4BS4A

Crystal structure of human tankyrase 2 in complex with 4'-isopropylflavone
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
210
structure length
207
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Discovery of Tankyrase Inhibiting Flavones with Increased Potency and Isoenzyme Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 207
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bs4A00
4UVTA 4BJCA 3GOYA 3PAXA 1EFYA 3GEYA 2PQFA 4HKKA 4UVWA 2RF5A 2PAWA 4RV6A 4L6ZA 4J1ZA 4AVUA 1GS0A 4HKNA 4UFYA 4BU7A 3KCZA 4MSKA 5C5PA 4OPXC 4L7OA 4HMHA 5AL3A 4HLKA 4BUVA 4M7BA 3GJWA 5ADQA 4W5IA 4L7LA 4TOSA 4UI5A 4PNTA 4PY4A 4UVUA 5ETYA 4L2GA 1UK0A 4LI6A 4UVZA 4BFPA 4UVXA 3CE0A 4OA7A 4BU9A 3SMIA 3P0PA 3C4HA 4IUEA 4UW1A 4UI8A 4HLFA 5DCZA 3FHBA 4DVIA 4K4FA 4UVYA 4HL5A 4J3LA 4W5SA 3L3MA 4UI7A 4W6EA 4N3RA 5ECEA 4K4EA 5ADSA 4BUYA 5LX6A 4PJVA 4UHGA 4R5WA 4DQYC 5C5QA 3SE2A 4L70A 3KJDA 3MHJA 4J22A 4N4TA 4GV7A 4PNRA 3P0QA 1A26A 4LI7A 3U9YA 4UXBA 4BU8A 4KZQA 4L31A 4L0TA 4BUFA 4TK0A 5FPFA 4UVLA 1WOKA 4PNNA 4L33A 4BJ9A 4L09A 1PAXA 4BJBA 4GV4A 4BUEA 4OQAC 5AL5A 4HHYA 4L0VA 2PAXA 3UA9A 4KZLA 4PJTA 4TKGA 4TJYA 4X52A 4OQBC 3HKVA 4UUHA 5ADTA 4BUUA 4HLHA 4UI3A 4N4VA 4BUSA 4UFUA 4GV2A 4L2FA 5AKUA 4BS4A 4ZZXA 5A00A 4TJUA 4BUXA 4L34A 4UX4A 3W51A 4KRSA 4L2KA 4PNSA 5ADRA 3GN7A 3BLJA 4PNMA 4XHUA 4BU3A 4GV0A 4UVOA 3SMJA 4F1QA 4BUTA 3KR8A 4L7RA 5AEHA 5FPGA 4UNDA 4AVWA 4L0SA 4L32A 4LI8A 4PNLA 4TKFA 4KZUA 4BUDA 4HLMA 4L0IA 4I9IA 2RCWA 4TVJA 5C5RA 5AL1A 1UK1A 3KR7A 2X5YA 4BUWA 3C49A 4J21A 3MHKA 5AL2A 2RD6A 4L7PA 4ZZZA 4L7UA 4TKIA 4HYFA 4UVVA 4TK5A 3U9HA 4L0BA 4L7NA 4UVSA 4R6EA 4UI6A 4HLGA 5EBTA 4MT9A 5LXPA 4HHZA 4UI4A 4BU6A 4F0EA 3UH4A 5AL4A 5LYHA 4PMLA 3P0NA 3UH2A 4BUIA 4TORA 4UVPA 4F1LA 4J3MA 4UVNA 4L10A 4HKIA 4MSGA 4U6AA 4PAXA 4BUAA 4L6SA 4BU5A 4ZZYA 5AKWA 3L3LA 4PNQA 3UDDA 4TJWA
chains in the Genus database with same CATH superfamily
4UVTA 2PC9A 4BJCA 3GOYA 3PAXA 1EFYA 3GEYA 2PQFA 4GMMA 4HKKA 4UVWA 2ZCIA 2RF5A 2PAWA 2GMVA 4GMZA 4L6ZA 4J1ZA 4RV6A 4AVUA 1GS0A 4HKNA 4UFYA 4BU7A 3KCZA 4MSKA 5C5PA 4OPXC 4L7OA 4WOUA 4HMHA 5AL3A 4HLKA 4BUVA 4F1QA 4M7BA 3GJWA 1YVYA 3DT2A 5ADQA 4W5IA 4L7LA 4TOSA 4UI5A 4PNTA 1OS1A 4PY4A 4UVUA 4L2GA 1UK0A 2QF1A 4LI6A 4UVZA 5ETYA 4UVXA 3CE0A 4OA7A 4BFPA 4BU9A 3SMIA 3P0PA 3C4HA 4IUEA 4UW1A 4UI8A 4HLFA 5DCZA 4RCGA 3FHBA 1XKVA 4DVIA 2QZYA 2FAHA 4K4FA 2PXZX 1J3BA 4GMUA 4UVYA 4HL5A 4J3LA 4W5SA 3L3MA 1KHGA 4UI7A 4N3RA 4W6EA 3MOHA 4K4EA 3MOFA 5ECEA 4BUYA 5LX6A 4PJVA 4UHGA 4R5WA 4GMWA 4DQYC 4GNQA 1AQ2A 4WPTA 5C5QA 3SE2A 4L70A 3KJDA 3MHJA 4J22A 4N4TA 2QEYA 4GV7A 2RKAA 3P0QA 4PNRA 1A26A 4LI7A 3U9YA 5I67A 4GNMA 4UXBA 2QF2A 4KZQA 4L31A 4L0TA 4WPVA 4BU8A 4UVLA 1WOKA 4BUFA 4TK0A 4PNNA 5FPFA 4L33A 4BJ9A 4L09A 1PAXA 4BJBA 4GV4A 1KHEA 3DTBA 4YW9A 4BUEA 4OQAC 5AL5A 4HHYA 4L0VA 2PAXA 3UA9A 4WL8A 4KZLA 4PJTA 4TKGA 4TJYA 4X52A 4OQBC 3HKVA 2OLRA 4UUHA 5ADTA 4BUUA 4HLHA 4UI3A 4N4VA 4BUSA 4UFUA 4GV2A 4L2FA 5AKUA 4YWBA 4BS4A 5FH2A 4ZZXA 4R43A 4TJUA 5A00A 1II2A 4L34A 4UX4A 4BUXA 3W51A 4KRSA 4L2KA 4PNSA 2OLQA 5ADRA 3GN7A 3BLJA 4PNMA 4XHUA 4BU3A 4GV0A 4UVOA 4PNQA 1KHBA 4GNOA 5FH0A 1KHFA 3KR8A 4YWDA 3SMJA 4L7RA 4BUTA 5AEHA 2RKDA 4UNDA 5FPGA 4AVWA 4L0SA 4L32A 4LI8A 4PNLA 4TKFA 4KZUA 1AYLA 5FH4A 3DT7A 4HLMA 4BUDA 4L0IA 1YTMA 2QEWA 2RCWA 4I9IA 2RK8A 4TVJA 3DT4A 5C5RA 5AL1A 1UK1A 3KR7A 2X5YA 2RKEA 1K3CA 3C49A 4BUWA 4J21A 3MHKA 5AL2A 1NHXA 4YW8A 2RD6A 4GNLA 4L7PA 4ZZZA 4L7UA 4TKIA 1YGGA 2RK7A 4HYFA 4UVVA 4TK5A 3U9HA 4L0BA 4L7NA 4GNPA 4UVSA 4R6EA 4UI6A 4HLGA 4WPUA 5EBTA 4MT9A 5LXPA 4HHZA 4UI4A 5FH5A 4BU6A 4WIUA 3UH4A 4F0EA 1K3DA 1YLHA 5AL4A 5LYHA 4PMLA 5ADSA 3P0NA 3UH2A 4BUIA 2PY7X 4TORA 4UVPA 4F1LA 4J3MA 1M51A 5FH1A 4UVNA 4L10A 4WIEA 4OX2A 5FH3A 4HKIA 4MSGA 4U6AA 4PAXA 1OENA 4BUAA 4L6SA 4BU5A 4ZZYA 5AKWA 3L3LA 3MOEA 2FAFA 3UDDA 4TJWA
chains in the Genus database with same CATH topology
4UVTA 2PC9A 4BJCA 3GOYA 3PAXA 1EFYA 3GEYA 2PQFA 4GMMA 4HKKA 4UVWA 2ZCIA 2RF5A 2PAWA 2GMVA 4GMZA 4L6ZA 4J1ZA 4RV6A 4AVUA 1GS0A 4HKNA 4UFYA 4BU7A 3KCZA 4MSKA 5C5PA 4OPXC 4L7OA 4WOUA 4HMHA 5AL3A 4HLKA 4BUVA 4F1QA 4M7BA 3GJWA 1YVYA 3DT2A 5ADQA 4W5IA 4L7LA 4TOSA 4UI5A 4PNTA 1OS1A 4PY4A 4UVUA 4L2GA 1UK0A 2QF1A 4LI6A 4UVZA 5ETYA 4UVXA 3CE0A 4OA7A 4BFPA 4BU9A 3SMIA 3P0PA 3C4HA 4IUEA 4UW1A 4UI8A 4HLFA 5DCZA 4RCGA 3FHBA 1XKVA 4DVIA 2QZYA 2FAHA 4K4FA 2PXZX 1J3BA 4GMUA 4UVYA 4HL5A 4J3LA 4W5SA 3L3MA 1KHGA 4UI7A 4N3RA 4W6EA 3MOHA 4K4EA 3MOFA 5ECEA 4BUYA 5LX6A 4PJVA 4UHGA 4R5WA 4GMWA 4DQYC 4GNQA 1AQ2A 4WPTA 5C5QA 3SE2A 4L70A 3KJDA 3MHJA 4J22A 4N4TA 2QEYA 4GV7A 2RKAA 3P0QA 4PNRA 1A26A 4LI7A 3U9YA 5I67A 4GNMA 4UXBA 2QF2A 4KZQA 4L31A 4L0TA 4WPVA 4BU8A 4UVLA 1WOKA 4BUFA 4TK0A 4PNNA 5FPFA 4L33A 4BJ9A 4L09A 1PAXA 4BJBA 4GV4A 1KHEA 3DTBA 4YW9A 4BUEA 4OQAC 5AL5A 4HHYA 4L0VA 2PAXA 3UA9A 4WL8A 4KZLA 4PJTA 4TKGA 4TJYA 4X52A 4OQBC 3HKVA 2OLRA 4UUHA 5ADTA 4BUUA 4HLHA 4UI3A 4N4VA 4BUSA 4UFUA 4GV2A 4L2FA 5AKUA 4YWBA 4BS4A 5FH2A 4ZZXA 4R43A 4TJUA 5A00A 1II2A 4L34A 4UX4A 4BUXA 3W51A 4KRSA 4L2KA 4PNSA 2OLQA 5ADRA 3GN7A 3BLJA 4PNMA 4XHUA 4BU3A 4GV0A 4UVOA 4PNQA 1KHBA 4GNOA 5FH0A 1KHFA 3KR8A 4YWDA 3SMJA 4L7RA 4BUTA 5AEHA 2RKDA 4UNDA 5FPGA 4AVWA 4L0SA 4L32A 4LI8A 4PNLA 4TKFA 4KZUA 1AYLA 5FH4A 3DT7A 4HLMA 4BUDA 4L0IA 1YTMA 2QEWA 2RCWA 4I9IA 2RK8A 4TVJA 3DT4A 5C5RA 5AL1A 1UK1A 3KR7A 2X5YA 2RKEA 1K3CA 3C49A 4BUWA 4J21A 3MHKA 5AL2A 1NHXA 4YW8A 2RD6A 4GNLA 4L7PA 4ZZZA 4L7UA 4TKIA 1YGGA 2RK7A 4HYFA 4UVVA 4TK5A 3U9HA 4L0BA 4L7NA 4GNPA 4UVSA 4R6EA 4UI6A 4HLGA 4WPUA 5EBTA 4MT9A 5LXPA 4HHZA 4UI4A 5FH5A 4BU6A 4WIUA 3UH4A 4F0EA 1K3DA 1YLHA 5AL4A 5LYHA 4PMLA 5ADSA 3P0NA 3UH2A 4BUIA 2PY7X 4TORA 4UVPA 4F1LA 4J3MA 1M51A 5FH1A 4UVNA 4L10A 4WIEA 4OX2A 5FH3A 4HKIA 4MSGA 4U6AA 4PAXA 1OENA 4BUAA 4L6SA 4BU5A 4ZZYA 5AKWA 3L3LA 3MOEA 2FAFA 3UDDA 4TJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVT A;  4BJC A;  3GOY A;  3PAX A;  1EFY A;  3GEY A;  2PQF A;  4HKK A;  4UVW A;  2RF5 A;  2PAW A;  4RV6 A;  4L6Z A;  4J1Z A;  4AVU A;  1GS0 A;  4HKN A;  4UFY A;  4BU7 A;  3KCZ A;  4MSK A;  5C5P A;  4OPX C;  4L7O A;  4HMH A;  5AL3 A;  4HLK A;  4BUV A;  4M7B A;  3GJW A;  5ADQ A;  4W5I A;  4L7L A;  4TOS A;  4UI5 A;  4PNT A;  4PY4 A;  4UVU A;  5ETY A;  4L2G A;  1UK0 A;  4LI6 A;  4UVZ A;  4BFP A;  4UVX A;  3CE0 A;  4OA7 A;  4BU9 A;  3SMI A;  3P0P A;  3C4H A;  4IUE A;  4UW1 A;  4UI8 A;  4HLF A;  5DCZ A;  3FHB A;  4DVI A;  4K4F A;  4UVY A;  4HL5 A;  4J3L A;  4W5S A;  3L3M A;  4UI7 A;  4W6E A;  4N3R A;  5ECE A;  4K4E A;  5ADS A;  4BUY A;  5LX6 A;  4PJV A;  4UHG A;  4R5W A;  4DQY C;  5C5Q A;  3SE2 A;  4L70 A;  3KJD A;  3MHJ A;  4J22 A;  4N4T A;  4GV7 A;  4PNR A;  3P0Q A;  1A26 A;  4LI7 A;  3U9Y A;  4UXB A;  4BU8 A;  4KZQ A;  4L31 A;  4L0T A;  4BUF A;  4TK0 A;  5FPF A;  4UVL A;  1WOK A;  4PNN A;  4L33 A;  4BJ9 A;  4L09 A;  1PAX A;  4BJB A;  4GV4 A;  4BUE A;  4OQA C;  5AL5 A;  4HHY A;  4L0V A;  2PAX A;  3UA9 A;  4KZL A;  4PJT A;  4TKG A;  4TJY A;  4X52 A;  4OQB C;  3HKV A;  4UUH A;  5ADT A;  4BUU A;  4HLH A;  4UI3 A;  4N4V A;  4BUS A;  4UFU A;  4GV2 A;  4L2F A;  5AKU A;  4BS4 A;  4ZZX A;  5A00 A;  4TJU A;  4BUX A;  4L34 A;  4UX4 A;  3W51 A;  4KRS A;  4L2K A;  4PNS A;  5ADR A;  3GN7 A;  3BLJ A;  4PNM A;  4XHU A;  4BU3 A;  4GV0 A;  4UVO A;  3SMJ A;  4F1Q A;  4BUT A;  3KR8 A;  4L7R A;  5AEH A;  5FPG A;  4UND A;  4AVW A;  4L0S A;  4L32 A;  4LI8 A;  4PNL A;  4TKF A;  4KZU A;  4BUD A;  4HLM A;  4L0I A;  4I9I A;  2RCW A;  4TVJ A;  5C5R A;  5AL1 A;  1UK1 A;  3KR7 A;  2X5Y A;  4BUW A;  3C49 A;  4J21 A;  3MHK A;  5AL2 A;  2RD6 A;  4L7P A;  4ZZZ A;  4L7U A;  4TKI A;  4HYF A;  4UVV A;  4TK5 A;  3U9H A;  4L0B A;  4L7N A;  4UVS A;  4R6E A;  4UI6 A;  4HLG A;  5EBT A;  4MT9 A;  5LXP A;  4HHZ A;  4UI4 A;  4BU6 A;  4F0E A;  3UH4 A;  5AL4 A;  5LYH A;  4PML A;  3P0N A;  3UH2 A;  4BUI A;  4TOR A;  4UVP A;  4F1L A;  4J3M A;  4UVN A;  4L10 A;  4HKI A;  4MSG A;  4U6A A;  4PAX A;  4BUA A;  4L6S A;  4BU5 A;  4ZZY A;  5AKW A;  3L3L A;  4PNQ A;  3UDD A;  4TJW A; 
#chains in the Genus database with same CATH topology
 4UVT A;  2PC9 A;  4BJC A;  3GOY A;  3PAX A;  1EFY A;  3GEY A;  2PQF A;  4GMM A;  4HKK A;  4UVW A;  2ZCI A;  2RF5 A;  2PAW A;  2GMV A;  4GMZ A;  4L6Z A;  4J1Z A;  4RV6 A;  4AVU A;  1GS0 A;  4HKN A;  4UFY A;  4BU7 A;  3KCZ A;  4MSK A;  5C5P A;  4OPX C;  4L7O A;  4WOU A;  4HMH A;  5AL3 A;  4HLK A;  4BUV A;  4F1Q A;  4M7B A;  3GJW A;  1YVY A;  3DT2 A;  5ADQ A;  4W5I A;  4L7L A;  4TOS A;  4UI5 A;  4PNT A;  1OS1 A;  4PY4 A;  4UVU A;  4L2G A;  1UK0 A;  2QF1 A;  4LI6 A;  4UVZ A;  5ETY A;  4UVX A;  3CE0 A;  4OA7 A;  4BFP A;  4BU9 A;  3SMI A;  3P0P A;  3C4H A;  4IUE A;  4UW1 A;  4UI8 A;  4HLF A;  5DCZ A;  4RCG A;  3FHB A;  1XKV A;  4DVI A;  2QZY A;  2FAH A;  4K4F A;  2PXZ X;  1J3B A;  4GMU A;  4UVY A;  4HL5 A;  4J3L A;  4W5S A;  3L3M A;  1KHG A;  4UI7 A;  4N3R A;  4W6E A;  3MOH A;  4K4E A;  3MOF A;  5ECE A;  4BUY A;  5LX6 A;  4PJV A;  4UHG A;  4R5W A;  4GMW A;  4DQY C;  4GNQ A;  1AQ2 A;  4WPT A;  5C5Q A;  3SE2 A;  4L70 A;  3KJD A;  3MHJ A;  4J22 A;  4N4T A;  2QEY A;  4GV7 A;  2RKA A;  3P0Q A;  4PNR A;  1A26 A;  4LI7 A;  3U9Y A;  5I67 A;  4GNM A;  4UXB A;  2QF2 A;  4KZQ A;  4L31 A;  4L0T A;  4WPV A;  4BU8 A;  4UVL A;  1WOK A;  4BUF A;  4TK0 A;  4PNN A;  5FPF A;  4L33 A;  4BJ9 A;  4L09 A;  1PAX A;  4BJB A;  4GV4 A;  1KHE A;  3DTB A;  4YW9 A;  4BUE A;  4OQA C;  5AL5 A;  4HHY A;  4L0V A;  2PAX A;  3UA9 A;  4WL8 A;  4KZL A;  4PJT A;  4TKG A;  4TJY A;  4X52 A;  4OQB C;  3HKV A;  2OLR A;  4UUH A;  5ADT A;  4BUU A;  4HLH A;  4UI3 A;  4N4V A;  4BUS A;  4UFU A;  4GV2 A;  4L2F A;  5AKU A;  4YWB A;  4BS4 A;  5FH2 A;  4ZZX A;  4R43 A;  4TJU A;  5A00 A;  1II2 A;  4L34 A;  4UX4 A;  4BUX A;  3W51 A;  4KRS A;  4L2K A;  4PNS A;  2OLQ A;  5ADR A;  3GN7 A;  3BLJ A;  4PNM A;  4XHU A;  4BU3 A;  4GV0 A;  4UVO A;  4PNQ A;  1KHB A;  4GNO A;  5FH0 A;  1KHF A;  3KR8 A;  4YWD A;  3SMJ A;  4L7R A;  4BUT A;  5AEH A;  2RKD A;  4UND A;  5FPG A;  4AVW A;  4L0S A;  4L32 A;  4LI8 A;  4PNL A;  4TKF A;  4KZU A;  1AYL A;  5FH4 A;  3DT7 A;  4HLM A;  4BUD A;  4L0I A;  1YTM A;  2QEW A;  2RCW A;  4I9I A;  2RK8 A;  4TVJ A;  3DT4 A;  5C5R A;  5AL1 A;  1UK1 A;  3KR7 A;  2X5Y A;  2RKE A;  1K3C A;  3C49 A;  4BUW A;  4J21 A;  3MHK A;  5AL2 A;  1NHX A;  4YW8 A;  2RD6 A;  4GNL A;  4L7P A;  4ZZZ A;  4L7U A;  4TKI A;  1YGG A;  2RK7 A;  4HYF A;  4UVV A;  4TK5 A;  3U9H A;  4L0B A;  4L7N A;  4GNP A;  4UVS A;  4R6E A;  4UI6 A;  4HLG A;  4WPU A;  5EBT A;  4MT9 A;  5LXP A;  4HHZ A;  4UI4 A;  5FH5 A;  4BU6 A;  4WIU A;  3UH4 A;  4F0E A;  1K3D A;  1YLH A;  5AL4 A;  5LYH A;  4PML A;  5ADS A;  3P0N A;  3UH2 A;  4BUI A;  2PY7 X;  4TOR A;  4UVP A;  4F1L A;  4J3M A;  1M51 A;  5FH1 A;  4UVN A;  4L10 A;  4WIE A;  4OX2 A;  5FH3 A;  4HKI A;  4MSG A;  4U6A A;  4PAX A;  1OEN A;  4BUA A;  4L6S A;  4BU5 A;  4ZZY A;  5AKW A;  3L3L A;  3MOE A;  2FAF A;  3UDD A;  4TJW A; 
#chains in the Genus database with same CATH homology
 4UVT A;  2PC9 A;  4BJC A;  3GOY A;  3PAX A;  1EFY A;  3GEY A;  2PQF A;  4GMM A;  4HKK A;  4UVW A;  2ZCI A;  2RF5 A;  2PAW A;  2GMV A;  4GMZ A;  4L6Z A;  4J1Z A;  4RV6 A;  4AVU A;  1GS0 A;  4HKN A;  4UFY A;  4BU7 A;  3KCZ A;  4MSK A;  5C5P A;  4OPX C;  4L7O A;  4WOU A;  4HMH A;  5AL3 A;  4HLK A;  4BUV A;  4F1Q A;  4M7B A;  3GJW A;  1YVY A;  3DT2 A;  5ADQ A;  4W5I A;  4L7L A;  4TOS A;  4UI5 A;  4PNT A;  1OS1 A;  4PY4 A;  4UVU A;  4L2G A;  1UK0 A;  2QF1 A;  4LI6 A;  4UVZ A;  5ETY A;  4UVX A;  3CE0 A;  4OA7 A;  4BFP A;  4BU9 A;  3SMI A;  3P0P A;  3C4H A;  4IUE A;  4UW1 A;  4UI8 A;  4HLF A;  5DCZ A;  4RCG A;  3FHB A;  1XKV A;  4DVI A;  2QZY A;  2FAH A;  4K4F A;  2PXZ X;  1J3B A;  4GMU A;  4UVY A;  4HL5 A;  4J3L A;  4W5S A;  3L3M A;  1KHG A;  4UI7 A;  4N3R A;  4W6E A;  3MOH A;  4K4E A;  3MOF A;  5ECE A;  4BUY A;  5LX6 A;  4PJV A;  4UHG A;  4R5W A;  4GMW A;  4DQY C;  4GNQ A;  1AQ2 A;  4WPT A;  5C5Q A;  3SE2 A;  4L70 A;  3KJD A;  3MHJ A;  4J22 A;  4N4T A;  2QEY A;  4GV7 A;  2RKA A;  3P0Q A;  4PNR A;  1A26 A;  4LI7 A;  3U9Y A;  5I67 A;  4GNM A;  4UXB A;  2QF2 A;  4KZQ A;  4L31 A;  4L0T A;  4WPV A;  4BU8 A;  4UVL A;  1WOK A;  4BUF A;  4TK0 A;  4PNN A;  5FPF A;  4L33 A;  4BJ9 A;  4L09 A;  1PAX A;  4BJB A;  4GV4 A;  1KHE A;  3DTB A;  4YW9 A;  4BUE A;  4OQA C;  5AL5 A;  4HHY A;  4L0V A;  2PAX A;  3UA9 A;  4WL8 A;  4KZL A;  4PJT A;  4TKG A;  4TJY A;  4X52 A;  4OQB C;  3HKV A;  2OLR A;  4UUH A;  5ADT A;  4BUU A;  4HLH A;  4UI3 A;  4N4V A;  4BUS A;  4UFU A;  4GV2 A;  4L2F A;  5AKU A;  4YWB A;  4BS4 A;  5FH2 A;  4ZZX A;  4R43 A;  4TJU A;  5A00 A;  1II2 A;  4L34 A;  4UX4 A;  4BUX A;  3W51 A;  4KRS A;  4L2K A;  4PNS A;  2OLQ A;  5ADR A;  3GN7 A;  3BLJ A;  4PNM A;  4XHU A;  4BU3 A;  4GV0 A;  4UVO A;  4PNQ A;  1KHB A;  4GNO A;  5FH0 A;  1KHF A;  3KR8 A;  4YWD A;  3SMJ A;  4L7R A;  4BUT A;  5AEH A;  2RKD A;  4UND A;  5FPG A;  4AVW A;  4L0S A;  4L32 A;  4LI8 A;  4PNL A;  4TKF A;  4KZU A;  1AYL A;  5FH4 A;  3DT7 A;  4HLM A;  4BUD A;  4L0I A;  1YTM A;  2QEW A;  2RCW A;  4I9I A;  2RK8 A;  4TVJ A;  3DT4 A;  5C5R A;  5AL1 A;  1UK1 A;  3KR7 A;  2X5Y A;  2RKE A;  1K3C A;  3C49 A;  4BUW A;  4J21 A;  3MHK A;  5AL2 A;  1NHX A;  4YW8 A;  2RD6 A;  4GNL A;  4L7P A;  4ZZZ A;  4L7U A;  4TKI A;  1YGG A;  2RK7 A;  4HYF A;  4UVV A;  4TK5 A;  3U9H A;  4L0B A;  4L7N A;  4GNP A;  4UVS A;  4R6E A;  4UI6 A;  4HLG A;  4WPU A;  5EBT A;  4MT9 A;  5LXP A;  4HHZ A;  4UI4 A;  5FH5 A;  4BU6 A;  4WIU A;  3UH4 A;  4F0E A;  1K3D A;  1YLH A;  5AL4 A;  5LYH A;  4PML A;  5ADS A;  3P0N A;  3UH2 A;  4BUI A;  2PY7 X;  4TOR A;  4UVP A;  4F1L A;  4J3M A;  1M51 A;  5FH1 A;  4UVN A;  4L10 A;  4WIE A;  4OX2 A;  5FH3 A;  4HKI A;  4MSG A;  4U6A A;  4PAX A;  1OEN A;  4BUA A;  4L6S A;  4BU5 A;  4ZZY A;  5AKW A;  3L3L A;  3MOE A;  2FAF A;  3UDD A;  4TJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...