4BU3A

Crystal structure of human tankyrase 2 in complex with 2-phenyl-3,4- dihydroquinazolin-4-one
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu3A00
3U9HA 4PMLA 4BUVA 3HKVA 3UH2A 4OQBC 2PQFA 3P0QA 4UI3A 1UK1A 4W5SA 4K4FA 4BUUA 4J21A 4AVWA 3GN7A 4L34A 4L32A 4UI7A 1GS0A 1WOKA 4N4VA 4L0SA 4BU3A 4UVXA 3UDDA 4BUYA 4MSKA 5ECEA 4UVNA 4BJ9A 5ADSA 2PAWA 4HKKA 4L0TA 4BU7A 4BUWA 4UX4A 4UXBA 3MHJA 4J3MA 4X52A 4BU9A 4F1QA 4PJVA 4KZQA 4L2GA 4PNMA 4PNNA 5C5QA 1PAXA 4GV7A 4TKGA 4TK0A 3C4HA 4UVWA 4DQYC 4L0IA 4PY4A 4UNDA 4UFUA 4HMHA 3W51A 4TJUA 4PNSA 4TVJA 4HYFA 4UVTA 4J1ZA 4L6ZA 3P0NA 3CE0A 3U9YA 3KR7A 5FPGA 4PNLA 4R5WA 4R6EA 4BUFA 1UK0A 4KZUA 4LI8A 4U6AA 4HLHA 3GEYA 3P0PA 4HHZA 4GV0A 4L70A 3KJDA 4L0BA 4W6EA 3GOYA 4PJTA 4BU8A 3SMJA 4RV6A 4BS4A 4L2KA 4TJYA 4UVPA 4J3LA 4J22A 4MT9A 4L10A 4AVUA 4BJCA 5ADTA 3KCZA 4HL5A 4OQAC 4HKNA 5AKWA 3L3MA 4IUEA 4BJBA 4BFPA 4L7RA 4PNTA 4BU5A 4L31A 4UVSA 4ZZZA 4GV2A 4UVZA 4BUXA 4K4EA 4BUTA 3BLJA 3GJWA 4L09A 5AEHA 4DVIA 4UI4A 2RF5A 4OA7A 1EFYA 3PAXA 4UVUA 5ETYA 3SMIA 4BUDA 4N3RA 5AL1A 2PAXA 4L33A 1A26A 4L2FA 4L0VA 4PNRA 5EBTA 5AL3A 5LYHA 4UVOA 2RD6A 3KR8A 4BUEA 3C49A 5LX6A 3UH4A 5A00A 3FHBA 4UVVA 4HLKA 4I9IA 2X5YA 4UVYA 4ZZXA 4L7OA 4L7UA 4TKIA 4BUIA 4UVLA 4KRSA 4UI5A 4ZZYA 4MSGA 4UI8A 4M7BA 4PNQA 4HLMA 4TKFA 4TOSA 4F0EA 4UFYA 5ADQA 4LI6A 4HKIA 5C5PA 4LI7A 5AKUA 5C5RA 5AL5A 4N4TA 4L6SA 4GV4A 5ADRA 4HLGA 4UI6A 4BU6A 4BUAA 4UHGA 4HHYA 5DCZA 5AL2A 4BUSA 5AL4A 4L7NA 4F1LA 4PAXA 2RCWA 3MHKA 3UA9A 5LXPA 4OPXC 4XHUA 4UW1A 5FPFA 4HLFA 3L3LA 4TORA 4W5IA 4L7PA 3SE2A 4L7LA 4UUHA 4TJWA 4KZLA 4TK5A
chains in the Genus database with same CATH superfamily
3U9HA 4PMLA 4WPUA 4BUVA 3HKVA 3UH2A 4OQBC 2PQFA 3P0QA 1M51A 4UI3A 4GMMA 1UK1A 4W5SA 2OLRA 4K4FA 1YLHA 2PXZX 4J21A 4AVWA 3GN7A 4BUUA 4L34A 4L32A 2PY7X 4UI7A 4GNLA 1GS0A 1WOKA 4N4VA 4L0SA 4BU3A 1J3BA 4UVXA 3UDDA 4BUYA 4MSKA 5ECEA 4UVNA 4BJ9A 5ADSA 2PAWA 4HKKA 4L0TA 4BU7A 2RK8A 4BUWA 4UX4A 4GMZA 3MHJA 4J3MA 4UXBA 4X52A 4BU9A 4PJVA 4F1QA 4KZQA 4L2GA 4PNMA 4PNNA 5C5QA 1PAXA 4GV7A 4TKGA 4TK0A 3C4HA 4UVWA 4DQYC 4L0IA 4PY4A 4UNDA 4UFUA 4HMHA 3W51A 4TJUA 4PNSA 4WPTA 4TVJA 4HYFA 4UVTA 4J1ZA 4L6ZA 3P0NA 3CE0A 3U9YA 1KHBA 3KR7A 5FPGA 4PNLA 4R5WA 4R6EA 1XKVA 1UK0A 4BUFA 4KZUA 4LI8A 4RCGA 3DTBA 4U6AA 4HLHA 3GEYA 3P0PA 3DT4A 5FH0A 4HHZA 5FH2A 4GV0A 4L70A 5ADQA 2RKDA 2RK7A 3KJDA 4L0BA 4W6EA 3GOYA 4PJTA 1K3CA 4YW9A 3SMJA 4BU8A 4RV6A 4GNQA 4BS4A 5FH5A 3MOFA 4L2KA 4TJYA 2RKEA 3MOHA 4UVPA 4WOUA 4GNPA 4J3LA 4J22A 4MT9A 4L10A 1OENA 4AVUA 4BJCA 5ADTA 3KCZA 4HL5A 4OQAC 4HKNA 5AKWA 3L3MA 1KHFA 3DT7A 4IUEA 4BJBA 4BFPA 4L7RA 4PNTA 4BU5A 2OLQA 3MOEA 4R43A 4L31A 1OS1A 4UVSA 4ZZZA 4GV2A 4UVZA 4BUXA 4K4EA 2QEWA 4BUTA 3BLJA 3GJWA 4GMWA 4L09A 5AEHA 4DVIA 4UI4A 2RF5A 4OA7A 1EFYA 3PAXA 4UVUA 5ETYA 4YW8A 5FH1A 3SMIA 4BUDA 4N3RA 5AL1A 2PAXA 5I67A 2FAHA 4L33A 1A26A 4L2FA 4L0VA 4PNRA 5EBTA 5AL3A 5LYHA 4UVOA 2GMVA 2RD6A 3KR8A 3C49A 4BUEA 3DT2A 5A00A 4YWBA 3UH4A 5LX6A 4WPVA 1KHEA 3FHBA 4UVVA 4HLKA 1YVYA 4I9IA 2X5YA 4UVYA 4ZZXA 4L7OA 5FH3A 4L7UA 4TKIA 4BUIA 4UVLA 2RKAA 4KRSA 4UI5A 4ZZYA 4MSGA 4UI8A 4M7BA 2QF1A 1II2A 4HLMA 4PNQA 4TKFA 4TOSA 4UFYA 4LI6A 4F0EA 2FAFA 4HKIA 5C5PA 1NHXA 4GNMA 4LI7A 5AKUA 1YGGA 5AL5A 5C5RA 1K3DA 4N4TA 4L6SA 4WIUA 1AQ2A 4GV4A 5ADRA 4HLGA 4UI6A 4BU6A 4BUAA 4UHGA 1KHGA 4HHYA 4GNOA 5DCZA 4WL8A 5AL2A 2QEYA 4BUSA 5AL4A 4L7NA 4WIEA 4F1LA 2QZYA 2PC9A 4PAXA 3MHKA 2RCWA 3UA9A 5LXPA 4OPXC 1YTMA 2ZCIA 4XHUA 4GMUA 4UW1A 5FPFA 2QF2A 4HLFA 1AYLA 3L3LA 4TORA 4W5IA 4L7PA 3SE2A 4OX2A 4L7LA 4UUHA 4TJWA 5FH4A 4KZLA 4TK5A 4YWDA
chains in the Genus database with same CATH topology
3U9HA 4PMLA 4WPUA 4BUVA 3HKVA 3UH2A 4OQBC 2PQFA 3P0QA 1M51A 4UI3A 4GMMA 1UK1A 4W5SA 2OLRA 4K4FA 1YLHA 2PXZX 4J21A 4AVWA 3GN7A 4BUUA 4L34A 4L32A 2PY7X 4UI7A 4GNLA 1GS0A 1WOKA 4N4VA 4L0SA 4BU3A 1J3BA 4UVXA 3UDDA 4BUYA 4MSKA 5ECEA 4UVNA 4BJ9A 5ADSA 2PAWA 4HKKA 4L0TA 4BU7A 2RK8A 4BUWA 4UX4A 4GMZA 3MHJA 4J3MA 4UXBA 4X52A 4BU9A 4PJVA 4F1QA 4KZQA 4L2GA 4PNMA 4PNNA 5C5QA 1PAXA 4GV7A 4TKGA 4TK0A 3C4HA 4UVWA 4DQYC 4L0IA 4PY4A 4UNDA 4UFUA 4HMHA 3W51A 4TJUA 4PNSA 4WPTA 4TVJA 4HYFA 4UVTA 4J1ZA 4L6ZA 3P0NA 3CE0A 3U9YA 1KHBA 3KR7A 5FPGA 4PNLA 4R5WA 4R6EA 1XKVA 1UK0A 4BUFA 4KZUA 4LI8A 4RCGA 3DTBA 4U6AA 4HLHA 3GEYA 3P0PA 3DT4A 5FH0A 4HHZA 5FH2A 4GV0A 4L70A 5ADQA 2RKDA 2RK7A 3KJDA 4L0BA 4W6EA 3GOYA 4PJTA 1K3CA 4YW9A 3SMJA 4BU8A 4RV6A 4GNQA 4BS4A 5FH5A 3MOFA 4L2KA 4TJYA 2RKEA 3MOHA 4UVPA 4WOUA 4GNPA 4J3LA 4J22A 4MT9A 4L10A 1OENA 4AVUA 4BJCA 5ADTA 3KCZA 4HL5A 4OQAC 4HKNA 5AKWA 3L3MA 1KHFA 3DT7A 4IUEA 4BJBA 4BFPA 4L7RA 4PNTA 4BU5A 2OLQA 3MOEA 4R43A 4L31A 1OS1A 4UVSA 4ZZZA 4GV2A 4UVZA 4BUXA 4K4EA 2QEWA 4BUTA 3BLJA 3GJWA 4GMWA 4L09A 5AEHA 4DVIA 4UI4A 2RF5A 4OA7A 1EFYA 3PAXA 4UVUA 5ETYA 4YW8A 5FH1A 3SMIA 4BUDA 4N3RA 5AL1A 2PAXA 5I67A 2FAHA 4L33A 1A26A 4L2FA 4L0VA 4PNRA 5EBTA 5AL3A 5LYHA 4UVOA 2GMVA 2RD6A 3KR8A 3C49A 4BUEA 3DT2A 5A00A 4YWBA 3UH4A 5LX6A 4WPVA 1KHEA 3FHBA 4UVVA 4HLKA 1YVYA 4I9IA 2X5YA 4UVYA 4ZZXA 4L7OA 5FH3A 4L7UA 4TKIA 4BUIA 4UVLA 2RKAA 4KRSA 4UI5A 4ZZYA 4MSGA 4UI8A 4M7BA 2QF1A 1II2A 4HLMA 4PNQA 4TKFA 4TOSA 4UFYA 4LI6A 4F0EA 2FAFA 4HKIA 5C5PA 1NHXA 4GNMA 4LI7A 5AKUA 1YGGA 5AL5A 5C5RA 1K3DA 4N4TA 4L6SA 4WIUA 1AQ2A 4GV4A 5ADRA 4HLGA 4UI6A 4BU6A 4BUAA 4UHGA 1KHGA 4HHYA 4GNOA 5DCZA 4WL8A 5AL2A 2QEYA 4BUSA 5AL4A 4L7NA 4WIEA 4F1LA 2QZYA 2PC9A 4PAXA 3MHKA 2RCWA 3UA9A 5LXPA 4OPXC 1YTMA 2ZCIA 4XHUA 4GMUA 4UW1A 5FPFA 2QF2A 4HLFA 1AYLA 3L3LA 4TORA 4W5IA 4L7PA 3SE2A 4OX2A 4L7LA 4UUHA 4TJWA 5FH4A 4KZLA 4TK5A 4YWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9H A;  4PML A;  4BUV A;  3HKV A;  3UH2 A;  4OQB C;  2PQF A;  3P0Q A;  4UI3 A;  1UK1 A;  4W5S A;  4K4F A;  4BUU A;  4J21 A;  4AVW A;  3GN7 A;  4L34 A;  4L32 A;  4UI7 A;  1GS0 A;  1WOK A;  4N4V A;  4L0S A;  4BU3 A;  4UVX A;  3UDD A;  4BUY A;  4MSK A;  5ECE A;  4UVN A;  4BJ9 A;  5ADS A;  2PAW A;  4HKK A;  4L0T A;  4BU7 A;  4BUW A;  4UX4 A;  4UXB A;  3MHJ A;  4J3M A;  4X52 A;  4BU9 A;  4F1Q A;  4PJV A;  4KZQ A;  4L2G A;  4PNM A;  4PNN A;  5C5Q A;  1PAX A;  4GV7 A;  4TKG A;  4TK0 A;  3C4H A;  4UVW A;  4DQY C;  4L0I A;  4PY4 A;  4UND A;  4UFU A;  4HMH A;  3W51 A;  4TJU A;  4PNS A;  4TVJ A;  4HYF A;  4UVT A;  4J1Z A;  4L6Z A;  3P0N A;  3CE0 A;  3U9Y A;  3KR7 A;  5FPG A;  4PNL A;  4R5W A;  4R6E A;  4BUF A;  1UK0 A;  4KZU A;  4LI8 A;  4U6A A;  4HLH A;  3GEY A;  3P0P A;  4HHZ A;  4GV0 A;  4L70 A;  3KJD A;  4L0B A;  4W6E A;  3GOY A;  4PJT A;  4BU8 A;  3SMJ A;  4RV6 A;  4BS4 A;  4L2K A;  4TJY A;  4UVP A;  4J3L A;  4J22 A;  4MT9 A;  4L10 A;  4AVU A;  4BJC A;  5ADT A;  3KCZ A;  4HL5 A;  4OQA C;  4HKN A;  5AKW A;  3L3M A;  4IUE A;  4BJB A;  4BFP A;  4L7R A;  4PNT A;  4BU5 A;  4L31 A;  4UVS A;  4ZZZ A;  4GV2 A;  4UVZ A;  4BUX A;  4K4E A;  4BUT A;  3BLJ A;  3GJW A;  4L09 A;  5AEH A;  4DVI A;  4UI4 A;  2RF5 A;  4OA7 A;  1EFY A;  3PAX A;  4UVU A;  5ETY A;  3SMI A;  4BUD A;  4N3R A;  5AL1 A;  2PAX A;  4L33 A;  1A26 A;  4L2F A;  4L0V A;  4PNR A;  5EBT A;  5AL3 A;  5LYH A;  4UVO A;  2RD6 A;  3KR8 A;  4BUE A;  3C49 A;  5LX6 A;  3UH4 A;  5A00 A;  3FHB A;  4UVV A;  4HLK A;  4I9I A;  2X5Y A;  4UVY A;  4ZZX A;  4L7O A;  4L7U A;  4TKI A;  4BUI A;  4UVL A;  4KRS A;  4UI5 A;  4ZZY A;  4MSG A;  4UI8 A;  4M7B A;  4PNQ A;  4HLM A;  4TKF A;  4TOS A;  4F0E A;  4UFY A;  5ADQ A;  4LI6 A;  4HKI A;  5C5P A;  4LI7 A;  5AKU A;  5C5R A;  5AL5 A;  4N4T A;  4L6S A;  4GV4 A;  5ADR A;  4HLG A;  4UI6 A;  4BU6 A;  4BUA A;  4UHG A;  4HHY A;  5DCZ A;  5AL2 A;  4BUS A;  5AL4 A;  4L7N A;  4F1L A;  4PAX A;  2RCW A;  3MHK A;  3UA9 A;  5LXP A;  4OPX C;  4XHU A;  4UW1 A;  5FPF A;  4HLF A;  3L3L A;  4TOR A;  4W5I A;  4L7P A;  3SE2 A;  4L7L A;  4UUH A;  4TJW A;  4KZL A;  4TK5 A; 
#chains in the Genus database with same CATH topology
 3U9H A;  4PML A;  4WPU A;  4BUV A;  3HKV A;  3UH2 A;  4OQB C;  2PQF A;  3P0Q A;  1M51 A;  4UI3 A;  4GMM A;  1UK1 A;  4W5S A;  2OLR A;  4K4F A;  1YLH A;  2PXZ X;  4J21 A;  4AVW A;  3GN7 A;  4BUU A;  4L34 A;  4L32 A;  2PY7 X;  4UI7 A;  4GNL A;  1GS0 A;  1WOK A;  4N4V A;  4L0S A;  4BU3 A;  1J3B A;  4UVX A;  3UDD A;  4BUY A;  4MSK A;  5ECE A;  4UVN A;  4BJ9 A;  5ADS A;  2PAW A;  4HKK A;  4L0T A;  4BU7 A;  2RK8 A;  4BUW A;  4UX4 A;  4GMZ A;  3MHJ A;  4J3M A;  4UXB A;  4X52 A;  4BU9 A;  4PJV A;  4F1Q A;  4KZQ A;  4L2G A;  4PNM A;  4PNN A;  5C5Q A;  1PAX A;  4GV7 A;  4TKG A;  4TK0 A;  3C4H A;  4UVW A;  4DQY C;  4L0I A;  4PY4 A;  4UND A;  4UFU A;  4HMH A;  3W51 A;  4TJU A;  4PNS A;  4WPT A;  4TVJ A;  4HYF A;  4UVT A;  4J1Z A;  4L6Z A;  3P0N A;  3CE0 A;  3U9Y A;  1KHB A;  3KR7 A;  5FPG A;  4PNL A;  4R5W A;  4R6E A;  1XKV A;  1UK0 A;  4BUF A;  4KZU A;  4LI8 A;  4RCG A;  3DTB A;  4U6A A;  4HLH A;  3GEY A;  3P0P A;  3DT4 A;  5FH0 A;  4HHZ A;  5FH2 A;  4GV0 A;  4L70 A;  5ADQ A;  2RKD A;  2RK7 A;  3KJD A;  4L0B A;  4W6E A;  3GOY A;  4PJT A;  1K3C A;  4YW9 A;  3SMJ A;  4BU8 A;  4RV6 A;  4GNQ A;  4BS4 A;  5FH5 A;  3MOF A;  4L2K A;  4TJY A;  2RKE A;  3MOH A;  4UVP A;  4WOU A;  4GNP A;  4J3L A;  4J22 A;  4MT9 A;  4L10 A;  1OEN A;  4AVU A;  4BJC A;  5ADT A;  3KCZ A;  4HL5 A;  4OQA C;  4HKN A;  5AKW A;  3L3M A;  1KHF A;  3DT7 A;  4IUE A;  4BJB A;  4BFP A;  4L7R A;  4PNT A;  4BU5 A;  2OLQ A;  3MOE A;  4R43 A;  4L31 A;  1OS1 A;  4UVS A;  4ZZZ A;  4GV2 A;  4UVZ A;  4BUX A;  4K4E A;  2QEW A;  4BUT A;  3BLJ A;  3GJW A;  4GMW A;  4L09 A;  5AEH A;  4DVI A;  4UI4 A;  2RF5 A;  4OA7 A;  1EFY A;  3PAX A;  4UVU A;  5ETY A;  4YW8 A;  5FH1 A;  3SMI A;  4BUD A;  4N3R A;  5AL1 A;  2PAX A;  5I67 A;  2FAH A;  4L33 A;  1A26 A;  4L2F A;  4L0V A;  4PNR A;  5EBT A;  5AL3 A;  5LYH A;  4UVO A;  2GMV A;  2RD6 A;  3KR8 A;  3C49 A;  4BUE A;  3DT2 A;  5A00 A;  4YWB A;  3UH4 A;  5LX6 A;  4WPV A;  1KHE A;  3FHB A;  4UVV A;  4HLK A;  1YVY A;  4I9I A;  2X5Y A;  4UVY A;  4ZZX A;  4L7O A;  5FH3 A;  4L7U A;  4TKI A;  4BUI A;  4UVL A;  2RKA A;  4KRS A;  4UI5 A;  4ZZY A;  4MSG A;  4UI8 A;  4M7B A;  2QF1 A;  1II2 A;  4HLM A;  4PNQ A;  4TKF A;  4TOS A;  4UFY A;  4LI6 A;  4F0E A;  2FAF A;  4HKI A;  5C5P A;  1NHX A;  4GNM A;  4LI7 A;  5AKU A;  1YGG A;  5AL5 A;  5C5R A;  1K3D A;  4N4T A;  4L6S A;  4WIU A;  1AQ2 A;  4GV4 A;  5ADR A;  4HLG A;  4UI6 A;  4BU6 A;  4BUA A;  4UHG A;  1KHG A;  4HHY A;  4GNO A;  5DCZ A;  4WL8 A;  5AL2 A;  2QEY A;  4BUS A;  5AL4 A;  4L7N A;  4WIE A;  4F1L A;  2QZY A;  2PC9 A;  4PAX A;  3MHK A;  2RCW A;  3UA9 A;  5LXP A;  4OPX C;  1YTM A;  2ZCI A;  4XHU A;  4GMU A;  4UW1 A;  5FPF A;  2QF2 A;  4HLF A;  1AYL A;  3L3L A;  4TOR A;  4W5I A;  4L7P A;  3SE2 A;  4OX2 A;  4L7L A;  4UUH A;  4TJW A;  5FH4 A;  4KZL A;  4TK5 A;  4YWD A; 
#chains in the Genus database with same CATH homology
 3U9H A;  4PML A;  4WPU A;  4BUV A;  3HKV A;  3UH2 A;  4OQB C;  2PQF A;  3P0Q A;  1M51 A;  4UI3 A;  4GMM A;  1UK1 A;  4W5S A;  2OLR A;  4K4F A;  1YLH A;  2PXZ X;  4J21 A;  4AVW A;  3GN7 A;  4BUU A;  4L34 A;  4L32 A;  2PY7 X;  4UI7 A;  4GNL A;  1GS0 A;  1WOK A;  4N4V A;  4L0S A;  4BU3 A;  1J3B A;  4UVX A;  3UDD A;  4BUY A;  4MSK A;  5ECE A;  4UVN A;  4BJ9 A;  5ADS A;  2PAW A;  4HKK A;  4L0T A;  4BU7 A;  2RK8 A;  4BUW A;  4UX4 A;  4GMZ A;  3MHJ A;  4J3M A;  4UXB A;  4X52 A;  4BU9 A;  4PJV A;  4F1Q A;  4KZQ A;  4L2G A;  4PNM A;  4PNN A;  5C5Q A;  1PAX A;  4GV7 A;  4TKG A;  4TK0 A;  3C4H A;  4UVW A;  4DQY C;  4L0I A;  4PY4 A;  4UND A;  4UFU A;  4HMH A;  3W51 A;  4TJU A;  4PNS A;  4WPT A;  4TVJ A;  4HYF A;  4UVT A;  4J1Z A;  4L6Z A;  3P0N A;  3CE0 A;  3U9Y A;  1KHB A;  3KR7 A;  5FPG A;  4PNL A;  4R5W A;  4R6E A;  1XKV A;  1UK0 A;  4BUF A;  4KZU A;  4LI8 A;  4RCG A;  3DTB A;  4U6A A;  4HLH A;  3GEY A;  3P0P A;  3DT4 A;  5FH0 A;  4HHZ A;  5FH2 A;  4GV0 A;  4L70 A;  5ADQ A;  2RKD A;  2RK7 A;  3KJD A;  4L0B A;  4W6E A;  3GOY A;  4PJT A;  1K3C A;  4YW9 A;  3SMJ A;  4BU8 A;  4RV6 A;  4GNQ A;  4BS4 A;  5FH5 A;  3MOF A;  4L2K A;  4TJY A;  2RKE A;  3MOH A;  4UVP A;  4WOU A;  4GNP A;  4J3L A;  4J22 A;  4MT9 A;  4L10 A;  1OEN A;  4AVU A;  4BJC A;  5ADT A;  3KCZ A;  4HL5 A;  4OQA C;  4HKN A;  5AKW A;  3L3M A;  1KHF A;  3DT7 A;  4IUE A;  4BJB A;  4BFP A;  4L7R A;  4PNT A;  4BU5 A;  2OLQ A;  3MOE A;  4R43 A;  4L31 A;  1OS1 A;  4UVS A;  4ZZZ A;  4GV2 A;  4UVZ A;  4BUX A;  4K4E A;  2QEW A;  4BUT A;  3BLJ A;  3GJW A;  4GMW A;  4L09 A;  5AEH A;  4DVI A;  4UI4 A;  2RF5 A;  4OA7 A;  1EFY A;  3PAX A;  4UVU A;  5ETY A;  4YW8 A;  5FH1 A;  3SMI A;  4BUD A;  4N3R A;  5AL1 A;  2PAX A;  5I67 A;  2FAH A;  4L33 A;  1A26 A;  4L2F A;  4L0V A;  4PNR A;  5EBT A;  5AL3 A;  5LYH A;  4UVO A;  2GMV A;  2RD6 A;  3KR8 A;  3C49 A;  4BUE A;  3DT2 A;  5A00 A;  4YWB A;  3UH4 A;  5LX6 A;  4WPV A;  1KHE A;  3FHB A;  4UVV A;  4HLK A;  1YVY A;  4I9I A;  2X5Y A;  4UVY A;  4ZZX A;  4L7O A;  5FH3 A;  4L7U A;  4TKI A;  4BUI A;  4UVL A;  2RKA A;  4KRS A;  4UI5 A;  4ZZY A;  4MSG A;  4UI8 A;  4M7B A;  2QF1 A;  1II2 A;  4HLM A;  4PNQ A;  4TKF A;  4TOS A;  4UFY A;  4LI6 A;  4F0E A;  2FAF A;  4HKI A;  5C5P A;  1NHX A;  4GNM A;  4LI7 A;  5AKU A;  1YGG A;  5AL5 A;  5C5R A;  1K3D A;  4N4T A;  4L6S A;  4WIU A;  1AQ2 A;  4GV4 A;  5ADR A;  4HLG A;  4UI6 A;  4BU6 A;  4BUA A;  4UHG A;  1KHG A;  4HHY A;  4GNO A;  5DCZ A;  4WL8 A;  5AL2 A;  2QEY A;  4BUS A;  5AL4 A;  4L7N A;  4WIE A;  4F1L A;  2QZY A;  2PC9 A;  4PAX A;  3MHK A;  2RCW A;  3UA9 A;  5LXP A;  4OPX C;  1YTM A;  2ZCI A;  4XHU A;  4GMU A;  4UW1 A;  5FPF A;  2QF2 A;  4HLF A;  1AYL A;  3L3L A;  4TOR A;  4W5I A;  4L7P A;  3SE2 A;  4OX2 A;  4L7L A;  4UUH A;  4TJW A;  5FH4 A;  4KZL A;  4TK5 A;  4YWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...