4A 4MSGA 1PAXA 1K3CA 3KCZA 4GMUA 4KRSA 5AKUA 5DCZA 3L3LA 3SMJA 1AYLA 2RK7A 4OA7A 3UA9A 4UX4A 3DT7A 4PNMA 5FPGA 3SE2A 4RCGA 4L32A 4GNOA 4L70A 3P0QA 4WIEA 4BUTA 2FAHA 1UK1A 3U9HA 2ZCIA 4GMMA 3KJDA 3GEYA 4N4VA 4UUHA 5AL3A 4BUFA 4OQAC 4UHGA 2PXZX 4K4FA 1YVYA 4GV2A 4X52A 2PY7X 5ADQA 4PNSA 4K4EA 4UVZA 4M7BA 3HKVA 1NHXA 5FH4A 2RKEA 2RK8A 4W5SA 1II2A 4GV7A 1K3DA 3BLJA 4UFUA 4UNDA 5FH1A 4UI8A 4BUUA 4GNMA 4J1ZA 5A00A 5FH0A 3MHJA 1KHBA 4OX2A 3U9YA 2PAXA 4KZQA 3DT4A 4TOSA 4UI6A 4UVLA 4BU6A 4L2FA 4HHYA 4UVOA 5LXPA 4ZZZA 1M51A 1AQ2A 4BU7A 4OQBC 1J3BA 3DTBA 4UI7A 2X5YA 4LI6A 4RV6A 4UI5A 4PNLA 4WPUA 2RKAA 5C5PA 4UI4A 5ADRA 4HYFA 5AEHA 4R43A 4BUYA 4BUAA 4L0TA 4LI7A 4GMZA 4BUWA 4HKIA 4L33A 4R5WA 4UVTA 5AKWA 4UVPA 4YWBA 4BUIA 2PAWA 3MHKA 4UVNA 3P0NA 4BJBA 2QF1A 4PJTA 5AL4A 4W5IA 3SMIA 5LX6A 2QEYA 4L7LA 4WIUA 4F1LA 5ADTA 4BUVA 4HLKA 4J3MA 4BU8A 5I67A 4PNNA 3GOYA 3C4HA 4L7UA 4UXBA 4UI3A 5C5RA 4BUXA 4WPTA 3C49A 2QZYA 4L0BA 4N3RA 4L10A 4L6SA 4IUEA 2PC9A 4GMWA 4J22A 4KZLA 4L7PA 1A26A 4UVXA 3KR8A 4BJCA 4BU9A 4AVWA 3FHBA 2OLRA 4WPVA 4HLGA 3L3MA 4PAXA 4TK0A 4ZZYA 1YTMA 4UFYA 4TVJA 1YLHA 3MOFA 3P0PA 5ADSA 4L7OA 4L7NA 4TJWA 4DVIA 4HKKA 4BJ9A 4N4TA 4L2KA 4AVUA 1KHEA 1OENA 4PJVA 4L0SA 2RKDA 4TJYA 4BFPA 5FH3A 4HHZA 2RF5A 3UH4A 1KHGA 4GNPA 4U6AA 4L34A 5LYHA 4KZUA 4PNQA 4BU5A 1OS1A 4W6EA 3UDDA 4F0EA 4WOUA 4L6ZA 3UH2A 4TKGA 5ECEA 5ETYA 3GN7A 4LI8A 4I9IA 4L7RA 4YWDA 4UW1A 2OLQA 4HKNA 5FPFA 3KR7A 3MOEA 1KHFA 4WL8A 1EFYA 1YGGA 2PQFA 4MSKA 4TKIA 4XHUA 4MT9A 5AL2A 4YW9A 4TK5A 4F1QA 4L0VA 4J3LA 2RCWA 2QEWA 4TORA 4BUDA 4DQYC 4GNLA 4UVUA 4ZZXA 4L09A 5FH5A 5EBTA 5FH2A 1UK0A 3CE0A 5C5QA 3DT2A 1XKVA 4PNTA 4PNRA 5AL5A 4UVYA
chains in the Genus database with same CATH topology
4BUEA 4YW8A 4HLFA 4UVSA 3PAXA 4HLHA 4R6EA 4BU3A 4TJUA 1GS0A 2FAFA 4HLMA 4L0IA 4GNQA 1WOKA 2QF2A 4L2GA 3MOHA 5AL1A 4L31A 4BUSA 2RD6A 4BS4A 4PMLA 3GJWA 4UVVA 4UVWA 3W51A 4OPXC 4HL5A 4J21A 4GV4A 4GV0A 4TKFA 2GMVA 4HMHA 4PY4A 4MSGA 1PAXA 1K3CA 3KCZA 4GMUA 4KRSA 5AKUA 5DCZA 3L3LA 3SMJA 1AYLA 2RK7A 4OA7A 3UA9A 4UX4A 3DT7A 4PNMA 5FPGA 3SE2A 4RCGA 4L32A 4GNOA 4L70A 3P0QA 4WIEA 4BUTA 2FAHA 1UK1A 3U9HA 2ZCIA 4GMMA 3KJDA 3GEYA 4N4VA 4UUHA 5AL3A 4BUFA 4OQAC 4UHGA 2PXZX 4K4FA 1YVYA 4GV2A 4X52A 2PY7X 5ADQA 4PNSA 4K4EA 4UVZA 4M7BA 3HKVA 1NHXA 5FH4A 2RKEA 2RK8A 4W5SA 1II2A 4GV7A 1K3DA 3BLJA 4UFUA 4UNDA 5FH1A 4UI8A 4BUUA 4GNMA 4J1ZA 5A00A 5FH0A 3MHJA 1KHBA 4OX2A 3U9YA 2PAXA 4KZQA 3DT4A 4TOSA 4UI6A 4UVLA 4BU6A 4L2FA 4HHYA 4UVOA 5LXPA 4ZZZA 1M51A 1AQ2A 4BU7A 4OQBC 1J3BA 3DTBA 4UI7A 2X5YA 4LI6A 4RV6A 4UI5A 4PNLA 4WPUA 2RKAA 5C5PA 4UI4A 5ADRA 4HYFA 5AEHA 4R43A 4BUYA 4BUAA 4L0TA 4LI7A 4GMZA 4BUWA 4HKIA 4L33A 4R5WA 4UVTA 5AKWA 4UVPA 4YWBA 4BUIA 2PAWA 3MHKA 4UVNA 3P0NA 4BJBA 2QF1A 4PJTA 5AL4A 4W5IA 3SMIA 5LX6A 2QEYA 4L7LA 4WIUA 4F1LA 5ADTA 4BUVA 4HLKA 4J3MA 4BU8A 5I67A 4PNNA 3GOYA 3C4HA 4L7UA 4UXBA 4UI3A 5C5RA 4BUXA 4WPTA 3C49A 2QZYA 4L0BA 4N3RA 4L10A 4L6SA 4IUEA 2PC9A 4GMWA 4J22A 4KZLA 4L7PA 1A26A 4UVXA 3KR8A 4BJCA 4BU9A 4AVWA 3FHBA 2OLRA 4WPVA 4HLGA 3L3MA 4PAXA 4TK0A 4ZZYA 1YTMA 4UFYA 4TVJA 1YLHA 3MOFA 3P0PA 5ADSA 4L7OA 4L7NA 4TJWA 4DVIA 4HKKA 4BJ9A 4N4TA 4L2KA 4AVUA 1KHEA 1OENA 4PJVA 4L0SA 2RKDA 4TJYA 4BFPA 5FH3A 4HHZA 2RF5A 3UH4A 1KHGA 4GNPA 4U6AA 4L34A 5LYHA 4KZUA 4PNQA 4BU5A 1OS1A 4W6EA 3UDDA 4F0EA 4WOUA 4L6ZA 3UH2A 4TKGA 5ECEA 5ETYA 3GN7A 4LI8A 4I9IA 4L7RA 4YWDA 4UW1A 2OLQA 4HKNA 5FPFA 3KR7A 3MOEA 1KHFA 4WL8A 1EFYA 1YGGA 2PQFA 4MSKA 4TKIA 4XHUA 4MT9A 5AL2A 4YW9A 4TK5A 4F1QA 4L0VA 4J3LA 2RCWA 2QEWA 4TORA 4BUDA 4DQYC 4GNLA 4UVUA 4ZZXA 4L09A 5FH5A 5EBTA 5FH2A 1UK0A 3CE0A 5C5QA 3DT2A 1XKVA 4PNTA 4PNRA 5AL5A 4UVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUE A;  4HLF A;  4UVS A;  3PAX A;  4HLH A;  4R6E A;  4BU3 A;  4TJU A;  1GS0 A;  4HLM A;  4L0I A;  1WOK A;  4L2G A;  5AL1 A;  4L31 A;  4BUS A;  2RD6 A;  4BS4 A;  4PML A;  3GJW A;  4UVV A;  4UVW A;  3W51 A;  4OPX C;  4HL5 A;  4J21 A;  4GV4 A;  4GV0 A;  4TKF A;  4HMH A;  4PY4 A;  5DCZ A;  4MSG A;  1PAX A;  3KCZ A;  4KRS A;  5AKU A;  3L3L A;  3SMJ A;  4OA7 A;  3UA9 A;  4UX4 A;  4PNM A;  3SE2 A;  5FPG A;  4L32 A;  4L70 A;  3P0Q A;  4BUT A;  4DVI A;  3U9H A;  1UK1 A;  3U9Y A;  3KJD A;  3GEY A;  4N4V A;  4UUH A;  5AL3 A;  4BUF A;  4OQA C;  4UHG A;  4K4F A;  4X52 A;  4GV2 A;  5ADQ A;  4PNS A;  4K4E A;  4UVZ A;  4M7B A;  3HKV A;  4W5S A;  4GV7 A;  4UFU A;  3BLJ A;  4UND A;  4UI8 A;  4BUU A;  4J1Z A;  5A00 A;  3MHJ A;  2PAX A;  4KZQ A;  4TOS A;  4UI6 A;  4UVL A;  4BU6 A;  5LXP A;  4L2F A;  4HHY A;  4UVO A;  4ZZZ A;  4OQB C;  4BU7 A;  4UI7 A;  2X5Y A;  4LI6 A;  4RV6 A;  4UI5 A;  4PNL A;  5C5P A;  5ADR A;  4UI4 A;  4HYF A;  5AEH A;  4BUY A;  4BUA A;  4L0T A;  4LI7 A;  4BUW A;  4HKI A;  4L33 A;  4R5W A;  4UVT A;  5AKW A;  4UVP A;  4BUI A;  2PAW A;  3MHK A;  4UVN A;  3P0N A;  4BJB A;  4PJT A;  5AL4 A;  4W5I A;  3SMI A;  5LX6 A;  4L7L A;  4F1L A;  5ADT A;  4BUV A;  4HLK A;  4J3M A;  4BU8 A;  4PNN A;  3GOY A;  3C4H A;  4L7U A;  4UXB A;  4UI3 A;  5C5R A;  4BUX A;  3C49 A;  4N3R A;  4L0B A;  4L10 A;  4L6S A;  4IUE A;  4J22 A;  4KZL A;  4L7P A;  4UVX A;  4BU9 A;  1A26 A;  3KR8 A;  4BJC A;  4AVW A;  3FHB A;  4TK0 A;  4HLG A;  3L3M A;  4PAX A;  4ZZY A;  4UFY A;  4TVJ A;  3P0P A;  5ADS A;  4L7O A;  4L7N A;  4TJW A;  4HKK A;  4BJ9 A;  4N4T A;  4L2K A;  4AVU A;  4PJV A;  4L0S A;  4TJY A;  4BFP A;  4HHZ A;  2RF5 A;  3UH4 A;  4U6A A;  4L34 A;  5LYH A;  4KZU A;  4PNQ A;  4BU5 A;  4W6E A;  3UDD A;  4F0E A;  4L6Z A;  3UH2 A;  4TKG A;  5ECE A;  5ETY A;  3GN7 A;  4LI8 A;  4I9I A;  4L7R A;  4UW1 A;  4HKN A;  5FPF A;  3KR7 A;  1EFY A;  2PQF A;  4MSK A;  4TKI A;  4XHU A;  4MT9 A;  5AL2 A;  4TK5 A;  4F1Q A;  4L0V A;  4J3L A;  2RCW A;  4TOR A;  4BUD A;  4DQY C;  4UVU A;  4ZZX A;  4L09 A;  5EBT A;  1UK0 A;  3CE0 A;  5C5Q A;  4PNT A;  4PNR A;  5AL5 A;  4UVY A; 
#chains in the Genus database with same CATH topology
 4BUE A;  4YW8 A;  4HLF A;  4UVS A;  3PAX A;  4HLH A;  4R6E A;  4BU3 A;  4TJU A;  1GS0 A;  2FAF A;  4HLM A;  4L0I A;  4GNQ A;  1WOK A;  2QF2 A;  4L2G A;  3MOH A;  5AL1 A;  4L31 A;  4BUS A;  2RD6 A;  4BS4 A;  4PML A;  3GJW A;  4UVV A;  4UVW A;  3W51 A;  4OPX C;  4HL5 A;  4J21 A;  4GV4 A;  4GV0 A;  4TKF A;  2GMV A;  4HMH A;  4PY4 A;  4MSG A;  1PAX A;  1K3C A;  3KCZ A;  4GMU A;  4KRS A;  5AKU A;  5DCZ A;  3L3L A;  3SMJ A;  1AYL A;  2RK7 A;  4OA7 A;  3UA9 A;  4UX4 A;  3DT7 A;  4PNM A;  5FPG A;  3SE2 A;  4RCG A;  4L32 A;  4GNO A;  4L70 A;  3P0Q A;  4WIE A;  4BUT A;  2FAH A;  1UK1 A;  3U9H A;  2ZCI A;  4GMM A;  3KJD A;  3GEY A;  4N4V A;  4UUH A;  5AL3 A;  4BUF A;  4OQA C;  4UHG A;  2PXZ X;  4K4F A;  1YVY A;  4GV2 A;  4X52 A;  2PY7 X;  5ADQ A;  4PNS A;  4K4E A;  4UVZ A;  4M7B A;  3HKV A;  1NHX A;  5FH4 A;  2RKE A;  2RK8 A;  4W5S A;  1II2 A;  4GV7 A;  1K3D A;  3BLJ A;  4UFU A;  4UND A;  5FH1 A;  4UI8 A;  4BUU A;  4GNM A;  4J1Z A;  5A00 A;  5FH0 A;  3MHJ A;  1KHB A;  4OX2 A;  3U9Y A;  2PAX A;  4KZQ A;  3DT4 A;  4TOS A;  4UI6 A;  4UVL A;  4BU6 A;  4L2F A;  4HHY A;  4UVO A;  5LXP A;  4ZZZ A;  1M51 A;  1AQ2 A;  4BU7 A;  4OQB C;  1J3B A;  3DTB A;  4UI7 A;  2X5Y A;  4LI6 A;  4RV6 A;  4UI5 A;  4PNL A;  4WPU A;  2RKA A;  5C5P A;  4UI4 A;  5ADR A;  4HYF A;  5AEH A;  4R43 A;  4BUY A;  4BUA A;  4L0T A;  4LI7 A;  4GMZ A;  4BUW A;  4HKI A;  4L33 A;  4R5W A;  4UVT A;  5AKW A;  4UVP A;  4YWB A;  4BUI A;  2PAW A;  3MHK A;  4UVN A;  3P0N A;  4BJB A;  2QF1 A;  4PJT A;  5AL4 A;  4W5I A;  3SMI A;  5LX6 A;  2QEY A;  4L7L A;  4WIU A;  4F1L A;  5ADT A;  4BUV A;  4HLK A;  4J3M A;  4BU8 A;  5I67 A;  4PNN A;  3GOY A;  3C4H A;  4L7U A;  4UXB A;  4UI3 A;  5C5R A;  4BUX A;  4WPT A;  3C49 A;  2QZY A;  4L0B A;  4N3R A;  4L10 A;  4L6S A;  4IUE A;  2PC9 A;  4GMW A;  4J22 A;  4KZL A;  4L7P A;  1A26 A;  4UVX A;  3KR8 A;  4BJC A;  4BU9 A;  4AVW A;  3FHB A;  2OLR A;  4WPV A;  4HLG A;  3L3M A;  4PAX A;  4TK0 A;  4ZZY A;  1YTM A;  4UFY A;  4TVJ A;  1YLH A;  3MOF A;  3P0P A;  5ADS A;  4L7O A;  4L7N A;  4TJW A;  4DVI A;  4HKK A;  4BJ9 A;  4N4T A;  4L2K A;  4AVU A;  1KHE A;  1OEN A;  4PJV A;  4L0S A;  2RKD A;  4TJY A;  4BFP A;  5FH3 A;  4HHZ A;  2RF5 A;  3UH4 A;  1KHG A;  4GNP A;  4U6A A;  4L34 A;  5LYH A;  4KZU A;  4PNQ A;  4BU5 A;  1OS1 A;  4W6E A;  3UDD A;  4F0E A;  4WOU A;  4L6Z A;  3UH2 A;  4TKG A;  5ECE A;  5ETY A;  3GN7 A;  4LI8 A;  4I9I A;  4L7R A;  4YWD A;  4UW1 A;  2OLQ A;  4HKN A;  5FPF A;  3KR7 A;  3MOE A;  1KHF A;  4WL8 A;  1EFY A;  1YGG A;  2PQF A;  4MSK A;  4TKI A;  4XHU A;  4MT9 A;  5AL2 A;  4YW9 A;  4TK5 A;  4F1Q A;  4L0V A;  4J3L A;  2RCW A;  2QEW A;  4TOR A;  4BUD A;  4DQY C;  4GNL A;  4UVU A;  4ZZX A;  4L09 A;  5FH5 A;  5EBT A;  5FH2 A;  1UK0 A;  3CE0 A;  5C5Q A;  3DT2 A;  1XKV A;  4PNT A;  4PNR A;  5AL5 A;  4UVY A; 
#chains in the Genus database with same CATH homology
 4BUE A;  4YW8 A;  4HLF A;  4UVS A;  3PAX A;  4HLH A;  4R6E A;  4BU3 A;  4TJU A;  1GS0 A;  2FAF A;  4HLM A;  4L0I A;  4GNQ A;  1WOK A;  2QF2 A;  4L2G A;  3MOH A;  5AL1 A;  4L31 A;  4BUS A;  2RD6 A;  4BS4 A;  4PML A;  3GJW A;  4UVV A;  4UVW A;  3W51 A;  4OPX C;  4HL5 A;  4J21 A;  4GV4 A;  4GV0 A;  4TKF A;  2GMV A;  4HMH A;  4PY4 A;  4MSG A;  1PAX A;  1K3C A;  3KCZ A;  4GMU A;  4KRS A;  5AKU A;  5DCZ A;  3L3L A;  3SMJ A;  1AYL A;  2RK7 A;  4OA7 A;  3UA9 A;  4UX4 A;  3DT7 A;  4PNM A;  5FPG A;  3SE2 A;  4RCG A;  4L32 A;  4GNO A;  4L70 A;  3P0Q A;  4WIE A;  4BUT A;  2FAH A;  1UK1 A;  3U9H A;  2ZCI A;  4GMM A;  3KJD A;  3GEY A;  4N4V A;  4UUH A;  5AL3 A;  4BUF A;  4OQA C;  4UHG A;  2PXZ X;  4K4F A;  1YVY A;  4GV2 A;  4X52 A;  2PY7 X;  5ADQ A;  4PNS A;  4K4E A;  4UVZ A;  4M7B A;  3HKV A;  1NHX A;  5FH4 A;  2RKE A;  2RK8 A;  4W5S A;  1II2 A;  4GV7 A;  1K3D A;  3BLJ A;  4UFU A;  4UND A;  5FH1 A;  4UI8 A;  4BUU A;  4GNM A;  4J1Z A;  5A00 A;  5FH0 A;  3MHJ A;  1KHB A;  4OX2 A;  3U9Y A;  2PAX A;  4KZQ A;  3DT4 A;  4TOS A;  4UI6 A;  4UVL A;  4BU6 A;  4L2F A;  4HHY A;  4UVO A;  5LXP A;  4ZZZ A;  1M51 A;  1AQ2 A;  4BU7 A;  4OQB C;  1J3B A;  3DTB A;  4UI7 A;  2X5Y A;  4LI6 A;  4RV6 A;  4UI5 A;  4PNL A;  4WPU A;  2RKA A;  5C5P A;  4UI4 A;  5ADR A;  4HYF A;  5AEH A;  4R43 A;  4BUY A;  4BUA A;  4L0T A;  4LI7 A;  4GMZ A;  4BUW A;  4HKI A;  4L33 A;  4R5W A;  4UVT A;  5AKW A;  4UVP A;  4YWB A;  4BUI A;  2PAW A;  3MHK A;  4UVN A;  3P0N A;  4BJB A;  2QF1 A;  4PJT A;  5AL4 A;  4W5I A;  3SMI A;  5LX6 A;  2QEY A;  4L7L A;  4WIU A;  4F1L A;  5ADT A;  4BUV A;  4HLK A;  4J3M A;  4BU8 A;  5I67 A;  4PNN A;  3GOY A;  3C4H A;  4L7U A;  4UXB A;  4UI3 A;  5C5R A;  4BUX A;  4WPT A;  3C49 A;  2QZY A;  4L0B A;  4N3R A;  4L10 A;  4L6S A;  4IUE A;  2PC9 A;  4GMW A;  4J22 A;  4KZL A;  4L7P A;  1A26 A;  4UVX A;  3KR8 A;  4BJC A;  4BU9 A;  4AVW A;  3FHB A;  2OLR A;  4WPV A;  4HLG A;  3L3M A;  4PAX A;  4TK0 A;  4ZZY A;  1YTM A;  4UFY A;  4TVJ A;  1YLH A;  3MOF A;  3P0P A;  5ADS A;  4L7O A;  4L7N A;  4TJW A;  4DVI A;  4HKK A;  4BJ9 A;  4N4T A;  4L2K A;  4AVU A;  1KHE A;  1OEN A;  4PJV A;  4L0S A;  2RKD A;  4TJY A;  4BFP A;  5FH3 A;  4HHZ A;  2RF5 A;  3UH4 A;  1KHG A;  4GNP A;  4U6A A;  4L34 A;  5LYH A;  4KZU A;  4PNQ A;  4BU5 A;  1OS1 A;  4W6E A;  3UDD A;  4F0E A;  4WOU A;  4L6Z A;  3UH2 A;  4TKG A;  5ECE A;  5ETY A;  3GN7 A;  4LI8 A;  4I9I A;  4L7R A;  4YWD A;  4UW1 A;  2OLQ A;  4HKN A;  5FPF A;  3KR7 A;  3MOE A;  1KHF A;  4WL8 A;  1EFY A;  1YGG A;  2PQF A;  4MSK A;  4TKI A;  4XHU A;  4MT9 A;  5AL2 A;  4YW9 A;  4TK5 A;  4F1Q A;  4L0V A;  4J3L A;  2RCW A;  2QEW A;  4TOR A;  4BUD A;  4DQY C;  4GNL A;  4UVU A;  4ZZX A;  4L09 A;  5FH5 A;  5EBT A;  5FH2 A;  1UK0 A;  3CE0 A;  5C5Q A;  3DT2 A;  1XKV A;  4PNT A;  4PNR A;  5AL5 A;  4UVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...