4BU3A

Crystal structure of human tankyrase 2 in complex with 2-phenyl-3,4- dihydroquinazolin-4-one
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu3A00
3KJDA 4KZLA 4L32A 4UVNA 4UVXA 5AL5A 4L31A 4UXBA 4PJVA 4UFYA 4GV4A 4PMLA 4BU6A 1WOKA 1EFYA 4L70A 4L0IA 4HKNA 4BFPA 4MSKA 3P0NA 4UI6A 4UI4A 2PQFA 3U9HA 4L34A 4W5SA 4W5IA 4BJBA 3C4HA 4J3MA 4L7UA 4UVZA 3UH2A 4BJCA 4R6EA 4RV6A 4UI5A 4HL5A 4BUIA 4PNMA 4F1LA 3GOYA 4BU7A 4GV7A 4OA7A 4J21A 5ECEA 5ADSA 4HHYA 4L2GA 4UVPA 4AVUA 5ADRA 1A26A 1PAXA 1UK0A 3CE0A 3SMIA 3P0QA 5LXPA 4BUAA 4UUHA 4TVJA 4J3LA 4N4VA 3UA9A 4BUWA 5AEHA 4BU5A 4ZZXA 3P0PA 4BUEA 4TOSA 4UVOA 4HLMA 4UNDA 4PNLA 4PY4A 2RD6A 5AKUA 4L0VA 4BUXA 4L0SA 4MT9A 4UVSA 2RCWA 5DCZA 4PNNA 3U9YA 4F1QA 4W6EA 3L3MA 5C5PA 4L0BA 3FHBA 4PNTA 4GV2A 3GJWA 4TK5A 4F0EA 4L2FA 4UFUA 4N4TA 4TKIA 4U6AA 5EBTA 4LI7A 4TKGA 5LX6A 4R5WA 4HHZA 5AL4A 4BJ9A 3UDDA 3GN7A 4HLHA 4IUEA 4UVLA 4XHUA 4TORA 4UI3A 4BS4A 4HLFA 2PAWA 4PNQA 4BUUA 5C5QA 4BUYA 4L09A 3HKVA 4LI6A 4HYFA 4BUFA 4OQBC 4BUDA 4UI8A 4BU9A 5AL1A 4L33A 4L7NA 4J1ZA 4UVTA 5AL3A 4BU8A 4UVUA 4K4EA 4TJYA 5FPGA 4DVIA 4HLKA 4DQYC 4MSGA 4PNRA 4TKFA 4PAXA 4ZZYA 3MHKA 4LI8A 5A00A 3PAXA 2RF5A 3UH4A 3GEYA 4M7BA 1UK1A 4L2KA 2X5YA 4GV0A 5FPFA 4UHGA 5AL2A 3SMJA 4TJUA 4HKKA 4KZUA 4L7LA 4K4FA 4L6SA 2PAXA 5C5RA 3W51A 4TJWA 4AVWA 4KZQA 4L10A 4ZZZA 4BUSA 4BU3A 4BUVA 4PNSA 4UI7A 4UVVA 5AKWA 3KR7A 3C49A 5ETYA 4UVWA 1GS0A 5ADTA 3SE2A 4HMHA 4L7RA 4X52A 4UW1A 4L0TA 4TK0A 4OQAC 4HLGA 3KCZA 4UVYA 4UX4A 3L3LA 4I9IA 5LYHA 4HKIA 4N3RA 4L6ZA 4L7PA 3BLJA 3KR8A 5ADQA 4PJTA 3MHJA 4BUTA 4J22A 4OPXC 4L7OA 4KRSA
chains in the Genus database with same CATH superfamily
1NHXA 3KJDA 4KZLA 4L32A 4UVNA 4UVXA 5AL5A 4GNMA 4L31A 4UXBA 4YWBA 2QF2A 4PJVA 1YVYA 4UFYA 4GV4A 4PMLA 4WPUA 4BU6A 1WOKA 1EFYA 2QEWA 4L0IA 4L70A 2PY7X 4HKNA 5FH2A 2RK8A 3DT7A 4BFPA 4MSKA 3P0NA 4UI6A 4UI4A 2PQFA 2QEYA 4L34A 4W5SA 3U9HA 4W5IA 4BJBA 3C4HA 4J3MA 4L7UA 4UVZA 3UH2A 4BJCA 1KHGA 4R6EA 4RV6A 4UI5A 4HL5A 5FH4A 4BUIA 4PNMA 4F1LA 3GOYA 4BU7A 2RKAA 2PC9A 4GV7A 4OA7A 4GMMA 4J21A 5ECEA 5FH0A 4HHYA 4L2GA 5ADSA 4UVPA 4AVUA 5ADRA 5FH3A 2OLRA 1A26A 1PAXA 3CE0A 1UK0A 5FH1A 3P0QA 3SMIA 2GMVA 4BUAA 4UUHA 4TVJA 5LXPA 4J3LA 4N4VA 3UA9A 4BUWA 4WOUA 5AEHA 4BU5A 3MOFA 4ZZXA 3P0PA 4BUEA 1K3DA 4TOSA 4GMUA 4GNOA 4UVOA 4HLMA 4UNDA 4PNLA 4PY4A 2RD6A 5AKUA 4L0VA 4BUXA 4GNLA 4L0SA 3DT4A 4MT9A 4UVSA 1KHEA 1M51A 2RCWA 1XKVA 4PNNA 5DCZA 4YWDA 3U9YA 4F1QA 4W6EA 1YLHA 3L3MA 5C5PA 2FAHA 4L0BA 3FHBA 4PNTA 4GV2A 4R43A 3GJWA 4TK5A 4F0EA 4L2FA 4UFUA 4N4TA 4TKIA 4U6AA 5EBTA 4LI7A 4TKGA 5LX6A 4R5WA 4HHZA 4GNQA 5AL4A 4BJ9A 5I67A 3UDDA 3GN7A 4HLHA 4IUEA 1YTMA 4UVLA 4TORA 4UI3A 4XHUA 4HLFA 4BS4A 2PAWA 4PNQA 4BUUA 3DT2A 5C5QA 4BUYA 4L09A 3HKVA 4LI6A 4HYFA 1AQ2A 4BUFA 4OQBC 4BUDA 3MOEA 1KHFA 4UI8A 4BU9A 4RCGA 5AL1A 4L33A 4L7NA 4J1ZA 4UVTA 4WL8A 5AL3A 4ZZZA 4BU8A 4UVUA 4K4EA 4TJYA 5FH5A 5FPGA 4DVIA 4HLKA 2ZCIA 4DQYC 4MSGA 4PNRA 4TKFA 1J3BA 4PAXA 3MHKA 4LI8A 1OS1A 4OX2A 3PAXA 2RK7A 2RF5A 5A00A 4ZZYA 1YGGA 3GEYA 4M7BA 3UH4A 1UK1A 4L2KA 1II2A 2X5YA 4GV0A 4WIEA 5FPFA 2RKEA 2FAFA 4UHGA 3MOHA 5AL2A 3SMJA 4TJUA 4HKKA 4YW8A 4KZUA 4L7LA 4YW9A 2QF1A 1KHBA 4K4FA 4L6SA 2PAXA 5C5RA 3W51A 4GMWA 4TJWA 4WIUA 4AVWA 4KZQA 1OENA 4L10A 4WPVA 4BU3A 4BUSA 4PNSA 4UI7A 2QZYA 4UVVA 5AKWA 3KR7A 4BUVA 3C49A 4GMZA 5ETYA 1K3CA 4UVWA 1GS0A 5ADTA 3SE2A 4HMHA 1AYLA 4L7RA 4X52A 4UW1A 4GNPA 2OLQA 4L0TA 4WPTA 4TK0A 4OQAC 4HLGA 3KCZA 4UVYA 2PXZX 4UX4A 3L3LA 4I9IA 3DTBA 5LYHA 4HKIA 2RKDA 4N3RA 4L6ZA 4L7PA 3BLJA 3KR8A 5ADQA 4PJTA 3MHJA 4BUTA 4J22A 4OPXC 4L7OA 4KRSA
chains in the Genus database with same CATH topology
1NHXA 3KJDA 4KZLA 4L32A 4UVNA 4UVXA 5AL5A 4GNMA 4L31A 4UXBA 4YWBA 2QF2A 4PJVA 1YVYA 4UFYA 4GV4A 4PMLA 4WPUA 4BU6A 1WOKA 1EFYA 2QEWA 4L0IA 4L70A 2PY7X 4HKNA 5FH2A 2RK8A 3DT7A 4BFPA 4MSKA 3P0NA 4UI6A 4UI4A 2PQFA 2QEYA 4L34A 4W5SA 3U9HA 4W5IA 4BJBA 3C4HA 4J3MA 4L7UA 4UVZA 3UH2A 4BJCA 1KHGA 4R6EA 4RV6A 4UI5A 4HL5A 5FH4A 4BUIA 4PNMA 4F1LA 3GOYA 4BU7A 2RKAA 2PC9A 4GV7A 4OA7A 4GMMA 4J21A 5ECEA 5FH0A 4HHYA 4L2GA 5ADSA 4UVPA 4AVUA 5ADRA 5FH3A 2OLRA 1A26A 1PAXA 3CE0A 1UK0A 5FH1A 3P0QA 3SMIA 2GMVA 4BUAA 4UUHA 4TVJA 5LXPA 4J3LA 4N4VA 3UA9A 4BUWA 4WOUA 5AEHA 4BU5A 3MOFA 4ZZXA 3P0PA 4BUEA 1K3DA 4TOSA 4GMUA 4GNOA 4UVOA 4HLMA 4UNDA 4PNLA 4PY4A 2RD6A 5AKUA 4L0VA 4BUXA 4GNLA 4L0SA 3DT4A 4MT9A 4UVSA 1KHEA 1M51A 2RCWA 1XKVA 4PNNA 5DCZA 4YWDA 3U9YA 4F1QA 4W6EA 1YLHA 3L3MA 5C5PA 2FAHA 4L0BA 3FHBA 4PNTA 4GV2A 4R43A 3GJWA 4TK5A 4F0EA 4L2FA 4UFUA 4N4TA 4TKIA 4U6AA 5EBTA 4LI7A 4TKGA 5LX6A 4R5WA 4HHZA 4GNQA 5AL4A 4BJ9A 5I67A 3UDDA 3GN7A 4HLHA 4IUEA 1YTMA 4UVLA 4TORA 4UI3A 4XHUA 4HLFA 4BS4A 2PAWA 4PNQA 4BUUA 3DT2A 5C5QA 4BUYA 4L09A 3HKVA 4LI6A 4HYFA 1AQ2A 4BUFA 4OQBC 4BUDA 3MOEA 1KHFA 4UI8A 4BU9A 4RCGA 5AL1A 4L33A 4L7NA 4J1ZA 4UVTA 4WL8A 5AL3A 4ZZZA 4BU8A 4UVUA 4K4EA 4TJYA 5FH5A 5FPGA 4DVIA 4HLKA 2ZCIA 4DQYC 4MSGA 4PNRA 4TKFA 1J3BA 4PAXA 3MHKA 4LI8A 1OS1A 4OX2A 3PAXA 2RK7A 2RF5A 5A00A 4ZZYA 1YGGA 3GEYA 4M7BA 3UH4A 1UK1A 4L2KA 1II2A 2X5YA 4GV0A 4WIEA 5FPFA 2RKEA 2FAFA 4UHGA 3MOHA 5AL2A 3SMJA 4TJUA 4HKKA 4YW8A 4KZUA 4L7LA 4YW9A 2QF1A 1KHBA 4K4FA 4L6SA 2PAXA 5C5RA 3W51A 4GMWA 4TJWA 4WIUA 4AVWA 4KZQA 1OENA 4L10A 4WPVA 4BU3A 4BUSA 4PNSA 4UI7A 2QZYA 4UVVA 5AKWA 3KR7A 4BUVA 3C49A 4GMZA 5ETYA 1K3CA 4UVWA 1GS0A 5ADTA 3SE2A 4HMHA 1AYLA 4L7RA 4X52A 4UW1A 4GNPA 2OLQA 4L0TA 4WPTA 4TK0A 4OQAC 4HLGA 3KCZA 4UVYA 2PXZX 4UX4A 3L3LA 4I9IA 3DTBA 5LYHA 4HKIA 2RKDA 4N3RA 4L6ZA 4L7PA 3BLJA 3KR8A 5ADQA 4PJTA 3MHJA 4BUTA 4J22A 4OPXC 4L7OA 4KRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJD A;  4KZL A;  4L32 A;  4UVN A;  4UVX A;  5AL5 A;  4L31 A;  4UXB A;  4PJV A;  4UFY A;  4GV4 A;  4PML A;  4BU6 A;  1WOK A;  1EFY A;  4L70 A;  4L0I A;  4HKN A;  4BFP A;  4MSK A;  3P0N A;  4UI6 A;  4UI4 A;  2PQF A;  3U9H A;  4L34 A;  4W5S A;  4W5I A;  4BJB A;  3C4H A;  4J3M A;  4L7U A;  4UVZ A;  3UH2 A;  4BJC A;  4R6E A;  4RV6 A;  4UI5 A;  4HL5 A;  4BUI A;  4PNM A;  4F1L A;  3GOY A;  4BU7 A;  4GV7 A;  4OA7 A;  4J21 A;  5ECE A;  5ADS A;  4HHY A;  4L2G A;  4UVP A;  4AVU A;  5ADR A;  1A26 A;  1PAX A;  1UK0 A;  3CE0 A;  3SMI A;  3P0Q A;  5LXP A;  4BUA A;  4UUH A;  4TVJ A;  4J3L A;  4N4V A;  3UA9 A;  4BUW A;  5AEH A;  4BU5 A;  4ZZX A;  3P0P A;  4BUE A;  4TOS A;  4UVO A;  4HLM A;  4UND A;  4PNL A;  4PY4 A;  2RD6 A;  5AKU A;  4L0V A;  4BUX A;  4L0S A;  4MT9 A;  4UVS A;  2RCW A;  5DCZ A;  4PNN A;  3U9Y A;  4F1Q A;  4W6E A;  3L3M A;  5C5P A;  4L0B A;  3FHB A;  4PNT A;  4GV2 A;  3GJW A;  4TK5 A;  4F0E A;  4L2F A;  4UFU A;  4N4T A;  4TKI A;  4U6A A;  5EBT A;  4LI7 A;  4TKG A;  5LX6 A;  4R5W A;  4HHZ A;  5AL4 A;  4BJ9 A;  3UDD A;  3GN7 A;  4HLH A;  4IUE A;  4UVL A;  4XHU A;  4TOR A;  4UI3 A;  4BS4 A;  4HLF A;  2PAW A;  4PNQ A;  4BUU A;  5C5Q A;  4BUY A;  4L09 A;  3HKV A;  4LI6 A;  4HYF A;  4BUF A;  4OQB C;  4BUD A;  4UI8 A;  4BU9 A;  5AL1 A;  4L33 A;  4L7N A;  4J1Z A;  4UVT A;  5AL3 A;  4BU8 A;  4UVU A;  4K4E A;  4TJY A;  5FPG A;  4DVI A;  4HLK A;  4DQY C;  4MSG A;  4PNR A;  4TKF A;  4PAX A;  4ZZY A;  3MHK A;  4LI8 A;  5A00 A;  3PAX A;  2RF5 A;  3UH4 A;  3GEY A;  4M7B A;  1UK1 A;  4L2K A;  2X5Y A;  4GV0 A;  5FPF A;  4UHG A;  5AL2 A;  3SMJ A;  4TJU A;  4HKK A;  4KZU A;  4L7L A;  4K4F A;  4L6S A;  2PAX A;  5C5R A;  3W51 A;  4TJW A;  4AVW A;  4KZQ A;  4L10 A;  4ZZZ A;  4BUS A;  4BU3 A;  4BUV A;  4PNS A;  4UI7 A;  4UVV A;  5AKW A;  3KR7 A;  3C49 A;  5ETY A;  4UVW A;  1GS0 A;  5ADT A;  3SE2 A;  4HMH A;  4L7R A;  4X52 A;  4UW1 A;  4L0T A;  4TK0 A;  4OQA C;  4HLG A;  3KCZ A;  4UVY A;  4UX4 A;  3L3L A;  4I9I A;  5LYH A;  4HKI A;  4N3R A;  4L6Z A;  4L7P A;  3BLJ A;  3KR8 A;  5ADQ A;  4PJT A;  3MHJ A;  4BUT A;  4J22 A;  4OPX C;  4L7O A;  4KRS A; 
#chains in the Genus database with same CATH topology
 1NHX A;  3KJD A;  4KZL A;  4L32 A;  4UVN A;  4UVX A;  5AL5 A;  4GNM A;  4L31 A;  4UXB A;  4YWB A;  2QF2 A;  4PJV A;  1YVY A;  4UFY A;  4GV4 A;  4PML A;  4WPU A;  4BU6 A;  1WOK A;  1EFY A;  2QEW A;  4L0I A;  4L70 A;  2PY7 X;  4HKN A;  5FH2 A;  2RK8 A;  3DT7 A;  4BFP A;  4MSK A;  3P0N A;  4UI6 A;  4UI4 A;  2PQF A;  2QEY A;  4L34 A;  4W5S A;  3U9H A;  4W5I A;  4BJB A;  3C4H A;  4J3M A;  4L7U A;  4UVZ A;  3UH2 A;  4BJC A;  1KHG A;  4R6E A;  4RV6 A;  4UI5 A;  4HL5 A;  5FH4 A;  4BUI A;  4PNM A;  4F1L A;  3GOY A;  4BU7 A;  2RKA A;  2PC9 A;  4GV7 A;  4OA7 A;  4GMM A;  4J21 A;  5ECE A;  5FH0 A;  4HHY A;  4L2G A;  5ADS A;  4UVP A;  4AVU A;  5ADR A;  5FH3 A;  2OLR A;  1A26 A;  1PAX A;  3CE0 A;  1UK0 A;  5FH1 A;  3P0Q A;  3SMI A;  2GMV A;  4BUA A;  4UUH A;  4TVJ A;  5LXP A;  4J3L A;  4N4V A;  3UA9 A;  4BUW A;  4WOU A;  5AEH A;  4BU5 A;  3MOF A;  4ZZX A;  3P0P A;  4BUE A;  1K3D A;  4TOS A;  4GMU A;  4GNO A;  4UVO A;  4HLM A;  4UND A;  4PNL A;  4PY4 A;  2RD6 A;  5AKU A;  4L0V A;  4BUX A;  4GNL A;  4L0S A;  3DT4 A;  4MT9 A;  4UVS A;  1KHE A;  1M51 A;  2RCW A;  1XKV A;  4PNN A;  5DCZ A;  4YWD A;  3U9Y A;  4F1Q A;  4W6E A;  1YLH A;  3L3M A;  5C5P A;  2FAH A;  4L0B A;  3FHB A;  4PNT A;  4GV2 A;  4R43 A;  3GJW A;  4TK5 A;  4F0E A;  4L2F A;  4UFU A;  4N4T A;  4TKI A;  4U6A A;  5EBT A;  4LI7 A;  4TKG A;  5LX6 A;  4R5W A;  4HHZ A;  4GNQ A;  5AL4 A;  4BJ9 A;  5I67 A;  3UDD A;  3GN7 A;  4HLH A;  4IUE A;  1YTM A;  4UVL A;  4TOR A;  4UI3 A;  4XHU A;  4HLF A;  4BS4 A;  2PAW A;  4PNQ A;  4BUU A;  3DT2 A;  5C5Q A;  4BUY A;  4L09 A;  3HKV A;  4LI6 A;  4HYF A;  1AQ2 A;  4BUF A;  4OQB C;  4BUD A;  3MOE A;  1KHF A;  4UI8 A;  4BU9 A;  4RCG A;  5AL1 A;  4L33 A;  4L7N A;  4J1Z A;  4UVT A;  4WL8 A;  5AL3 A;  4ZZZ A;  4BU8 A;  4UVU A;  4K4E A;  4TJY A;  5FH5 A;  5FPG A;  4DVI A;  4HLK A;  2ZCI A;  4DQY C;  4MSG A;  4PNR A;  4TKF A;  1J3B A;  4PAX A;  3MHK A;  4LI8 A;  1OS1 A;  4OX2 A;  3PAX A;  2RK7 A;  2RF5 A;  5A00 A;  4ZZY A;  1YGG A;  3GEY A;  4M7B A;  3UH4 A;  1UK1 A;  4L2K A;  1II2 A;  2X5Y A;  4GV0 A;  4WIE A;  5FPF A;  2RKE A;  2FAF A;  4UHG A;  3MOH A;  5AL2 A;  3SMJ A;  4TJU A;  4HKK A;  4YW8 A;  4KZU A;  4L7L A;  4YW9 A;  2QF1 A;  1KHB A;  4K4F A;  4L6S A;  2PAX A;  5C5R A;  3W51 A;  4GMW A;  4TJW A;  4WIU A;  4AVW A;  4KZQ A;  1OEN A;  4L10 A;  4WPV A;  4BU3 A;  4BUS A;  4PNS A;  4UI7 A;  2QZY A;  4UVV A;  5AKW A;  3KR7 A;  4BUV A;  3C49 A;  4GMZ A;  5ETY A;  1K3C A;  4UVW A;  1GS0 A;  5ADT A;  3SE2 A;  4HMH A;  1AYL A;  4L7R A;  4X52 A;  4UW1 A;  4GNP A;  2OLQ A;  4L0T A;  4WPT A;  4TK0 A;  4OQA C;  4HLG A;  3KCZ A;  4UVY A;  2PXZ X;  4UX4 A;  3L3L A;  4I9I A;  3DTB A;  5LYH A;  4HKI A;  2RKD A;  4N3R A;  4L6Z A;  4L7P A;  3BLJ A;  3KR8 A;  5ADQ A;  4PJT A;  3MHJ A;  4BUT A;  4J22 A;  4OPX C;  4L7O A;  4KRS A; 
#chains in the Genus database with same CATH homology
 1NHX A;  3KJD A;  4KZL A;  4L32 A;  4UVN A;  4UVX A;  5AL5 A;  4GNM A;  4L31 A;  4UXB A;  4YWB A;  2QF2 A;  4PJV A;  1YVY A;  4UFY A;  4GV4 A;  4PML A;  4WPU A;  4BU6 A;  1WOK A;  1EFY A;  2QEW A;  4L0I A;  4L70 A;  2PY7 X;  4HKN A;  5FH2 A;  2RK8 A;  3DT7 A;  4BFP A;  4MSK A;  3P0N A;  4UI6 A;  4UI4 A;  2PQF A;  2QEY A;  4L34 A;  4W5S A;  3U9H A;  4W5I A;  4BJB A;  3C4H A;  4J3M A;  4L7U A;  4UVZ A;  3UH2 A;  4BJC A;  1KHG A;  4R6E A;  4RV6 A;  4UI5 A;  4HL5 A;  5FH4 A;  4BUI A;  4PNM A;  4F1L A;  3GOY A;  4BU7 A;  2RKA A;  2PC9 A;  4GV7 A;  4OA7 A;  4GMM A;  4J21 A;  5ECE A;  5FH0 A;  4HHY A;  4L2G A;  5ADS A;  4UVP A;  4AVU A;  5ADR A;  5FH3 A;  2OLR A;  1A26 A;  1PAX A;  3CE0 A;  1UK0 A;  5FH1 A;  3P0Q A;  3SMI A;  2GMV A;  4BUA A;  4UUH A;  4TVJ A;  5LXP A;  4J3L A;  4N4V A;  3UA9 A;  4BUW A;  4WOU A;  5AEH A;  4BU5 A;  3MOF A;  4ZZX A;  3P0P A;  4BUE A;  1K3D A;  4TOS A;  4GMU A;  4GNO A;  4UVO A;  4HLM A;  4UND A;  4PNL A;  4PY4 A;  2RD6 A;  5AKU A;  4L0V A;  4BUX A;  4GNL A;  4L0S A;  3DT4 A;  4MT9 A;  4UVS A;  1KHE A;  1M51 A;  2RCW A;  1XKV A;  4PNN A;  5DCZ A;  4YWD A;  3U9Y A;  4F1Q A;  4W6E A;  1YLH A;  3L3M A;  5C5P A;  2FAH A;  4L0B A;  3FHB A;  4PNT A;  4GV2 A;  4R43 A;  3GJW A;  4TK5 A;  4F0E A;  4L2F A;  4UFU A;  4N4T A;  4TKI A;  4U6A A;  5EBT A;  4LI7 A;  4TKG A;  5LX6 A;  4R5W A;  4HHZ A;  4GNQ A;  5AL4 A;  4BJ9 A;  5I67 A;  3UDD A;  3GN7 A;  4HLH A;  4IUE A;  1YTM A;  4UVL A;  4TOR A;  4UI3 A;  4XHU A;  4HLF A;  4BS4 A;  2PAW A;  4PNQ A;  4BUU A;  3DT2 A;  5C5Q A;  4BUY A;  4L09 A;  3HKV A;  4LI6 A;  4HYF A;  1AQ2 A;  4BUF A;  4OQB C;  4BUD A;  3MOE A;  1KHF A;  4UI8 A;  4BU9 A;  4RCG A;  5AL1 A;  4L33 A;  4L7N A;  4J1Z A;  4UVT A;  4WL8 A;  5AL3 A;  4ZZZ A;  4BU8 A;  4UVU A;  4K4E A;  4TJY A;  5FH5 A;  5FPG A;  4DVI A;  4HLK A;  2ZCI A;  4DQY C;  4MSG A;  4PNR A;  4TKF A;  1J3B A;  4PAX A;  3MHK A;  4LI8 A;  1OS1 A;  4OX2 A;  3PAX A;  2RK7 A;  2RF5 A;  5A00 A;  4ZZY A;  1YGG A;  3GEY A;  4M7B A;  3UH4 A;  1UK1 A;  4L2K A;  1II2 A;  2X5Y A;  4GV0 A;  4WIE A;  5FPF A;  2RKE A;  2FAF A;  4UHG A;  3MOH A;  5AL2 A;  3SMJ A;  4TJU A;  4HKK A;  4YW8 A;  4KZU A;  4L7L A;  4YW9 A;  2QF1 A;  1KHB A;  4K4F A;  4L6S A;  2PAX A;  5C5R A;  3W51 A;  4GMW A;  4TJW A;  4WIU A;  4AVW A;  4KZQ A;  1OEN A;  4L10 A;  4WPV A;  4BU3 A;  4BUS A;  4PNS A;  4UI7 A;  2QZY A;  4UVV A;  5AKW A;  3KR7 A;  4BUV A;  3C49 A;  4GMZ A;  5ETY A;  1K3C A;  4UVW A;  1GS0 A;  5ADT A;  3SE2 A;  4HMH A;  1AYL A;  4L7R A;  4X52 A;  4UW1 A;  4GNP A;  2OLQ A;  4L0T A;  4WPT A;  4TK0 A;  4OQA C;  4HLG A;  3KCZ A;  4UVY A;  2PXZ X;  4UX4 A;  3L3L A;  4I9I A;  3DTB A;  5LYH A;  4HKI A;  2RKD A;  4N3R A;  4L6Z A;  4L7P A;  3BLJ A;  3KR8 A;  5ADQ A;  4PJT A;  3MHJ A;  4BUT A;  4J22 A;  4OPX C;  4L7O A;  4KRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...