4BU7A

Crystal structure of human tankyrase 2 in complex with 2-(4- bromophenyl)-3,4-dihydroquinazolin-4-one
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 68
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu7A00
2RCWA 3BLJA 4PNNA 4BU5A 4R6EA 1GS0A 4UXBA 4PNMA 3UH2A 4L70A 4UVUA 5ADSA 5ECEA 1PAXA 3GEYA 3P0PA 1UK1A 4L0TA 5AL3A 4BJBA 2X5YA 3C4HA 3U9HA 5ADRA 4PNTA 4UI3A 3SMIA 4BU9A 4UVVA 4GV7A 4UVOA 4ZZXA 4J3LA 4RV6A 4UI4A 3UA9A 4L7NA 1A26A 4GV0A 4UVSA 3PAXA 4L2FA 4J3MA 5AL5A 4TKFA 4UVXA 3SMJA 4UHGA 5ADQA 5A00A 4AVUA 5AEHA 4DVIA 4GV4A 4W5IA 4L7PA 4BFPA 5LYHA 4UVLA 4BUDA 5AKWA 4HYFA 4MSKA 4PNSA 3KR8A 4TORA 5ETYA 4BS4A 4TVJA 5AL2A 4BUTA 4L7UA 4KZLA 5EBTA 3SE2A 4LI7A 4BJCA 4X52A 4UI6A 4L0VA 4PMLA 4W6EA 4TOSA 4HLHA 4HHZA 2PAXA 4TJUA 4TK0A 3C49A 4BJ9A 4ZZYA 5DCZA 2PQFA 4MT9A 4K4FA 4TJWA 4BUFA 4UX4A 3HKVA 3L3MA 4TKGA 4UVZA 2RF5A 4UVWA 3GOYA 4PJVA 4BU6A 4BU8A 4BU7A 4UFYA 4J21A 3MHKA 4AVWA 4F0EA 5FPFA 4L6SA 4XHUA 3KCZA 4OQAC 4UVTA 4L0BA 4F1LA 4U6AA 4BUSA 4UFUA 4K4EA 4HKNA 4L09A 4HHYA 2RD6A 4HLKA 5C5RA 5AL4A 4HLMA 4L7RA 4UNDA 4BUAA 3UDDA 4KZUA 4HMHA 1UK0A 4L33A 4L0IA 4HL5A 4MSGA 4PNLA 4UI7A 4BUEA 4L2KA 4L0SA 4BUXA 4HKIA 4L2GA 3GN7A 4BUUA 4UVPA 4N4VA 4BUIA 3CE0A 4L7OA 4N3RA 4DQYC 4M7BA 4I9IA 4L6ZA 4TJYA 4W5SA 2PAWA 3P0QA 3GJWA 3UH4A 4J1ZA 4F1QA 3P0NA 4GV2A 5LXPA 3MHJA 4PAXA 4R5WA 4UUHA 4L34A 5ADTA 4PNRA 4BUWA 4L31A 5C5QA 4HKKA 1EFYA 4IUEA 5AKUA 3FHBA 4BUVA 4UI5A 5AL1A 4L32A 4PY4A 4BU3A 4J22A 4UI8A 4ZZZA 4KRSA 3U9YA 4PNQA 4OQBC 4LI6A 4HLFA 5FPGA 4HLGA 3KR7A 4L7LA 4L10A 4UW1A 5C5PA 4TK5A 3KJDA 4UVYA 4LI8A 4N4TA 4OA7A 1WOKA 4PJTA 4UVNA 3L3LA 4BUYA 4TKIA 5LX6A 4KZQA 3W51A 4OPXC
chains in the Genus database with same CATH superfamily
2RCWA 3MOFA 3BLJA 4PNNA 4BU5A 4R6EA 4OX2A 1GS0A 4UXBA 4PNMA 3UH2A 4L70A 4UVUA 5ADSA 5ECEA 1PAXA 3GEYA 3P0PA 1UK1A 4L0TA 5AL3A 1K3DA 4GNOA 4BJBA 2X5YA 3C4HA 3U9HA 5ADRA 4PNTA 3MOHA 4UI3A 4WL8A 3SMIA 4BU9A 4GNLA 4UVVA 2ZCIA 4GV7A 4UVOA 4J3LA 4RV6A 4UI4A 4ZZXA 3UA9A 4L7NA 1A26A 4GV0A 4UVSA 3PAXA 4L2FA 4J3MA 5AL5A 4TKFA 4UVXA 3SMJA 1OENA 5ADQA 2QF2A 2RKEA 5A00A 4AVUA 5AEHA 4DVIA 4GV4A 4W5IA 4L7PA 4BFPA 5LYHA 4UVLA 2FAFA 4BUDA 5AKWA 4HYFA 4MSKA 4PNSA 3KR8A 4TORA 4WPUA 5ETYA 4BS4A 4GNMA 4TVJA 2OLQA 5AL2A 4BUTA 4L7UA 4KZLA 5EBTA 3SE2A 4LI7A 3DTBA 3MOEA 4X52A 4GMZA 4UI6A 4L0VA 2RK7A 4PMLA 4TOSA 4W6EA 4HLHA 4GNQA 4HHZA 2PAXA 4TJUA 4TK0A 3C49A 4BJ9A 4ZZYA 1XKVA 5DCZA 1II2A 1OS1A 1NHXA 2PQFA 4MT9A 5FH4A 4K4FA 2QEWA 4TJWA 4YWDA 4BUFA 4RCGA 4UX4A 3HKVA 1AQ2A 3L3MA 4TKGA 4UVZA 1YLHA 1YTMA 2RF5A 3GOYA 4PJVA 4UVWA 4BU6A 4BU8A 4BU7A 5FH5A 4UFYA 4J21A 3MHKA 5FH3A 4WOUA 2OLRA 2QEYA 2QF1A 4AVWA 1J3BA 4L6SA 4F0EA 5FPFA 4XHUA 1KHBA 3KCZA 4OQAC 4GMUA 4YW9A 1KHFA 4UVTA 4L0BA 2PC9A 4F1LA 4U6AA 4BUSA 4GMMA 4UFUA 4K4EA 1M51A 4HKNA 4L09A 2RKDA 1KHGA 1YGGA 2RD6A 4HHYA 3DT7A 4GNPA 4HLKA 5C5RA 5AL4A 4BJCA 4HLMA 4L7RA 4UNDA 4BUAA 2FAHA 3UDDA 1YVYA 4KZUA 4HMHA 1UK0A 2PY7X 4L33A 4L0IA 4HL5A 5FH2A 4MSGA 4PNLA 1KHEA 4UI7A 4BUEA 4L2KA 2RKAA 4WPTA 4L0SA 4BUXA 4HKIA 2RK8A 4L2GA 3GN7A 4BUUA 4UVPA 4N4VA 4BUIA 3CE0A 4L7OA 4N3RA 4DQYC 4M7BA 4I9IA 4L6ZA 4TJYA 4W5SA 2PAWA 3P0QA 3GJWA 3UH4A 4YW8A 5FH0A 4J1ZA 4F1QA 2QZYA 3DT2A 3P0NA 4GV2A 4R43A 2GMVA 5LXPA 3MHJA 4PAXA 4R5WA 1K3CA 4UUHA 4YWBA 4L34A 5ADTA 4PNRA 4BUWA 4L31A 5C5QA 4HKKA 1EFYA 4IUEA 5AKUA 3FHBA 2PXZX 4BUVA 4UI5A 4GMWA 4L32A 5AL1A 4PY4A 4BU3A 3DT4A 1AYLA 4J22A 4UI8A 4ZZZA 4KRSA 3U9YA 4PNQA 5FH1A 4WIUA 4OQBC 4LI6A 4HLFA 5I67A 5FPGA 4HLGA 4WPVA 3KR7A 4WIEA 4L7LA 4L10A 4UW1A 5C5PA 4TK5A 3KJDA 4UVYA 4LI8A 4N4TA 4OA7A 1WOKA 4PJTA 4UVNA 3L3LA 4BUYA 4TKIA 4UHGA 5LX6A 4KZQA 3W51A 4OPXC
chains in the Genus database with same CATH topology
2RCWA 3MOFA 3BLJA 4PNNA 4BU5A 4R6EA 4OX2A 1GS0A 4UXBA 4PNMA 3UH2A 4L70A 4UVUA 5ADSA 5ECEA 1PAXA 3GEYA 3P0PA 1UK1A 4L0TA 5AL3A 1K3DA 4GNOA 4BJBA 2X5YA 3C4HA 3U9HA 5ADRA 4PNTA 3MOHA 4UI3A 4WL8A 3SMIA 4BU9A 4GNLA 4UVVA 2ZCIA 4GV7A 4UVOA 4J3LA 4RV6A 4UI4A 4ZZXA 3UA9A 4L7NA 1A26A 4GV0A 4UVSA 3PAXA 4L2FA 4J3MA 5AL5A 4TKFA 4UVXA 3SMJA 1OENA 5ADQA 2QF2A 2RKEA 5A00A 4AVUA 5AEHA 4DVIA 4GV4A 4W5IA 4L7PA 4BFPA 5LYHA 4UVLA 2FAFA 4BUDA 5AKWA 4HYFA 4MSKA 4PNSA 3KR8A 4TORA 4WPUA 5ETYA 4BS4A 4GNMA 4TVJA 2OLQA 5AL2A 4BUTA 4L7UA 4KZLA 5EBTA 3SE2A 4LI7A 3DTBA 3MOEA 4X52A 4GMZA 4UI6A 4L0VA 2RK7A 4PMLA 4TOSA 4W6EA 4HLHA 4GNQA 4HHZA 2PAXA 4TJUA 4TK0A 3C49A 4BJ9A 4ZZYA 1XKVA 5DCZA 1II2A 1OS1A 1NHXA 2PQFA 4MT9A 5FH4A 4K4FA 2QEWA 4TJWA 4YWDA 4BUFA 4RCGA 4UX4A 3HKVA 1AQ2A 3L3MA 4TKGA 4UVZA 1YLHA 1YTMA 2RF5A 3GOYA 4PJVA 4UVWA 4BU6A 4BU8A 4BU7A 5FH5A 4UFYA 4J21A 3MHKA 5FH3A 4WOUA 2OLRA 2QEYA 2QF1A 4AVWA 1J3BA 4L6SA 4F0EA 5FPFA 4XHUA 1KHBA 3KCZA 4OQAC 4GMUA 4YW9A 1KHFA 4UVTA 4L0BA 2PC9A 4F1LA 4U6AA 4BUSA 4GMMA 4UFUA 4K4EA 1M51A 4HKNA 4L09A 2RKDA 1KHGA 1YGGA 2RD6A 4HHYA 3DT7A 4GNPA 4HLKA 5C5RA 5AL4A 4BJCA 4HLMA 4L7RA 4UNDA 4BUAA 2FAHA 3UDDA 1YVYA 4KZUA 4HMHA 1UK0A 2PY7X 4L33A 4L0IA 4HL5A 5FH2A 4MSGA 4PNLA 1KHEA 4UI7A 4BUEA 4L2KA 2RKAA 4WPTA 4L0SA 4BUXA 4HKIA 2RK8A 4L2GA 3GN7A 4BUUA 4UVPA 4N4VA 4BUIA 3CE0A 4L7OA 4N3RA 4DQYC 4M7BA 4I9IA 4L6ZA 4TJYA 4W5SA 2PAWA 3P0QA 3GJWA 3UH4A 4YW8A 5FH0A 4J1ZA 4F1QA 2QZYA 3DT2A 3P0NA 4GV2A 4R43A 2GMVA 5LXPA 3MHJA 4PAXA 4R5WA 1K3CA 4UUHA 4YWBA 4L34A 5ADTA 4PNRA 4BUWA 4L31A 5C5QA 4HKKA 1EFYA 4IUEA 5AKUA 3FHBA 2PXZX 4BUVA 4UI5A 4GMWA 4L32A 5AL1A 4PY4A 4BU3A 3DT4A 1AYLA 4J22A 4UI8A 4ZZZA 4KRSA 3U9YA 4PNQA 5FH1A 4WIUA 4OQBC 4LI6A 4HLFA 5I67A 5FPGA 4HLGA 4WPVA 3KR7A 4WIEA 4L7LA 4L10A 4UW1A 5C5PA 4TK5A 3KJDA 4UVYA 4LI8A 4N4TA 4OA7A 1WOKA 4PJTA 4UVNA 3L3LA 4BUYA 4TKIA 4UHGA 5LX6A 4KZQA 3W51A 4OPXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCW A;  3BLJ A;  4PNN A;  4BU5 A;  4R6E A;  1GS0 A;  4UXB A;  4PNM A;  3UH2 A;  4L70 A;  4UVU A;  5ADS A;  5ECE A;  1PAX A;  3GEY A;  3P0P A;  1UK1 A;  4L0T A;  5AL3 A;  4BJB A;  2X5Y A;  3C4H A;  3U9H A;  5ADR A;  4PNT A;  4UI3 A;  3SMI A;  4BU9 A;  4UVV A;  4GV7 A;  4UVO A;  4ZZX A;  4J3L A;  4RV6 A;  4UI4 A;  3UA9 A;  4L7N A;  1A26 A;  4GV0 A;  4UVS A;  3PAX A;  4L2F A;  4J3M A;  5AL5 A;  4TKF A;  4UVX A;  3SMJ A;  4UHG A;  5ADQ A;  5A00 A;  4AVU A;  5AEH A;  4DVI A;  4GV4 A;  4W5I A;  4L7P A;  4BFP A;  5LYH A;  4UVL A;  4BUD A;  5AKW A;  4HYF A;  4MSK A;  4PNS A;  3KR8 A;  4TOR A;  5ETY A;  4BS4 A;  4TVJ A;  5AL2 A;  4BUT A;  4L7U A;  4KZL A;  5EBT A;  3SE2 A;  4LI7 A;  4BJC A;  4X52 A;  4UI6 A;  4L0V A;  4PML A;  4W6E A;  4TOS A;  4HLH A;  4HHZ A;  2PAX A;  4TJU A;  4TK0 A;  3C49 A;  4BJ9 A;  4ZZY A;  5DCZ A;  2PQF A;  4MT9 A;  4K4F A;  4TJW A;  4BUF A;  4UX4 A;  3HKV A;  3L3M A;  4TKG A;  4UVZ A;  2RF5 A;  4UVW A;  3GOY A;  4PJV A;  4BU6 A;  4BU8 A;  4BU7 A;  4UFY A;  4J21 A;  3MHK A;  4AVW A;  4F0E A;  5FPF A;  4L6S A;  4XHU A;  3KCZ A;  4OQA C;  4UVT A;  4L0B A;  4F1L A;  4U6A A;  4BUS A;  4UFU A;  4K4E A;  4HKN A;  4L09 A;  4HHY A;  2RD6 A;  4HLK A;  5C5R A;  5AL4 A;  4HLM A;  4L7R A;  4UND A;  4BUA A;  3UDD A;  4KZU A;  4HMH A;  1UK0 A;  4L33 A;  4L0I A;  4HL5 A;  4MSG A;  4PNL A;  4UI7 A;  4BUE A;  4L2K A;  4L0S A;  4BUX A;  4HKI A;  4L2G A;  3GN7 A;  4BUU A;  4UVP A;  4N4V A;  4BUI A;  3CE0 A;  4L7O A;  4N3R A;  4DQY C;  4M7B A;  4I9I A;  4L6Z A;  4TJY A;  4W5S A;  2PAW A;  3P0Q A;  3GJW A;  3UH4 A;  4J1Z A;  4F1Q A;  3P0N A;  4GV2 A;  5LXP A;  3MHJ A;  4PAX A;  4R5W A;  4UUH A;  4L34 A;  5ADT A;  4PNR A;  4BUW A;  4L31 A;  5C5Q A;  4HKK A;  1EFY A;  4IUE A;  5AKU A;  3FHB A;  4BUV A;  4UI5 A;  5AL1 A;  4L32 A;  4PY4 A;  4BU3 A;  4J22 A;  4UI8 A;  4ZZZ A;  4KRS A;  3U9Y A;  4PNQ A;  4OQB C;  4LI6 A;  4HLF A;  5FPG A;  4HLG A;  3KR7 A;  4L7L A;  4L10 A;  4UW1 A;  5C5P A;  4TK5 A;  3KJD A;  4UVY A;  4LI8 A;  4N4T A;  4OA7 A;  1WOK A;  4PJT A;  4UVN A;  3L3L A;  4BUY A;  4TKI A;  5LX6 A;  4KZQ A;  3W51 A;  4OPX C; 
#chains in the Genus database with same CATH topology
 2RCW A;  3MOF A;  3BLJ A;  4PNN A;  4BU5 A;  4R6E A;  4OX2 A;  1GS0 A;  4UXB A;  4PNM A;  3UH2 A;  4L70 A;  4UVU A;  5ADS A;  5ECE A;  1PAX A;  3GEY A;  3P0P A;  1UK1 A;  4L0T A;  5AL3 A;  1K3D A;  4GNO A;  4BJB A;  2X5Y A;  3C4H A;  3U9H A;  5ADR A;  4PNT A;  3MOH A;  4UI3 A;  4WL8 A;  3SMI A;  4BU9 A;  4GNL A;  4UVV A;  2ZCI A;  4GV7 A;  4UVO A;  4J3L A;  4RV6 A;  4UI4 A;  4ZZX A;  3UA9 A;  4L7N A;  1A26 A;  4GV0 A;  4UVS A;  3PAX A;  4L2F A;  4J3M A;  5AL5 A;  4TKF A;  4UVX A;  3SMJ A;  1OEN A;  5ADQ A;  2QF2 A;  2RKE A;  5A00 A;  4AVU A;  5AEH A;  4DVI A;  4GV4 A;  4W5I A;  4L7P A;  4BFP A;  5LYH A;  4UVL A;  2FAF A;  4BUD A;  5AKW A;  4HYF A;  4MSK A;  4PNS A;  3KR8 A;  4TOR A;  4WPU A;  5ETY A;  4BS4 A;  4GNM A;  4TVJ A;  2OLQ A;  5AL2 A;  4BUT A;  4L7U A;  4KZL A;  5EBT A;  3SE2 A;  4LI7 A;  3DTB A;  3MOE A;  4X52 A;  4GMZ A;  4UI6 A;  4L0V A;  2RK7 A;  4PML A;  4TOS A;  4W6E A;  4HLH A;  4GNQ A;  4HHZ A;  2PAX A;  4TJU A;  4TK0 A;  3C49 A;  4BJ9 A;  4ZZY A;  1XKV A;  5DCZ A;  1II2 A;  1OS1 A;  1NHX A;  2PQF A;  4MT9 A;  5FH4 A;  4K4F A;  2QEW A;  4TJW A;  4YWD A;  4BUF A;  4RCG A;  4UX4 A;  3HKV A;  1AQ2 A;  3L3M A;  4TKG A;  4UVZ A;  1YLH A;  1YTM A;  2RF5 A;  3GOY A;  4PJV A;  4UVW A;  4BU6 A;  4BU8 A;  4BU7 A;  5FH5 A;  4UFY A;  4J21 A;  3MHK A;  5FH3 A;  4WOU A;  2OLR A;  2QEY A;  2QF1 A;  4AVW A;  1J3B A;  4L6S A;  4F0E A;  5FPF A;  4XHU A;  1KHB A;  3KCZ A;  4OQA C;  4GMU A;  4YW9 A;  1KHF A;  4UVT A;  4L0B A;  2PC9 A;  4F1L A;  4U6A A;  4BUS A;  4GMM A;  4UFU A;  4K4E A;  1M51 A;  4HKN A;  4L09 A;  2RKD A;  1KHG A;  1YGG A;  2RD6 A;  4HHY A;  3DT7 A;  4GNP A;  4HLK A;  5C5R A;  5AL4 A;  4BJC A;  4HLM A;  4L7R A;  4UND A;  4BUA A;  2FAH A;  3UDD A;  1YVY A;  4KZU A;  4HMH A;  1UK0 A;  2PY7 X;  4L33 A;  4L0I A;  4HL5 A;  5FH2 A;  4MSG A;  4PNL A;  1KHE A;  4UI7 A;  4BUE A;  4L2K A;  2RKA A;  4WPT A;  4L0S A;  4BUX A;  4HKI A;  2RK8 A;  4L2G A;  3GN7 A;  4BUU A;  4UVP A;  4N4V A;  4BUI A;  3CE0 A;  4L7O A;  4N3R A;  4DQY C;  4M7B A;  4I9I A;  4L6Z A;  4TJY A;  4W5S A;  2PAW A;  3P0Q A;  3GJW A;  3UH4 A;  4YW8 A;  5FH0 A;  4J1Z A;  4F1Q A;  2QZY A;  3DT2 A;  3P0N A;  4GV2 A;  4R43 A;  2GMV A;  5LXP A;  3MHJ A;  4PAX A;  4R5W A;  1K3C A;  4UUH A;  4YWB A;  4L34 A;  5ADT A;  4PNR A;  4BUW A;  4L31 A;  5C5Q A;  4HKK A;  1EFY A;  4IUE A;  5AKU A;  3FHB A;  2PXZ X;  4BUV A;  4UI5 A;  4GMW A;  4L32 A;  5AL1 A;  4PY4 A;  4BU3 A;  3DT4 A;  1AYL A;  4J22 A;  4UI8 A;  4ZZZ A;  4KRS A;  3U9Y A;  4PNQ A;  5FH1 A;  4WIU A;  4OQB C;  4LI6 A;  4HLF A;  5I67 A;  5FPG A;  4HLG A;  4WPV A;  3KR7 A;  4WIE A;  4L7L A;  4L10 A;  4UW1 A;  5C5P A;  4TK5 A;  3KJD A;  4UVY A;  4LI8 A;  4N4T A;  4OA7 A;  1WOK A;  4PJT A;  4UVN A;  3L3L A;  4BUY A;  4TKI A;  4UHG A;  5LX6 A;  4KZQ A;  3W51 A;  4OPX C; 
#chains in the Genus database with same CATH homology
 2RCW A;  3MOF A;  3BLJ A;  4PNN A;  4BU5 A;  4R6E A;  4OX2 A;  1GS0 A;  4UXB A;  4PNM A;  3UH2 A;  4L70 A;  4UVU A;  5ADS A;  5ECE A;  1PAX A;  3GEY A;  3P0P A;  1UK1 A;  4L0T A;  5AL3 A;  1K3D A;  4GNO A;  4BJB A;  2X5Y A;  3C4H A;  3U9H A;  5ADR A;  4PNT A;  3MOH A;  4UI3 A;  4WL8 A;  3SMI A;  4BU9 A;  4GNL A;  4UVV A;  2ZCI A;  4GV7 A;  4UVO A;  4J3L A;  4RV6 A;  4UI4 A;  4ZZX A;  3UA9 A;  4L7N A;  1A26 A;  4GV0 A;  4UVS A;  3PAX A;  4L2F A;  4J3M A;  5AL5 A;  4TKF A;  4UVX A;  3SMJ A;  1OEN A;  5ADQ A;  2QF2 A;  2RKE A;  5A00 A;  4AVU A;  5AEH A;  4DVI A;  4GV4 A;  4W5I A;  4L7P A;  4BFP A;  5LYH A;  4UVL A;  2FAF A;  4BUD A;  5AKW A;  4HYF A;  4MSK A;  4PNS A;  3KR8 A;  4TOR A;  4WPU A;  5ETY A;  4BS4 A;  4GNM A;  4TVJ A;  2OLQ A;  5AL2 A;  4BUT A;  4L7U A;  4KZL A;  5EBT A;  3SE2 A;  4LI7 A;  3DTB A;  3MOE A;  4X52 A;  4GMZ A;  4UI6 A;  4L0V A;  2RK7 A;  4PML A;  4TOS A;  4W6E A;  4HLH A;  4GNQ A;  4HHZ A;  2PAX A;  4TJU A;  4TK0 A;  3C49 A;  4BJ9 A;  4ZZY A;  1XKV A;  5DCZ A;  1II2 A;  1OS1 A;  1NHX A;  2PQF A;  4MT9 A;  5FH4 A;  4K4F A;  2QEW A;  4TJW A;  4YWD A;  4BUF A;  4RCG A;  4UX4 A;  3HKV A;  1AQ2 A;  3L3M A;  4TKG A;  4UVZ A;  1YLH A;  1YTM A;  2RF5 A;  3GOY A;  4PJV A;  4UVW A;  4BU6 A;  4BU8 A;  4BU7 A;  5FH5 A;  4UFY A;  4J21 A;  3MHK A;  5FH3 A;  4WOU A;  2OLR A;  2QEY A;  2QF1 A;  4AVW A;  1J3B A;  4L6S A;  4F0E A;  5FPF A;  4XHU A;  1KHB A;  3KCZ A;  4OQA C;  4GMU A;  4YW9 A;  1KHF A;  4UVT A;  4L0B A;  2PC9 A;  4F1L A;  4U6A A;  4BUS A;  4GMM A;  4UFU A;  4K4E A;  1M51 A;  4HKN A;  4L09 A;  2RKD A;  1KHG A;  1YGG A;  2RD6 A;  4HHY A;  3DT7 A;  4GNP A;  4HLK A;  5C5R A;  5AL4 A;  4BJC A;  4HLM A;  4L7R A;  4UND A;  4BUA A;  2FAH A;  3UDD A;  1YVY A;  4KZU A;  4HMH A;  1UK0 A;  2PY7 X;  4L33 A;  4L0I A;  4HL5 A;  5FH2 A;  4MSG A;  4PNL A;  1KHE A;  4UI7 A;  4BUE A;  4L2K A;  2RKA A;  4WPT A;  4L0S A;  4BUX A;  4HKI A;  2RK8 A;  4L2G A;  3GN7 A;  4BUU A;  4UVP A;  4N4V A;  4BUI A;  3CE0 A;  4L7O A;  4N3R A;  4DQY C;  4M7B A;  4I9I A;  4L6Z A;  4TJY A;  4W5S A;  2PAW A;  3P0Q A;  3GJW A;  3UH4 A;  4YW8 A;  5FH0 A;  4J1Z A;  4F1Q A;  2QZY A;  3DT2 A;  3P0N A;  4GV2 A;  4R43 A;  2GMV A;  5LXP A;  3MHJ A;  4PAX A;  4R5W A;  1K3C A;  4UUH A;  4YWB A;  4L34 A;  5ADT A;  4PNR A;  4BUW A;  4L31 A;  5C5Q A;  4HKK A;  1EFY A;  4IUE A;  5AKU A;  3FHB A;  2PXZ X;  4BUV A;  4UI5 A;  4GMW A;  4L32 A;  5AL1 A;  4PY4 A;  4BU3 A;  3DT4 A;  1AYL A;  4J22 A;  4UI8 A;  4ZZZ A;  4KRS A;  3U9Y A;  4PNQ A;  5FH1 A;  4WIU A;  4OQB C;  4LI6 A;  4HLF A;  5I67 A;  5FPG A;  4HLG A;  4WPV A;  3KR7 A;  4WIE A;  4L7L A;  4L10 A;  4UW1 A;  5C5P A;  4TK5 A;  3KJD A;  4UVY A;  4LI8 A;  4N4T A;  4OA7 A;  1WOK A;  4PJT A;  4UVN A;  3L3L A;  4BUY A;  4TKI A;  4UHG A;  5LX6 A;  4KZQ A;  3W51 A;  4OPX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...