4BJCA

Crystal structure of human tankyrase 2 in complex with rucaparib
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
210
structure length
197
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Evaluation and Structural Basis for the Inhibition of Tankyrases by Parp Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 197
sequence length 210
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bjcA00
4PNLA 4UI7A 4BJCA 4PMLA 5AL5A 4L0VA 4MT9A 3L3LA 4PNNA 4L70A 4X52A 4BUFA 4HLHA 2PAXA 4W6EA 4AVUA 3U9YA 4U6AA 3P0PA 4UVSA 4KZUA 4HHYA 4M7BA 4UNDA 4BJBA 4ZZYA 4TOSA 1A26A 4BUSA 3SE2A 1WOKA 4HKNA 5C5QA 3W51A 4TJUA 4PY4A 4DVIA 4IUEA 3U9HA 4UUHA 4L34A 4L32A 4BU9A 4L33A 4L7RA 4XHUA 4BU8A 4PJVA 1GS0A 4UI8A 4UVLA 4BUYA 4BUDA 4TORA 4BUUA 3MHJA 4TKFA 4K4EA 4L0SA 4HKKA 4BUWA 3SMIA 3C4HA 4PNQA 5AL3A 4ZZXA 3UH4A 3KCZA 4BJ9A 3CE0A 4UVZA 4J22A 4UI5A 4GV7A 4OA7A 4L6SA 4TVJA 4ZZZA 4UVUA 4L31A 4BU6A 4N3RA 4MSKA 3UH2A 4TJWA 5ETYA 4PNTA 4HL5A 4I9IA 4TKGA 4J3MA 4L7PA 4HMHA 5FPGA 5LYHA 3KJDA 4F1LA 4LI8A 4TK0A 4PNMA 5AL4A 3P0NA 4F1QA 3SMJA 4UVXA 3HKVA 1UK1A 4KZQA 4L6ZA 4UI3A 4UVYA 4UW1A 4KRSA 5ADSA 2PAWA 5A00A 4F0EA 4L7LA 4AVWA 1PAXA 3FHBA 4PNRA 4K4FA 4UI6A 4PNSA 4GV0A 4N4VA 3GEYA 4HLKA 4HLGA 4KZLA 4TKIA 5AKWA 2RCWA 4HLMA 4TK5A 3P0QA 4UHGA 5AEHA 5LX6A 4BUIA 4HLFA 3PAXA 4L10A 1UK0A 3C49A 4N4TA 4UVVA 2RD6A 1EFYA 5FPFA 4BUXA 4GV2A 4UFYA 4DQYC 4L7OA 4J21A 4BU7A 4UVNA 5AKUA 4L2GA 5LXPA 4L0BA 4OQAC 4HHZA 4R5WA 4L09A 5AL1A 4HKIA 3L3MA 4UVPA 3KR7A 5ADRA 3GN7A 4W5IA 4BFPA 4BUTA 4HYFA 4W5SA 4GV4A 4BUAA 4UVWA 4UXBA 3MHKA 2PQFA 4R6EA 4L2KA 4L7UA 5DCZA 4PAXA 3GJWA 3GOYA 5AL2A 4BU3A 4BU5A 4BUEA 5EBTA 5C5RA 4OQBC 4BUVA 3UDDA 4BS4A 4L0IA 4UX4A 2RF5A 3KR8A 2X5YA 4TJYA 4L7NA 3BLJA 4UI4A 5ADQA 4PJTA 4UFUA 5ECEA 5C5PA 4LI6A 4L0TA 4MSGA 4UVOA 4RV6A 4UVTA 4J1ZA 4OPXC 5ADTA 4J3LA 4L2FA 3UA9A 4LI7A
chains in the Genus database with same CATH superfamily
4PNLA 2QF1A 4UI7A 4BJCA 5I67A 4PMLA 5AL5A 4L0VA 4MT9A 3L3LA 4PNNA 2OLQA 4L70A 4X52A 4BUFA 4HLHA 4GNPA 2PAXA 4GNOA 4W6EA 4AVUA 3U9YA 1YVYA 4U6AA 3P0PA 4UVSA 2QZYA 4HHYA 4KZUA 4M7BA 4UNDA 4BJBA 4ZZYA 4TOSA 1A26A 4BUSA 5ADQA 3SE2A 1WOKA 4HKNA 4YW9A 5C5QA 3W51A 4J3LA 4PY4A 4TJUA 4DVIA 4IUEA 3U9HA 4UUHA 4L34A 4L32A 4BU9A 4L33A 4L7RA 4XHUA 4BU8A 4PJVA 1GS0A 4UI8A 1KHEA 4UVLA 4BUYA 4WPTA 1YTMA 4BUDA 4TORA 4BUUA 3MHJA 4TKFA 4K4EA 2PY7X 4L0SA 1YGGA 4HKKA 4BUWA 3SMIA 3C4HA 4PNQA 5AL3A 1AYLA 4ZZXA 3UH4A 1II2A 3KCZA 4BJ9A 3CE0A 4UVZA 4J22A 4WIUA 1XKVA 4GV7A 4OA7A 4L6SA 4TVJA 4UI5A 4UVUA 4ZZZA 4L31A 4BU6A 4N3RA 4MSKA 1M51A 3UH2A 4TJWA 5ETYA 4WIEA 4PNTA 4HL5A 4I9IA 4TKGA 4J3MA 4L7PA 4HMHA 5FPGA 5LYHA 3KJDA 4F1LA 4LI8A 1K3DA 4TK0A 4PNMA 5AL4A 3P0NA 3MOHA 4F1QA 3SMJA 4GMWA 4UVXA 3HKVA 1UK1A 4KZQA 4L6ZA 4UI3A 4UVYA 4UW1A 4KRSA 4WL8A 4WPVA 2PAWA 3DT4A 4GNMA 5FH0A 5A00A 4F0EA 4L7LA 4AVWA 2QEWA 3MOEA 4GMUA 5FH3A 2ZCIA 1PAXA 3FHBA 4PNRA 4K4FA 4UI6A 4GMMA 4GV0A 2GMVA 2RKEA 3GEYA 4HLKA 4HLGA 4KZLA 4N4VA 4PNSA 4TKIA 5AKWA 2RCWA 4WOUA 2FAFA 5FH5A 4HLMA 4TK5A 3MOFA 3P0QA 4UHGA 5AEHA 5LX6A 4BUIA 4HLFA 1OENA 3PAXA 1UK0A 3C49A 4L10A 1KHGA 4N4TA 4RCGA 4UVVA 2RD6A 1EFYA 5FPFA 4BUXA 4GV2A 4UFYA 4DQYC 4L7OA 4J21A 4BU7A 4UVNA 1KHFA 2QF2A 3DTBA 4L2GA 4L0BA 5AKUA 4HHZA 5LXPA 4R5WA 4GNQA 4OQAC 1J3BA 4L09A 5AL1A 4HKIA 1YLHA 3L3MA 4UVPA 3KR7A 5ADRA 2RKDA 3GN7A 4W5IA 4BFPA 2RK7A 4BUTA 4HYFA 4W5SA 4GV4A 4BUAA 3DT2A 1OS1A 5FH4A 4UVWA 4UXBA 2PC9A 3MHKA 5FH1A 2PQFA 4R6EA 4L2KA 4GMZA 4L7UA 5DCZA 4PAXA 1AQ2A 3GJWA 3GOYA 5AL2A 4BU3A 4BU5A 4BUEA 5EBTA 5C5RA 2OLRA 4OQBC 4BUVA 3UDDA 4BS4A 3DT7A 4L0IA 4R43A 4UX4A 2RF5A 3KR8A 2X5YA 4GNLA 4L7NA 2RKAA 3BLJA 4TJYA 4UI4A 5FH2A 4YWDA 5ADSA 2PXZX 4PJTA 2FAHA 1NHXA 4UFUA 5ECEA 5C5PA 2RK8A 4LI6A 4L0TA 4MSGA 4YWBA 4UVOA 4RV6A 4UVTA 4WPUA 4J1ZA 4OX2A 4OPXC 4YW8A 1KHBA 1K3CA 5ADTA 2QEYA 4L2FA 3UA9A 4LI7A
chains in the Genus database with same CATH topology
4PNLA 2QF1A 4UI7A 4BJCA 5I67A 4PMLA 5AL5A 4L0VA 4MT9A 3L3LA 4PNNA 2OLQA 4L70A 4X52A 4BUFA 4HLHA 4GNPA 2PAXA 4GNOA 4W6EA 4AVUA 3U9YA 1YVYA 4U6AA 3P0PA 4UVSA 2QZYA 4HHYA 4KZUA 4M7BA 4UNDA 4BJBA 4ZZYA 4TOSA 1A26A 4BUSA 5ADQA 3SE2A 1WOKA 4HKNA 4YW9A 5C5QA 3W51A 4J3LA 4PY4A 4TJUA 4DVIA 4IUEA 3U9HA 4UUHA 4L34A 4L32A 4BU9A 4L33A 4L7RA 4XHUA 4BU8A 4PJVA 1GS0A 4UI8A 1KHEA 4UVLA 4BUYA 4WPTA 1YTMA 4BUDA 4TORA 4BUUA 3MHJA 4TKFA 4K4EA 2PY7X 4L0SA 1YGGA 4HKKA 4BUWA 3SMIA 3C4HA 4PNQA 5AL3A 1AYLA 4ZZXA 3UH4A 1II2A 3KCZA 4BJ9A 3CE0A 4UVZA 4J22A 4WIUA 1XKVA 4GV7A 4OA7A 4L6SA 4TVJA 4UI5A 4UVUA 4ZZZA 4L31A 4BU6A 4N3RA 4MSKA 1M51A 3UH2A 4TJWA 5ETYA 4WIEA 4PNTA 4HL5A 4I9IA 4TKGA 4J3MA 4L7PA 4HMHA 5FPGA 5LYHA 3KJDA 4F1LA 4LI8A 1K3DA 4TK0A 4PNMA 5AL4A 3P0NA 3MOHA 4F1QA 3SMJA 4GMWA 4UVXA 3HKVA 1UK1A 4KZQA 4L6ZA 4UI3A 4UVYA 4UW1A 4KRSA 4WL8A 4WPVA 2PAWA 3DT4A 4GNMA 5FH0A 5A00A 4F0EA 4L7LA 4AVWA 2QEWA 3MOEA 4GMUA 5FH3A 2ZCIA 1PAXA 3FHBA 4PNRA 4K4FA 4UI6A 4GMMA 4GV0A 2GMVA 2RKEA 3GEYA 4HLKA 4HLGA 4KZLA 4N4VA 4PNSA 4TKIA 5AKWA 2RCWA 4WOUA 2FAFA 5FH5A 4HLMA 4TK5A 3MOFA 3P0QA 4UHGA 5AEHA 5LX6A 4BUIA 4HLFA 1OENA 3PAXA 1UK0A 3C49A 4L10A 1KHGA 4N4TA 4RCGA 4UVVA 2RD6A 1EFYA 5FPFA 4BUXA 4GV2A 4UFYA 4DQYC 4L7OA 4J21A 4BU7A 4UVNA 1KHFA 2QF2A 3DTBA 4L2GA 4L0BA 5AKUA 4HHZA 5LXPA 4R5WA 4GNQA 4OQAC 1J3BA 4L09A 5AL1A 4HKIA 1YLHA 3L3MA 4UVPA 3KR7A 5ADRA 2RKDA 3GN7A 4W5IA 4BFPA 2RK7A 4BUTA 4HYFA 4W5SA 4GV4A 4BUAA 3DT2A 1OS1A 5FH4A 4UVWA 4UXBA 2PC9A 3MHKA 5FH1A 2PQFA 4R6EA 4L2KA 4GMZA 4L7UA 5DCZA 4PAXA 1AQ2A 3GJWA 3GOYA 5AL2A 4BU3A 4BU5A 4BUEA 5EBTA 5C5RA 2OLRA 4OQBC 4BUVA 3UDDA 4BS4A 3DT7A 4L0IA 4R43A 4UX4A 2RF5A 3KR8A 2X5YA 4GNLA 4L7NA 2RKAA 3BLJA 4TJYA 4UI4A 5FH2A 4YWDA 5ADSA 2PXZX 4PJTA 2FAHA 1NHXA 4UFUA 5ECEA 5C5PA 2RK8A 4LI6A 4L0TA 4MSGA 4YWBA 4UVOA 4RV6A 4UVTA 4WPUA 4J1ZA 4OX2A 4OPXC 4YW8A 1KHBA 1K3CA 5ADTA 2QEYA 4L2FA 3UA9A 4LI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNL A;  4UI7 A;  4BJC A;  4PML A;  5AL5 A;  4L0V A;  4MT9 A;  3L3L A;  4PNN A;  4L70 A;  4X52 A;  4BUF A;  4HLH A;  2PAX A;  4W6E A;  4AVU A;  3U9Y A;  4U6A A;  3P0P A;  4UVS A;  4KZU A;  4HHY A;  4M7B A;  4UND A;  4BJB A;  4ZZY A;  4TOS A;  1A26 A;  4BUS A;  3SE2 A;  1WOK A;  4HKN A;  5C5Q A;  3W51 A;  4TJU A;  4PY4 A;  4DVI A;  4IUE A;  3U9H A;  4UUH A;  4L34 A;  4L32 A;  4BU9 A;  4L33 A;  4L7R A;  4XHU A;  4BU8 A;  4PJV A;  1GS0 A;  4UI8 A;  4UVL A;  4BUY A;  4BUD A;  4TOR A;  4BUU A;  3MHJ A;  4TKF A;  4K4E A;  4L0S A;  4HKK A;  4BUW A;  3SMI A;  3C4H A;  4PNQ A;  5AL3 A;  4ZZX A;  3UH4 A;  3KCZ A;  4BJ9 A;  3CE0 A;  4UVZ A;  4J22 A;  4UI5 A;  4GV7 A;  4OA7 A;  4L6S A;  4TVJ A;  4ZZZ A;  4UVU A;  4L31 A;  4BU6 A;  4N3R A;  4MSK A;  3UH2 A;  4TJW A;  5ETY A;  4PNT A;  4HL5 A;  4I9I A;  4TKG A;  4J3M A;  4L7P A;  4HMH A;  5FPG A;  5LYH A;  3KJD A;  4F1L A;  4LI8 A;  4TK0 A;  4PNM A;  5AL4 A;  3P0N A;  4F1Q A;  3SMJ A;  4UVX A;  3HKV A;  1UK1 A;  4KZQ A;  4L6Z A;  4UI3 A;  4UVY A;  4UW1 A;  4KRS A;  5ADS A;  2PAW A;  5A00 A;  4F0E A;  4L7L A;  4AVW A;  1PAX A;  3FHB A;  4PNR A;  4K4F A;  4UI6 A;  4PNS A;  4GV0 A;  4N4V A;  3GEY A;  4HLK A;  4HLG A;  4KZL A;  4TKI A;  5AKW A;  2RCW A;  4HLM A;  4TK5 A;  3P0Q A;  4UHG A;  5AEH A;  5LX6 A;  4BUI A;  4HLF A;  3PAX A;  4L10 A;  1UK0 A;  3C49 A;  4N4T A;  4UVV A;  2RD6 A;  1EFY A;  5FPF A;  4BUX A;  4GV2 A;  4UFY A;  4DQY C;  4L7O A;  4J21 A;  4BU7 A;  4UVN A;  5AKU A;  4L2G A;  5LXP A;  4L0B A;  4OQA C;  4HHZ A;  4R5W A;  4L09 A;  5AL1 A;  4HKI A;  3L3M A;  4UVP A;  3KR7 A;  5ADR A;  3GN7 A;  4W5I A;  4BFP A;  4BUT A;  4HYF A;  4W5S A;  4GV4 A;  4BUA A;  4UVW A;  4UXB A;  3MHK A;  2PQF A;  4R6E A;  4L2K A;  4L7U A;  5DCZ A;  4PAX A;  3GJW A;  3GOY A;  5AL2 A;  4BU3 A;  4BU5 A;  4BUE A;  5EBT A;  5C5R A;  4OQB C;  4BUV A;  3UDD A;  4BS4 A;  4L0I A;  4UX4 A;  2RF5 A;  3KR8 A;  2X5Y A;  4TJY A;  4L7N A;  3BLJ A;  4UI4 A;  5ADQ A;  4PJT A;  4UFU A;  5ECE A;  5C5P A;  4LI6 A;  4L0T A;  4MSG A;  4UVO A;  4RV6 A;  4UVT A;  4J1Z A;  4OPX C;  5ADT A;  4J3L A;  4L2F A;  3UA9 A;  4LI7 A; 
#chains in the Genus database with same CATH topology
 4PNL A;  2QF1 A;  4UI7 A;  4BJC A;  5I67 A;  4PML A;  5AL5 A;  4L0V A;  4MT9 A;  3L3L A;  4PNN A;  2OLQ A;  4L70 A;  4X52 A;  4BUF A;  4HLH A;  4GNP A;  2PAX A;  4GNO A;  4W6E A;  4AVU A;  3U9Y A;  1YVY A;  4U6A A;  3P0P A;  4UVS A;  2QZY A;  4HHY A;  4KZU A;  4M7B A;  4UND A;  4BJB A;  4ZZY A;  4TOS A;  1A26 A;  4BUS A;  5ADQ A;  3SE2 A;  1WOK A;  4HKN A;  4YW9 A;  5C5Q A;  3W51 A;  4J3L A;  4PY4 A;  4TJU A;  4DVI A;  4IUE A;  3U9H A;  4UUH A;  4L34 A;  4L32 A;  4BU9 A;  4L33 A;  4L7R A;  4XHU A;  4BU8 A;  4PJV A;  1GS0 A;  4UI8 A;  1KHE A;  4UVL A;  4BUY A;  4WPT A;  1YTM A;  4BUD A;  4TOR A;  4BUU A;  3MHJ A;  4TKF A;  4K4E A;  2PY7 X;  4L0S A;  1YGG A;  4HKK A;  4BUW A;  3SMI A;  3C4H A;  4PNQ A;  5AL3 A;  1AYL A;  4ZZX A;  3UH4 A;  1II2 A;  3KCZ A;  4BJ9 A;  3CE0 A;  4UVZ A;  4J22 A;  4WIU A;  1XKV A;  4GV7 A;  4OA7 A;  4L6S A;  4TVJ A;  4UI5 A;  4UVU A;  4ZZZ A;  4L31 A;  4BU6 A;  4N3R A;  4MSK A;  1M51 A;  3UH2 A;  4TJW A;  5ETY A;  4WIE A;  4PNT A;  4HL5 A;  4I9I A;  4TKG A;  4J3M A;  4L7P A;  4HMH A;  5FPG A;  5LYH A;  3KJD A;  4F1L A;  4LI8 A;  1K3D A;  4TK0 A;  4PNM A;  5AL4 A;  3P0N A;  3MOH A;  4F1Q A;  3SMJ A;  4GMW A;  4UVX A;  3HKV A;  1UK1 A;  4KZQ A;  4L6Z A;  4UI3 A;  4UVY A;  4UW1 A;  4KRS A;  4WL8 A;  4WPV A;  2PAW A;  3DT4 A;  4GNM A;  5FH0 A;  5A00 A;  4F0E A;  4L7L A;  4AVW A;  2QEW A;  3MOE A;  4GMU A;  5FH3 A;  2ZCI A;  1PAX A;  3FHB A;  4PNR A;  4K4F A;  4UI6 A;  4GMM A;  4GV0 A;  2GMV A;  2RKE A;  3GEY A;  4HLK A;  4HLG A;  4KZL A;  4N4V A;  4PNS A;  4TKI A;  5AKW A;  2RCW A;  4WOU A;  2FAF A;  5FH5 A;  4HLM A;  4TK5 A;  3MOF A;  3P0Q A;  4UHG A;  5AEH A;  5LX6 A;  4BUI A;  4HLF A;  1OEN A;  3PAX A;  1UK0 A;  3C49 A;  4L10 A;  1KHG A;  4N4T A;  4RCG A;  4UVV A;  2RD6 A;  1EFY A;  5FPF A;  4BUX A;  4GV2 A;  4UFY A;  4DQY C;  4L7O A;  4J21 A;  4BU7 A;  4UVN A;  1KHF A;  2QF2 A;  3DTB A;  4L2G A;  4L0B A;  5AKU A;  4HHZ A;  5LXP A;  4R5W A;  4GNQ A;  4OQA C;  1J3B A;  4L09 A;  5AL1 A;  4HKI A;  1YLH A;  3L3M A;  4UVP A;  3KR7 A;  5ADR A;  2RKD A;  3GN7 A;  4W5I A;  4BFP A;  2RK7 A;  4BUT A;  4HYF A;  4W5S A;  4GV4 A;  4BUA A;  3DT2 A;  1OS1 A;  5FH4 A;  4UVW A;  4UXB A;  2PC9 A;  3MHK A;  5FH1 A;  2PQF A;  4R6E A;  4L2K A;  4GMZ A;  4L7U A;  5DCZ A;  4PAX A;  1AQ2 A;  3GJW A;  3GOY A;  5AL2 A;  4BU3 A;  4BU5 A;  4BUE A;  5EBT A;  5C5R A;  2OLR A;  4OQB C;  4BUV A;  3UDD A;  4BS4 A;  3DT7 A;  4L0I A;  4R43 A;  4UX4 A;  2RF5 A;  3KR8 A;  2X5Y A;  4GNL A;  4L7N A;  2RKA A;  3BLJ A;  4TJY A;  4UI4 A;  5FH2 A;  4YWD A;  5ADS A;  2PXZ X;  4PJT A;  2FAH A;  1NHX A;  4UFU A;  5ECE A;  5C5P A;  2RK8 A;  4LI6 A;  4L0T A;  4MSG A;  4YWB A;  4UVO A;  4RV6 A;  4UVT A;  4WPU A;  4J1Z A;  4OX2 A;  4OPX C;  4YW8 A;  1KHB A;  1K3C A;  5ADT A;  2QEY A;  4L2F A;  3UA9 A;  4LI7 A; 
#chains in the Genus database with same CATH homology
 4PNL A;  2QF1 A;  4UI7 A;  4BJC A;  5I67 A;  4PML A;  5AL5 A;  4L0V A;  4MT9 A;  3L3L A;  4PNN A;  2OLQ A;  4L70 A;  4X52 A;  4BUF A;  4HLH A;  4GNP A;  2PAX A;  4GNO A;  4W6E A;  4AVU A;  3U9Y A;  1YVY A;  4U6A A;  3P0P A;  4UVS A;  2QZY A;  4HHY A;  4KZU A;  4M7B A;  4UND A;  4BJB A;  4ZZY A;  4TOS A;  1A26 A;  4BUS A;  5ADQ A;  3SE2 A;  1WOK A;  4HKN A;  4YW9 A;  5C5Q A;  3W51 A;  4J3L A;  4PY4 A;  4TJU A;  4DVI A;  4IUE A;  3U9H A;  4UUH A;  4L34 A;  4L32 A;  4BU9 A;  4L33 A;  4L7R A;  4XHU A;  4BU8 A;  4PJV A;  1GS0 A;  4UI8 A;  1KHE A;  4UVL A;  4BUY A;  4WPT A;  1YTM A;  4BUD A;  4TOR A;  4BUU A;  3MHJ A;  4TKF A;  4K4E A;  2PY7 X;  4L0S A;  1YGG A;  4HKK A;  4BUW A;  3SMI A;  3C4H A;  4PNQ A;  5AL3 A;  1AYL A;  4ZZX A;  3UH4 A;  1II2 A;  3KCZ A;  4BJ9 A;  3CE0 A;  4UVZ A;  4J22 A;  4WIU A;  1XKV A;  4GV7 A;  4OA7 A;  4L6S A;  4TVJ A;  4UI5 A;  4UVU A;  4ZZZ A;  4L31 A;  4BU6 A;  4N3R A;  4MSK A;  1M51 A;  3UH2 A;  4TJW A;  5ETY A;  4WIE A;  4PNT A;  4HL5 A;  4I9I A;  4TKG A;  4J3M A;  4L7P A;  4HMH A;  5FPG A;  5LYH A;  3KJD A;  4F1L A;  4LI8 A;  1K3D A;  4TK0 A;  4PNM A;  5AL4 A;  3P0N A;  3MOH A;  4F1Q A;  3SMJ A;  4GMW A;  4UVX A;  3HKV A;  1UK1 A;  4KZQ A;  4L6Z A;  4UI3 A;  4UVY A;  4UW1 A;  4KRS A;  4WL8 A;  4WPV A;  2PAW A;  3DT4 A;  4GNM A;  5FH0 A;  5A00 A;  4F0E A;  4L7L A;  4AVW A;  2QEW A;  3MOE A;  4GMU A;  5FH3 A;  2ZCI A;  1PAX A;  3FHB A;  4PNR A;  4K4F A;  4UI6 A;  4GMM A;  4GV0 A;  2GMV A;  2RKE A;  3GEY A;  4HLK A;  4HLG A;  4KZL A;  4N4V A;  4PNS A;  4TKI A;  5AKW A;  2RCW A;  4WOU A;  2FAF A;  5FH5 A;  4HLM A;  4TK5 A;  3MOF A;  3P0Q A;  4UHG A;  5AEH A;  5LX6 A;  4BUI A;  4HLF A;  1OEN A;  3PAX A;  1UK0 A;  3C49 A;  4L10 A;  1KHG A;  4N4T A;  4RCG A;  4UVV A;  2RD6 A;  1EFY A;  5FPF A;  4BUX A;  4GV2 A;  4UFY A;  4DQY C;  4L7O A;  4J21 A;  4BU7 A;  4UVN A;  1KHF A;  2QF2 A;  3DTB A;  4L2G A;  4L0B A;  5AKU A;  4HHZ A;  5LXP A;  4R5W A;  4GNQ A;  4OQA C;  1J3B A;  4L09 A;  5AL1 A;  4HKI A;  1YLH A;  3L3M A;  4UVP A;  3KR7 A;  5ADR A;  2RKD A;  3GN7 A;  4W5I A;  4BFP A;  2RK7 A;  4BUT A;  4HYF A;  4W5S A;  4GV4 A;  4BUA A;  3DT2 A;  1OS1 A;  5FH4 A;  4UVW A;  4UXB A;  2PC9 A;  3MHK A;  5FH1 A;  2PQF A;  4R6E A;  4L2K A;  4GMZ A;  4L7U A;  5DCZ A;  4PAX A;  1AQ2 A;  3GJW A;  3GOY A;  5AL2 A;  4BU3 A;  4BU5 A;  4BUE A;  5EBT A;  5C5R A;  2OLR A;  4OQB C;  4BUV A;  3UDD A;  4BS4 A;  3DT7 A;  4L0I A;  4R43 A;  4UX4 A;  2RF5 A;  3KR8 A;  2X5Y A;  4GNL A;  4L7N A;  2RKA A;  3BLJ A;  4TJY A;  4UI4 A;  5FH2 A;  4YWD A;  5ADS A;  2PXZ X;  4PJT A;  2FAH A;  1NHX A;  4UFU A;  5ECE A;  5C5P A;  2RK8 A;  4LI6 A;  4L0T A;  4MSG A;  4YWB A;  4UVO A;  4RV6 A;  4UVT A;  4WPU A;  4J1Z A;  4OX2 A;  4OPX C;  4YW8 A;  1KHB A;  1K3C A;  5ADT A;  2QEY A;  4L2F A;  3UA9 A;  4LI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...