4BS4A

Crystal structure of human tankyrase 2 in complex with 4'-isopropylflavone
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
210
structure length
207
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Discovery of Tankyrase Inhibiting Flavones with Increased Potency and Isoenzyme Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 207
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bs4A00
4N4TA 4BFPA 4L33A 4UI5A 5C5PA 4M7BA 4PNSA 5AL4A 4UVXA 3UH2A 3W51A 4BU6A 4RV6A 4R5WA 4PNNA 4PNTA 3FHBA 4PMLA 5AL5A 4L7OA 4TJYA 5LXPA 4GV4A 4GV0A 4UVLA 4HHYA 5AEHA 5LX6A 4L6SA 3L3LA 4K4FA 4UW1A 4BUXA 4BUYA 4MSGA 4UI7A 4UVNA 2X5YA 3KR7A 4KZLA 4J3MA 4UVZA 4BUEA 4BUIA 4TK5A 3C4HA 4UVWA 4UVTA 4PY4A 4HLKA 3UA9A 4TJWA 4IUEA 4L70A 4BUUA 2PAXA 3L3MA 4L34A 4UVPA 4ZZXA 3SE2A 4J22A 5EBTA 1UK0A 4N3RA 4J3LA 4L2GA 4PNLA 5FPGA 4UFYA 4L0TA 4J1ZA 4L7RA 5A00A 4L32A 4L2KA 4KZUA 4L31A 4PAXA 3BLJA 4U6AA 4AVWA 4BU3A 5ADSA 4F0EA 3MHKA 5AL1A 4UFUA 4HKKA 5C5QA 5FPFA 4BS4A 4HL5A 4GV7A 4L0VA 4HMHA 3GN7A 5AL2A 4OPXC 4W5SA 1GS0A 4X52A 4DVIA 4L7UA 3CE0A 4TOSA 4R6EA 4BUFA 4HKNA 4L0BA 4TVJA 3UH4A 5ADRA 4L2FA 4HLGA 4HLMA 4L7PA 4AVUA 4UHGA 5LYHA 4BJCA 5AKUA 3P0QA 4BU9A 3P0NA 5DCZA 2PAWA 4I9IA 4TKIA 3GJWA 3KCZA 4HYFA 4DQYC 2RF5A 3HKVA 4UI8A 4PJVA 3GOYA 4KRSA 4TORA 3SMIA 4BUVA 5ADQA 4HHZA 3MHJA 3P0PA 3C49A 4L09A 1EFYA 4L7LA 4K4EA 4L7NA 4W5IA 5AKWA 4UI3A 5ETYA 4BJ9A 4BUSA 4BUAA 4UI4A 4PJTA 4XHUA 4OQAC 4UNDA 4BUDA 4BU7A 4N4VA 5C5RA 5ADTA 4UVVA 4LI8A 3KJDA 4PNMA 4PNQA 4TJUA 3UDDA 4HLFA 4UVUA 4BU5A 4LI6A 4UXBA 3SMJA 1A26A 4LI7A 4L6ZA 4PNRA 4L10A 4F1LA 4UUHA 4L0SA 4BUTA 1PAXA 4BUWA 4TK0A 4MT9A 4BJBA 4W6EA 1WOKA 4J21A 3U9YA 4UI6A 4F1QA 4MSKA 4HKIA 4TKFA 4ZZZA 5AL3A 4OA7A 5ECEA 4UVOA 4ZZYA 2PQFA 4UVSA 4UVYA 4OQBC 3U9HA 4BU8A 4L0IA 4KZQA 3GEYA 4GV2A 4TKGA 1UK1A 2RD6A 3KR8A 4HLHA 4UX4A 3PAXA 2RCWA
chains in the Genus database with same CATH superfamily
4N4TA 4BFPA 1KHBA 4WIEA 2RKDA 1AQ2A 4L33A 2RK7A 3DTBA 4UI5A 5C5PA 4M7BA 4PNSA 5AL4A 4UVXA 3UH2A 3W51A 4BU6A 3MOFA 4RV6A 1NHXA 4PNNA 4PNTA 4R5WA 3FHBA 4PMLA 5AL5A 4L7OA 4WL8A 1XKVA 4TJYA 2GMVA 4GV4A 4GV0A 4UVLA 5LXPA 4HHYA 5AEHA 5LX6A 1KHEA 4L6SA 3L3LA 4K4FA 1YGGA 4UW1A 4BUYA 4BUXA 4MSGA 4UI7A 4UVNA 2X5YA 3KR7A 4KZLA 4J3MA 4UVZA 4BUEA 4BUIA 4TK5A 3C4HA 4UVWA 4GNMA 4UVTA 4PY4A 4HLKA 4BU9A 3DT2A 3UA9A 3DT4A 4TJWA 1J3BA 4IUEA 4L70A 2QF2A 4BUUA 2PAXA 3L3MA 4L34A 4UVPA 5FH1A 4ZZXA 3SE2A 4J22A 5EBTA 1UK0A 1KHFA 4GNOA 4J3LA 4L2GA 4N3RA 4PNLA 5FPGA 4UFYA 4L0TA 4GMMA 4J1ZA 4L7RA 5A00A 4L32A 4L2KA 4KZUA 4L31A 4PAXA 3BLJA 4U6AA 4AVWA 4BU3A 2ZCIA 4F0EA 5ADSA 3MHKA 5AL1A 4UFUA 4HKKA 5C5QA 2OLQA 4GMUA 5FPFA 4BS4A 4HL5A 4GV7A 4L0VA 4HMHA 1YLHA 3GN7A 5AL2A 2QEWA 4RCGA 4OX2A 4W5SA 1GS0A 4X52A 5FH0A 4DVIA 4OPXC 4L7UA 3CE0A 4TOSA 4WPTA 4R6EA 4BUFA 4YWDA 2FAHA 4HKNA 4L0BA 4TVJA 2QEYA 3UH4A 5ADRA 1OENA 2FAFA 4L2FA 2PC9A 4HLGA 4HLMA 4L7PA 4AVUA 4UHGA 5LYHA 4BJCA 5AKUA 3P0QA 4YW9A 3P0NA 5DCZA 1OS1A 2PAWA 5FH4A 2QZYA 4I9IA 1AYLA 3GJWA 3KCZA 1YVYA 4HYFA 4TKIA 4BJ9A 2PXZX 2OLRA 4DQYC 2RF5A 3HKVA 4UI8A 2RK8A 4PJVA 4GNQA 3MOEA 3GOYA 4KRSA 4TORA 3SMIA 4BUVA 5ADQA 4HHZA 4WOUA 3MHJA 3P0PA 2RKAA 3C49A 1EFYA 2QF1A 4K4EA 4L09A 4L7LA 4L7NA 4UI3A 4W5IA 4WPUA 5AKWA 5ETYA 4BUSA 4BUAA 4UI4A 4PJTA 4XHUA 1M51A 4UNDA 4BUDA 4OQAC 4BU7A 4N4VA 5C5RA 5ADTA 4UVVA 4GNPA 4GMWA 1K3CA 5FH5A 4LI8A 3KJDA 4PNMA 4PNQA 4TJUA 3UDDA 4HLFA 4UVUA 4BU5A 1KHGA 3DT7A 4LI6A 4UXBA 3SMJA 1A26A 4LI7A 4L6ZA 4PNRA 4L10A 4F1LA 4UUHA 4L0SA 5FH3A 4YWBA 4BUTA 1PAXA 4BUWA 2RKEA 4TK0A 4WIUA 4MT9A 4BJBA 4W6EA 1II2A 1WOKA 4J21A 4WPVA 2PY7X 3U9YA 4UI6A 4F1QA 4MSKA 4HKIA 4TKFA 4ZZZA 5AL3A 4OA7A 5ECEA 4UVOA 4YW8A 4ZZYA 2PQFA 4R43A 4UVSA 4UVYA 5I67A 4OQBC 4GNLA 3U9HA 4BU8A 4L0IA 4KZQA 1YTMA 3GEYA 4GV2A 4TKGA 1UK1A 2RD6A 3KR8A 1K3DA 3MOHA 4HLHA 5FH2A 4UX4A 4GMZA 3PAXA 2RCWA
chains in the Genus database with same CATH topology
4N4TA 4BFPA 1KHBA 4WIEA 2RKDA 1AQ2A 4L33A 2RK7A 3DTBA 4UI5A 5C5PA 4M7BA 4PNSA 5AL4A 4UVXA 3UH2A 3W51A 4BU6A 3MOFA 4RV6A 1NHXA 4PNNA 4PNTA 4R5WA 3FHBA 4PMLA 5AL5A 4L7OA 4WL8A 1XKVA 4TJYA 2GMVA 4GV4A 4GV0A 4UVLA 5LXPA 4HHYA 5AEHA 5LX6A 1KHEA 4L6SA 3L3LA 4K4FA 1YGGA 4UW1A 4BUYA 4BUXA 4MSGA 4UI7A 4UVNA 2X5YA 3KR7A 4KZLA 4J3MA 4UVZA 4BUEA 4BUIA 4TK5A 3C4HA 4UVWA 4GNMA 4UVTA 4PY4A 4HLKA 4BU9A 3DT2A 3UA9A 3DT4A 4TJWA 1J3BA 4IUEA 4L70A 2QF2A 4BUUA 2PAXA 3L3MA 4L34A 4UVPA 5FH1A 4ZZXA 3SE2A 4J22A 5EBTA 1UK0A 1KHFA 4GNOA 4J3LA 4L2GA 4N3RA 4PNLA 5FPGA 4UFYA 4L0TA 4GMMA 4J1ZA 4L7RA 5A00A 4L32A 4L2KA 4KZUA 4L31A 4PAXA 3BLJA 4U6AA 4AVWA 4BU3A 2ZCIA 4F0EA 5ADSA 3MHKA 5AL1A 4UFUA 4HKKA 5C5QA 2OLQA 4GMUA 5FPFA 4BS4A 4HL5A 4GV7A 4L0VA 4HMHA 1YLHA 3GN7A 5AL2A 2QEWA 4RCGA 4OX2A 4W5SA 1GS0A 4X52A 5FH0A 4DVIA 4OPXC 4L7UA 3CE0A 4TOSA 4WPTA 4R6EA 4BUFA 4YWDA 2FAHA 4HKNA 4L0BA 4TVJA 2QEYA 3UH4A 5ADRA 1OENA 2FAFA 4L2FA 2PC9A 4HLGA 4HLMA 4L7PA 4AVUA 4UHGA 5LYHA 4BJCA 5AKUA 3P0QA 4YW9A 3P0NA 5DCZA 1OS1A 2PAWA 5FH4A 2QZYA 4I9IA 1AYLA 3GJWA 3KCZA 1YVYA 4HYFA 4TKIA 4BJ9A 2PXZX 2OLRA 4DQYC 2RF5A 3HKVA 4UI8A 2RK8A 4PJVA 4GNQA 3MOEA 3GOYA 4KRSA 4TORA 3SMIA 4BUVA 5ADQA 4HHZA 4WOUA 3MHJA 3P0PA 2RKAA 3C49A 1EFYA 2QF1A 4K4EA 4L09A 4L7LA 4L7NA 4UI3A 4W5IA 4WPUA 5AKWA 5ETYA 4BUSA 4BUAA 4UI4A 4PJTA 4XHUA 1M51A 4UNDA 4BUDA 4OQAC 4BU7A 4N4VA 5C5RA 5ADTA 4UVVA 4GNPA 4GMWA 1K3CA 5FH5A 4LI8A 3KJDA 4PNMA 4PNQA 4TJUA 3UDDA 4HLFA 4UVUA 4BU5A 1KHGA 3DT7A 4LI6A 4UXBA 3SMJA 1A26A 4LI7A 4L6ZA 4PNRA 4L10A 4F1LA 4UUHA 4L0SA 5FH3A 4YWBA 4BUTA 1PAXA 4BUWA 2RKEA 4TK0A 4WIUA 4MT9A 4BJBA 4W6EA 1II2A 1WOKA 4J21A 4WPVA 2PY7X 3U9YA 4UI6A 4F1QA 4MSKA 4HKIA 4TKFA 4ZZZA 5AL3A 4OA7A 5ECEA 4UVOA 4YW8A 4ZZYA 2PQFA 4R43A 4UVSA 4UVYA 5I67A 4OQBC 4GNLA 3U9HA 4BU8A 4L0IA 4KZQA 1YTMA 3GEYA 4GV2A 4TKGA 1UK1A 2RD6A 3KR8A 1K3DA 3MOHA 4HLHA 5FH2A 4UX4A 4GMZA 3PAXA 2RCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4T A;  4BFP A;  4L33 A;  4UI5 A;  5C5P A;  4M7B A;  4PNS A;  5AL4 A;  4UVX A;  3UH2 A;  3W51 A;  4BU6 A;  4RV6 A;  4R5W A;  4PNN A;  4PNT A;  3FHB A;  4PML A;  5AL5 A;  4L7O A;  4TJY A;  5LXP A;  4GV4 A;  4GV0 A;  4UVL A;  4HHY A;  5AEH A;  5LX6 A;  4L6S A;  3L3L A;  4K4F A;  4UW1 A;  4BUX A;  4BUY A;  4MSG A;  4UI7 A;  4UVN A;  2X5Y A;  3KR7 A;  4KZL A;  4J3M A;  4UVZ A;  4BUE A;  4BUI A;  4TK5 A;  3C4H A;  4UVW A;  4UVT A;  4PY4 A;  4HLK A;  3UA9 A;  4TJW A;  4IUE A;  4L70 A;  4BUU A;  2PAX A;  3L3M A;  4L34 A;  4UVP A;  4ZZX A;  3SE2 A;  4J22 A;  5EBT A;  1UK0 A;  4N3R A;  4J3L A;  4L2G A;  4PNL A;  5FPG A;  4UFY A;  4L0T A;  4J1Z A;  4L7R A;  5A00 A;  4L32 A;  4L2K A;  4KZU A;  4L31 A;  4PAX A;  3BLJ A;  4U6A A;  4AVW A;  4BU3 A;  5ADS A;  4F0E A;  3MHK A;  5AL1 A;  4UFU A;  4HKK A;  5C5Q A;  5FPF A;  4BS4 A;  4HL5 A;  4GV7 A;  4L0V A;  4HMH A;  3GN7 A;  5AL2 A;  4OPX C;  4W5S A;  1GS0 A;  4X52 A;  4DVI A;  4L7U A;  3CE0 A;  4TOS A;  4R6E A;  4BUF A;  4HKN A;  4L0B A;  4TVJ A;  3UH4 A;  5ADR A;  4L2F A;  4HLG A;  4HLM A;  4L7P A;  4AVU A;  4UHG A;  5LYH A;  4BJC A;  5AKU A;  3P0Q A;  4BU9 A;  3P0N A;  5DCZ A;  2PAW A;  4I9I A;  4TKI A;  3GJW A;  3KCZ A;  4HYF A;  4DQY C;  2RF5 A;  3HKV A;  4UI8 A;  4PJV A;  3GOY A;  4KRS A;  4TOR A;  3SMI A;  4BUV A;  5ADQ A;  4HHZ A;  3MHJ A;  3P0P A;  3C49 A;  4L09 A;  1EFY A;  4L7L A;  4K4E A;  4L7N A;  4W5I A;  5AKW A;  4UI3 A;  5ETY A;  4BJ9 A;  4BUS A;  4BUA A;  4UI4 A;  4PJT A;  4XHU A;  4OQA C;  4UND A;  4BUD A;  4BU7 A;  4N4V A;  5C5R A;  5ADT A;  4UVV A;  4LI8 A;  3KJD A;  4PNM A;  4PNQ A;  4TJU A;  3UDD A;  4HLF A;  4UVU A;  4BU5 A;  4LI6 A;  4UXB A;  3SMJ A;  1A26 A;  4LI7 A;  4L6Z A;  4PNR A;  4L10 A;  4F1L A;  4UUH A;  4L0S A;  4BUT A;  1PAX A;  4BUW A;  4TK0 A;  4MT9 A;  4BJB A;  4W6E A;  1WOK A;  4J21 A;  3U9Y A;  4UI6 A;  4F1Q A;  4MSK A;  4HKI A;  4TKF A;  4ZZZ A;  5AL3 A;  4OA7 A;  5ECE A;  4UVO A;  4ZZY A;  2PQF A;  4UVS A;  4UVY A;  4OQB C;  3U9H A;  4BU8 A;  4L0I A;  4KZQ A;  3GEY A;  4GV2 A;  4TKG A;  1UK1 A;  2RD6 A;  3KR8 A;  4HLH A;  4UX4 A;  3PAX A;  2RCW A; 
#chains in the Genus database with same CATH topology
 4N4T A;  4BFP A;  1KHB A;  4WIE A;  2RKD A;  1AQ2 A;  4L33 A;  2RK7 A;  3DTB A;  4UI5 A;  5C5P A;  4M7B A;  4PNS A;  5AL4 A;  4UVX A;  3UH2 A;  3W51 A;  4BU6 A;  3MOF A;  4RV6 A;  1NHX A;  4PNN A;  4PNT A;  4R5W A;  3FHB A;  4PML A;  5AL5 A;  4L7O A;  4WL8 A;  1XKV A;  4TJY A;  2GMV A;  4GV4 A;  4GV0 A;  4UVL A;  5LXP A;  4HHY A;  5AEH A;  5LX6 A;  1KHE A;  4L6S A;  3L3L A;  4K4F A;  1YGG A;  4UW1 A;  4BUY A;  4BUX A;  4MSG A;  4UI7 A;  4UVN A;  2X5Y A;  3KR7 A;  4KZL A;  4J3M A;  4UVZ A;  4BUE A;  4BUI A;  4TK5 A;  3C4H A;  4UVW A;  4GNM A;  4UVT A;  4PY4 A;  4HLK A;  4BU9 A;  3DT2 A;  3UA9 A;  3DT4 A;  4TJW A;  1J3B A;  4IUE A;  4L70 A;  2QF2 A;  4BUU A;  2PAX A;  3L3M A;  4L34 A;  4UVP A;  5FH1 A;  4ZZX A;  3SE2 A;  4J22 A;  5EBT A;  1UK0 A;  1KHF A;  4GNO A;  4J3L A;  4L2G A;  4N3R A;  4PNL A;  5FPG A;  4UFY A;  4L0T A;  4GMM A;  4J1Z A;  4L7R A;  5A00 A;  4L32 A;  4L2K A;  4KZU A;  4L31 A;  4PAX A;  3BLJ A;  4U6A A;  4AVW A;  4BU3 A;  2ZCI A;  4F0E A;  5ADS A;  3MHK A;  5AL1 A;  4UFU A;  4HKK A;  5C5Q A;  2OLQ A;  4GMU A;  5FPF A;  4BS4 A;  4HL5 A;  4GV7 A;  4L0V A;  4HMH A;  1YLH A;  3GN7 A;  5AL2 A;  2QEW A;  4RCG A;  4OX2 A;  4W5S A;  1GS0 A;  4X52 A;  5FH0 A;  4DVI A;  4OPX C;  4L7U A;  3CE0 A;  4TOS A;  4WPT A;  4R6E A;  4BUF A;  4YWD A;  2FAH A;  4HKN A;  4L0B A;  4TVJ A;  2QEY A;  3UH4 A;  5ADR A;  1OEN A;  2FAF A;  4L2F A;  2PC9 A;  4HLG A;  4HLM A;  4L7P A;  4AVU A;  4UHG A;  5LYH A;  4BJC A;  5AKU A;  3P0Q A;  4YW9 A;  3P0N A;  5DCZ A;  1OS1 A;  2PAW A;  5FH4 A;  2QZY A;  4I9I A;  1AYL A;  3GJW A;  3KCZ A;  1YVY A;  4HYF A;  4TKI A;  4BJ9 A;  2PXZ X;  2OLR A;  4DQY C;  2RF5 A;  3HKV A;  4UI8 A;  2RK8 A;  4PJV A;  4GNQ A;  3MOE A;  3GOY A;  4KRS A;  4TOR A;  3SMI A;  4BUV A;  5ADQ A;  4HHZ A;  4WOU A;  3MHJ A;  3P0P A;  2RKA A;  3C49 A;  1EFY A;  2QF1 A;  4K4E A;  4L09 A;  4L7L A;  4L7N A;  4UI3 A;  4W5I A;  4WPU A;  5AKW A;  5ETY A;  4BUS A;  4BUA A;  4UI4 A;  4PJT A;  4XHU A;  1M51 A;  4UND A;  4BUD A;  4OQA C;  4BU7 A;  4N4V A;  5C5R A;  5ADT A;  4UVV A;  4GNP A;  4GMW A;  1K3C A;  5FH5 A;  4LI8 A;  3KJD A;  4PNM A;  4PNQ A;  4TJU A;  3UDD A;  4HLF A;  4UVU A;  4BU5 A;  1KHG A;  3DT7 A;  4LI6 A;  4UXB A;  3SMJ A;  1A26 A;  4LI7 A;  4L6Z A;  4PNR A;  4L10 A;  4F1L A;  4UUH A;  4L0S A;  5FH3 A;  4YWB A;  4BUT A;  1PAX A;  4BUW A;  2RKE A;  4TK0 A;  4WIU A;  4MT9 A;  4BJB A;  4W6E A;  1II2 A;  1WOK A;  4J21 A;  4WPV A;  2PY7 X;  3U9Y A;  4UI6 A;  4F1Q A;  4MSK A;  4HKI A;  4TKF A;  4ZZZ A;  5AL3 A;  4OA7 A;  5ECE A;  4UVO A;  4YW8 A;  4ZZY A;  2PQF A;  4R43 A;  4UVS A;  4UVY A;  5I67 A;  4OQB C;  4GNL A;  3U9H A;  4BU8 A;  4L0I A;  4KZQ A;  1YTM A;  3GEY A;  4GV2 A;  4TKG A;  1UK1 A;  2RD6 A;  3KR8 A;  1K3D A;  3MOH A;  4HLH A;  5FH2 A;  4UX4 A;  4GMZ A;  3PAX A;  2RCW A; 
#chains in the Genus database with same CATH homology
 4N4T A;  4BFP A;  1KHB A;  4WIE A;  2RKD A;  1AQ2 A;  4L33 A;  2RK7 A;  3DTB A;  4UI5 A;  5C5P A;  4M7B A;  4PNS A;  5AL4 A;  4UVX A;  3UH2 A;  3W51 A;  4BU6 A;  3MOF A;  4RV6 A;  1NHX A;  4PNN A;  4PNT A;  4R5W A;  3FHB A;  4PML A;  5AL5 A;  4L7O A;  4WL8 A;  1XKV A;  4TJY A;  2GMV A;  4GV4 A;  4GV0 A;  4UVL A;  5LXP A;  4HHY A;  5AEH A;  5LX6 A;  1KHE A;  4L6S A;  3L3L A;  4K4F A;  1YGG A;  4UW1 A;  4BUY A;  4BUX A;  4MSG A;  4UI7 A;  4UVN A;  2X5Y A;  3KR7 A;  4KZL A;  4J3M A;  4UVZ A;  4BUE A;  4BUI A;  4TK5 A;  3C4H A;  4UVW A;  4GNM A;  4UVT A;  4PY4 A;  4HLK A;  4BU9 A;  3DT2 A;  3UA9 A;  3DT4 A;  4TJW A;  1J3B A;  4IUE A;  4L70 A;  2QF2 A;  4BUU A;  2PAX A;  3L3M A;  4L34 A;  4UVP A;  5FH1 A;  4ZZX A;  3SE2 A;  4J22 A;  5EBT A;  1UK0 A;  1KHF A;  4GNO A;  4J3L A;  4L2G A;  4N3R A;  4PNL A;  5FPG A;  4UFY A;  4L0T A;  4GMM A;  4J1Z A;  4L7R A;  5A00 A;  4L32 A;  4L2K A;  4KZU A;  4L31 A;  4PAX A;  3BLJ A;  4U6A A;  4AVW A;  4BU3 A;  2ZCI A;  4F0E A;  5ADS A;  3MHK A;  5AL1 A;  4UFU A;  4HKK A;  5C5Q A;  2OLQ A;  4GMU A;  5FPF A;  4BS4 A;  4HL5 A;  4GV7 A;  4L0V A;  4HMH A;  1YLH A;  3GN7 A;  5AL2 A;  2QEW A;  4RCG A;  4OX2 A;  4W5S A;  1GS0 A;  4X52 A;  5FH0 A;  4DVI A;  4OPX C;  4L7U A;  3CE0 A;  4TOS A;  4WPT A;  4R6E A;  4BUF A;  4YWD A;  2FAH A;  4HKN A;  4L0B A;  4TVJ A;  2QEY A;  3UH4 A;  5ADR A;  1OEN A;  2FAF A;  4L2F A;  2PC9 A;  4HLG A;  4HLM A;  4L7P A;  4AVU A;  4UHG A;  5LYH A;  4BJC A;  5AKU A;  3P0Q A;  4YW9 A;  3P0N A;  5DCZ A;  1OS1 A;  2PAW A;  5FH4 A;  2QZY A;  4I9I A;  1AYL A;  3GJW A;  3KCZ A;  1YVY A;  4HYF A;  4TKI A;  4BJ9 A;  2PXZ X;  2OLR A;  4DQY C;  2RF5 A;  3HKV A;  4UI8 A;  2RK8 A;  4PJV A;  4GNQ A;  3MOE A;  3GOY A;  4KRS A;  4TOR A;  3SMI A;  4BUV A;  5ADQ A;  4HHZ A;  4WOU A;  3MHJ A;  3P0P A;  2RKA A;  3C49 A;  1EFY A;  2QF1 A;  4K4E A;  4L09 A;  4L7L A;  4L7N A;  4UI3 A;  4W5I A;  4WPU A;  5AKW A;  5ETY A;  4BUS A;  4BUA A;  4UI4 A;  4PJT A;  4XHU A;  1M51 A;  4UND A;  4BUD A;  4OQA C;  4BU7 A;  4N4V A;  5C5R A;  5ADT A;  4UVV A;  4GNP A;  4GMW A;  1K3C A;  5FH5 A;  4LI8 A;  3KJD A;  4PNM A;  4PNQ A;  4TJU A;  3UDD A;  4HLF A;  4UVU A;  4BU5 A;  1KHG A;  3DT7 A;  4LI6 A;  4UXB A;  3SMJ A;  1A26 A;  4LI7 A;  4L6Z A;  4PNR A;  4L10 A;  4F1L A;  4UUH A;  4L0S A;  5FH3 A;  4YWB A;  4BUT A;  1PAX A;  4BUW A;  2RKE A;  4TK0 A;  4WIU A;  4MT9 A;  4BJB A;  4W6E A;  1II2 A;  1WOK A;  4J21 A;  4WPV A;  2PY7 X;  3U9Y A;  4UI6 A;  4F1Q A;  4MSK A;  4HKI A;  4TKF A;  4ZZZ A;  5AL3 A;  4OA7 A;  5ECE A;  4UVO A;  4YW8 A;  4ZZY A;  2PQF A;  4R43 A;  4UVS A;  4UVY A;  5I67 A;  4OQB C;  4GNL A;  3U9H A;  4BU8 A;  4L0I A;  4KZQ A;  1YTM A;  3GEY A;  4GV2 A;  4TKG A;  1UK1 A;  2RD6 A;  3KR8 A;  1K3D A;  3MOH A;  4HLH A;  5FH2 A;  4UX4 A;  4GMZ A;  3PAX A;  2RCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...