4BU7A

Crystal structure of human tankyrase 2 in complex with 2-(4- bromophenyl)-3,4-dihydroquinazolin-4-one
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu7A00
4MSGA 4J21A 5AKUA 5C5QA 4L2FA 4TJUA 4UVUA 5EBTA 3L3LA 4BUSA 4UVSA 4UXBA 4L2KA 4L7RA 4BUYA 4UHGA 4N4TA 3GJWA 4L0IA 4HLGA 4GV4A 4TOSA 4BUAA 2PAWA 3KR8A 5ADTA 4GV0A 4J3LA 3U9YA 4HLMA 4UVVA 4N4VA 4UVOA 4HKKA 4MT9A 3FHBA 4GV2A 4PNMA 5ETYA 4KZLA 3MHKA 4L31A 3UH2A 2X5YA 4R6EA 3C4HA 3P0NA 5AL5A 4BUTA 4K4EA 4L6ZA 4BU5A 4BUEA 4LI7A 4M7BA 4J1ZA 4UI6A 4L0BA 4W6EA 3SMIA 2RF5A 4BU9A 4R5WA 5ADQA 3P0QA 4L10A 2PAXA 5LYHA 4KZUA 1UK1A 4UFYA 4BJBA 5C5RA 5AL2A 4UNDA 4KZQA 4F1LA 4BUWA 4HHZA 4L09A 4PMLA 4L0TA 5AL4A 4BFPA 4BJ9A 4BUIA 4TK0A 4HLFA 4TKFA 4TJYA 4L7UA 4K4FA 4UUHA 4PAXA 1EFYA 3CE0A 4UVZA 4UI7A 4BS4A 3GEYA 4L33A 5FPGA 4TORA 4HKNA 4TKIA 4L32A 4TKGA 3HKVA 4PNRA 3PAXA 4F0EA 3MHJA 3SMJA 4L6SA 4UI8A 3W51A 3BLJA 4PNLA 3UDDA 5ADRA 4BUVA 4BU8A 4HKIA 4J3MA 4UVPA 4BUFA 5AL3A 3UA9A 3GOYA 4AVWA 5DCZA 4LI6A 5C5PA 3L3MA 4OQBC 1PAXA 5AEHA 4PNTA 4ZZZA 1UK0A 4AVUA 4UI5A 4L0VA 4UX4A 3KJDA 4L7NA 4GV7A 4XHUA 4BU6A 5A00A 5FPFA 4OPXC 4PY4A 4BU7A 4PNSA 1A26A 3SE2A 3UH4A 4UFUA 4U6AA 4BUDA 5AKWA 4IUEA 4UW1A 4X52A 4J22A 4TVJA 4W5SA 4W5IA 4L7OA 4HYFA 4ZZYA 3GN7A 4KRSA 4PJVA 4BUUA 4UI3A 4UI4A 5LXPA 4UVTA 4BUXA 4DVIA 2RD6A 5AL1A 4PJTA 4L7PA 4BU3A 5ADSA 4UVNA 4HLHA 1GS0A 4HLKA 4DQYC 4I9IA 4L34A 4ZZXA 4OQAC 4UVLA 4UVXA 3C49A 4PNQA 3KR7A 3P0PA 4HMHA 4OA7A 4PNNA 4L70A 4L0SA 5LX6A 4L2GA 2RCWA 4L7LA 5ECEA 3U9HA 4N3RA 4F1QA 4RV6A 3KCZA 4HL5A 4BJCA 4HHYA 4MSKA 4UVYA 2PQFA 4UVWA 4TJWA 4LI8A 4TK5A 1WOKA
chains in the Genus database with same CATH superfamily
5FH2A 4MSGA 4J21A 5AKUA 4RCGA 1AYLA 5C5QA 4L2FA 4TJUA 4UVUA 5EBTA 3L3LA 4BUSA 4UVSA 2ZCIA 4L2KA 2RKAA 4L7RA 4GNOA 4UXBA 4N4TA 4BUYA 4UHGA 3GJWA 4L0IA 4HLGA 4GV4A 4TOSA 4WIUA 3DTBA 4WPUA 2PAWA 3KR8A 4BUAA 4GV0A 4J3LA 3U9YA 2QF2A 3MOHA 4HLMA 5ADTA 4UVVA 4N4VA 2OLQA 4UVOA 4BU9A 4HKKA 4MT9A 3FHBA 4GV2A 4PNMA 5ETYA 4GMUA 4KZLA 3MHKA 4L31A 3UH2A 2FAHA 2X5YA 4R6EA 3C4HA 3P0NA 5AL5A 4BUTA 4K4EA 4L6ZA 4BU5A 4BUEA 4LI7A 4M7BA 1KHFA 4GMZA 4J1ZA 4L0BA 4UI6A 1K3DA 2RF5A 4OX2A 4R5WA 4W6EA 3P0QA 3SMIA 4L10A 2PAXA 1KHBA 5ADQA 5LYHA 4KZUA 1UK1A 4YW9A 4UFYA 3DT4A 4BJBA 5C5RA 5AL2A 4YW8A 1NHXA 4UNDA 4KZQA 4F1LA 4GNMA 4BUWA 4HHZA 4L09A 4WIEA 4PMLA 4L0TA 1J3BA 5AL4A 4BFPA 4BJ9A 4BUIA 5LXPA 4TK0A 3MOEA 4HLFA 4TKFA 2PXZX 4TJYA 4L7UA 4K4FA 4UUHA 1KHEA 1EFYA 3CE0A 4PAXA 4UVZA 4UI7A 4BS4A 2QZYA 2RK7A 3GEYA 1OS1A 2PC9A 4L33A 2RKDA 5FPGA 4TORA 4HKNA 1YVYA 4TKIA 4L32A 4TKGA 3HKVA 4PNRA 3PAXA 4F0EA 4GNQA 2GMVA 3MHJA 3SMJA 4L6SA 2RKEA 4UI8A 3W51A 3BLJA 4PNLA 3UDDA 5ADRA 4BUVA 4BU8A 2RK8A 4HKIA 4J3MA 4UVPA 4BUFA 5AL3A 3UA9A 3GOYA 4GNLA 4AVWA 4GMWA 5DCZA 4LI6A 5C5PA 3L3MA 4OQBC 1PAXA 5AEHA 4PNTA 2QEYA 4ZZZA 1UK0A 2QF1A 4UI5A 4L0VA 4AVUA 4UX4A 3KJDA 4L7NA 4GV7A 4XHUA 1OENA 2OLRA 2FAFA 5A00A 4BU6A 5FPFA 4OPXC 1XKVA 4PY4A 4BU7A 4PNSA 1A26A 3SE2A 3UH4A 2QEWA 1K3CA 4UFUA 4U6AA 4BUDA 5AKWA 4IUEA 4UW1A 4X52A 4J22A 4TVJA 5FH0A 4W5SA 4W5IA 5FH3A 4L7OA 4HYFA 5FH1A 4ZZYA 3GN7A 4WPTA 3DT2A 1YLHA 4KRSA 4PJVA 4R43A 4UI3A 1M51A 4UI4A 4UVTA 4BUUA 4BUXA 4DVIA 2RD6A 5AL1A 5FH5A 4PJTA 4L7PA 1II2A 4WPVA 4BU3A 5ADSA 4YWDA 4UVNA 4WL8A 4HLHA 3DT7A 1GS0A 4HLKA 4DQYC 1YGGA 4I9IA 4L34A 3MOFA 4ZZXA 4OQAC 4UVLA 4UVXA 4YWBA 3C49A 4PNQA 3KR7A 3P0PA 4HMHA 4OA7A 4PNNA 2PY7X 4L70A 4L0SA 5FH4A 5I67A 4GMMA 4L2GA 5LX6A 2RCWA 4L7LA 5ECEA 1KHGA 4N3RA 3U9HA 4F1QA 4WOUA 1AQ2A 4RV6A 3KCZA 4HL5A 1YTMA 4BJCA 4GNPA 4HHYA 4MSKA 4UVYA 2PQFA 4UVWA 4TJWA 4LI8A 4TK5A 1WOKA
chains in the Genus database with same CATH topology
5FH2A 4MSGA 4J21A 5AKUA 4RCGA 1AYLA 5C5QA 4L2FA 4TJUA 4UVUA 5EBTA 3L3LA 4BUSA 4UVSA 2ZCIA 4L2KA 2RKAA 4L7RA 4GNOA 4UXBA 4N4TA 4BUYA 4UHGA 3GJWA 4L0IA 4HLGA 4GV4A 4TOSA 4WIUA 3DTBA 4WPUA 2PAWA 3KR8A 4BUAA 4GV0A 4J3LA 3U9YA 2QF2A 3MOHA 4HLMA 5ADTA 4UVVA 4N4VA 2OLQA 4UVOA 4BU9A 4HKKA 4MT9A 3FHBA 4GV2A 4PNMA 5ETYA 4GMUA 4KZLA 3MHKA 4L31A 3UH2A 2FAHA 2X5YA 4R6EA 3C4HA 3P0NA 5AL5A 4BUTA 4K4EA 4L6ZA 4BU5A 4BUEA 4LI7A 4M7BA 1KHFA 4GMZA 4J1ZA 4L0BA 4UI6A 1K3DA 2RF5A 4OX2A 4R5WA 4W6EA 3P0QA 3SMIA 4L10A 2PAXA 1KHBA 5ADQA 5LYHA 4KZUA 1UK1A 4YW9A 4UFYA 3DT4A 4BJBA 5C5RA 5AL2A 4YW8A 1NHXA 4UNDA 4KZQA 4F1LA 4GNMA 4BUWA 4HHZA 4L09A 4WIEA 4PMLA 4L0TA 1J3BA 5AL4A 4BFPA 4BJ9A 4BUIA 5LXPA 4TK0A 3MOEA 4HLFA 4TKFA 2PXZX 4TJYA 4L7UA 4K4FA 4UUHA 1KHEA 1EFYA 3CE0A 4PAXA 4UVZA 4UI7A 4BS4A 2QZYA 2RK7A 3GEYA 1OS1A 2PC9A 4L33A 2RKDA 5FPGA 4TORA 4HKNA 1YVYA 4TKIA 4L32A 4TKGA 3HKVA 4PNRA 3PAXA 4F0EA 4GNQA 2GMVA 3MHJA 3SMJA 4L6SA 2RKEA 4UI8A 3W51A 3BLJA 4PNLA 3UDDA 5ADRA 4BUVA 4BU8A 2RK8A 4HKIA 4J3MA 4UVPA 4BUFA 5AL3A 3UA9A 3GOYA 4GNLA 4AVWA 4GMWA 5DCZA 4LI6A 5C5PA 3L3MA 4OQBC 1PAXA 5AEHA 4PNTA 2QEYA 4ZZZA 1UK0A 2QF1A 4UI5A 4L0VA 4AVUA 4UX4A 3KJDA 4L7NA 4GV7A 4XHUA 1OENA 2OLRA 2FAFA 5A00A 4BU6A 5FPFA 4OPXC 1XKVA 4PY4A 4BU7A 4PNSA 1A26A 3SE2A 3UH4A 2QEWA 1K3CA 4UFUA 4U6AA 4BUDA 5AKWA 4IUEA 4UW1A 4X52A 4J22A 4TVJA 5FH0A 4W5SA 4W5IA 5FH3A 4L7OA 4HYFA 5FH1A 4ZZYA 3GN7A 4WPTA 3DT2A 1YLHA 4KRSA 4PJVA 4R43A 4UI3A 1M51A 4UI4A 4UVTA 4BUUA 4BUXA 4DVIA 2RD6A 5AL1A 5FH5A 4PJTA 4L7PA 1II2A 4WPVA 4BU3A 5ADSA 4YWDA 4UVNA 4WL8A 4HLHA 3DT7A 1GS0A 4HLKA 4DQYC 1YGGA 4I9IA 4L34A 3MOFA 4ZZXA 4OQAC 4UVLA 4UVXA 4YWBA 3C49A 4PNQA 3KR7A 3P0PA 4HMHA 4OA7A 4PNNA 2PY7X 4L70A 4L0SA 5FH4A 5I67A 4GMMA 4L2GA 5LX6A 2RCWA 4L7LA 5ECEA 1KHGA 4N3RA 3U9HA 4F1QA 4WOUA 1AQ2A 4RV6A 3KCZA 4HL5A 1YTMA 4BJCA 4GNPA 4HHYA 4MSKA 4UVYA 2PQFA 4UVWA 4TJWA 4LI8A 4TK5A 1WOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSG A;  4J21 A;  5AKU A;  5C5Q A;  4L2F A;  4TJU A;  4UVU A;  5EBT A;  3L3L A;  4BUS A;  4UVS A;  4UXB A;  4L2K A;  4L7R A;  4BUY A;  4UHG A;  4N4T A;  3GJW A;  4L0I A;  4HLG A;  4GV4 A;  4TOS A;  4BUA A;  2PAW A;  3KR8 A;  5ADT A;  4GV0 A;  4J3L A;  3U9Y A;  4HLM A;  4UVV A;  4N4V A;  4UVO A;  4HKK A;  4MT9 A;  3FHB A;  4GV2 A;  4PNM A;  5ETY A;  4KZL A;  3MHK A;  4L31 A;  3UH2 A;  2X5Y A;  4R6E A;  3C4H A;  3P0N A;  5AL5 A;  4BUT A;  4K4E A;  4L6Z A;  4BU5 A;  4BUE A;  4LI7 A;  4M7B A;  4J1Z A;  4UI6 A;  4L0B A;  4W6E A;  3SMI A;  2RF5 A;  4BU9 A;  4R5W A;  5ADQ A;  3P0Q A;  4L10 A;  2PAX A;  5LYH A;  4KZU A;  1UK1 A;  4UFY A;  4BJB A;  5C5R A;  5AL2 A;  4UND A;  4KZQ A;  4F1L A;  4BUW A;  4HHZ A;  4L09 A;  4PML A;  4L0T A;  5AL4 A;  4BFP A;  4BJ9 A;  4BUI A;  4TK0 A;  4HLF A;  4TKF A;  4TJY A;  4L7U A;  4K4F A;  4UUH A;  4PAX A;  1EFY A;  3CE0 A;  4UVZ A;  4UI7 A;  4BS4 A;  3GEY A;  4L33 A;  5FPG A;  4TOR A;  4HKN A;  4TKI A;  4L32 A;  4TKG A;  3HKV A;  4PNR A;  3PAX A;  4F0E A;  3MHJ A;  3SMJ A;  4L6S A;  4UI8 A;  3W51 A;  3BLJ A;  4PNL A;  3UDD A;  5ADR A;  4BUV A;  4BU8 A;  4HKI A;  4J3M A;  4UVP A;  4BUF A;  5AL3 A;  3UA9 A;  3GOY A;  4AVW A;  5DCZ A;  4LI6 A;  5C5P A;  3L3M A;  4OQB C;  1PAX A;  5AEH A;  4PNT A;  4ZZZ A;  1UK0 A;  4AVU A;  4UI5 A;  4L0V A;  4UX4 A;  3KJD A;  4L7N A;  4GV7 A;  4XHU A;  4BU6 A;  5A00 A;  5FPF A;  4OPX C;  4PY4 A;  4BU7 A;  4PNS A;  1A26 A;  3SE2 A;  3UH4 A;  4UFU A;  4U6A A;  4BUD A;  5AKW A;  4IUE A;  4UW1 A;  4X52 A;  4J22 A;  4TVJ A;  4W5S A;  4W5I A;  4L7O A;  4HYF A;  4ZZY A;  3GN7 A;  4KRS A;  4PJV A;  4BUU A;  4UI3 A;  4UI4 A;  5LXP A;  4UVT A;  4BUX A;  4DVI A;  2RD6 A;  5AL1 A;  4PJT A;  4L7P A;  4BU3 A;  5ADS A;  4UVN A;  4HLH A;  1GS0 A;  4HLK A;  4DQY C;  4I9I A;  4L34 A;  4ZZX A;  4OQA C;  4UVL A;  4UVX A;  3C49 A;  4PNQ A;  3KR7 A;  3P0P A;  4HMH A;  4OA7 A;  4PNN A;  4L70 A;  4L0S A;  5LX6 A;  4L2G A;  2RCW A;  4L7L A;  5ECE A;  3U9H A;  4N3R A;  4F1Q A;  4RV6 A;  3KCZ A;  4HL5 A;  4BJC A;  4HHY A;  4MSK A;  4UVY A;  2PQF A;  4UVW A;  4TJW A;  4LI8 A;  4TK5 A;  1WOK A; 
#chains in the Genus database with same CATH topology
 5FH2 A;  4MSG A;  4J21 A;  5AKU A;  4RCG A;  1AYL A;  5C5Q A;  4L2F A;  4TJU A;  4UVU A;  5EBT A;  3L3L A;  4BUS A;  4UVS A;  2ZCI A;  4L2K A;  2RKA A;  4L7R A;  4GNO A;  4UXB A;  4N4T A;  4BUY A;  4UHG A;  3GJW A;  4L0I A;  4HLG A;  4GV4 A;  4TOS A;  4WIU A;  3DTB A;  4WPU A;  2PAW A;  3KR8 A;  4BUA A;  4GV0 A;  4J3L A;  3U9Y A;  2QF2 A;  3MOH A;  4HLM A;  5ADT A;  4UVV A;  4N4V A;  2OLQ A;  4UVO A;  4BU9 A;  4HKK A;  4MT9 A;  3FHB A;  4GV2 A;  4PNM A;  5ETY A;  4GMU A;  4KZL A;  3MHK A;  4L31 A;  3UH2 A;  2FAH A;  2X5Y A;  4R6E A;  3C4H A;  3P0N A;  5AL5 A;  4BUT A;  4K4E A;  4L6Z A;  4BU5 A;  4BUE A;  4LI7 A;  4M7B A;  1KHF A;  4GMZ A;  4J1Z A;  4L0B A;  4UI6 A;  1K3D A;  2RF5 A;  4OX2 A;  4R5W A;  4W6E A;  3P0Q A;  3SMI A;  4L10 A;  2PAX A;  1KHB A;  5ADQ A;  5LYH A;  4KZU A;  1UK1 A;  4YW9 A;  4UFY A;  3DT4 A;  4BJB A;  5C5R A;  5AL2 A;  4YW8 A;  1NHX A;  4UND A;  4KZQ A;  4F1L A;  4GNM A;  4BUW A;  4HHZ A;  4L09 A;  4WIE A;  4PML A;  4L0T A;  1J3B A;  5AL4 A;  4BFP A;  4BJ9 A;  4BUI A;  5LXP A;  4TK0 A;  3MOE A;  4HLF A;  4TKF A;  2PXZ X;  4TJY A;  4L7U A;  4K4F A;  4UUH A;  1KHE A;  1EFY A;  3CE0 A;  4PAX A;  4UVZ A;  4UI7 A;  4BS4 A;  2QZY A;  2RK7 A;  3GEY A;  1OS1 A;  2PC9 A;  4L33 A;  2RKD A;  5FPG A;  4TOR A;  4HKN A;  1YVY A;  4TKI A;  4L32 A;  4TKG A;  3HKV A;  4PNR A;  3PAX A;  4F0E A;  4GNQ A;  2GMV A;  3MHJ A;  3SMJ A;  4L6S A;  2RKE A;  4UI8 A;  3W51 A;  3BLJ A;  4PNL A;  3UDD A;  5ADR A;  4BUV A;  4BU8 A;  2RK8 A;  4HKI A;  4J3M A;  4UVP A;  4BUF A;  5AL3 A;  3UA9 A;  3GOY A;  4GNL A;  4AVW A;  4GMW A;  5DCZ A;  4LI6 A;  5C5P A;  3L3M A;  4OQB C;  1PAX A;  5AEH A;  4PNT A;  2QEY A;  4ZZZ A;  1UK0 A;  2QF1 A;  4UI5 A;  4L0V A;  4AVU A;  4UX4 A;  3KJD A;  4L7N A;  4GV7 A;  4XHU A;  1OEN A;  2OLR A;  2FAF A;  5A00 A;  4BU6 A;  5FPF A;  4OPX C;  1XKV A;  4PY4 A;  4BU7 A;  4PNS A;  1A26 A;  3SE2 A;  3UH4 A;  2QEW A;  1K3C A;  4UFU A;  4U6A A;  4BUD A;  5AKW A;  4IUE A;  4UW1 A;  4X52 A;  4J22 A;  4TVJ A;  5FH0 A;  4W5S A;  4W5I A;  5FH3 A;  4L7O A;  4HYF A;  5FH1 A;  4ZZY A;  3GN7 A;  4WPT A;  3DT2 A;  1YLH A;  4KRS A;  4PJV A;  4R43 A;  4UI3 A;  1M51 A;  4UI4 A;  4UVT A;  4BUU A;  4BUX A;  4DVI A;  2RD6 A;  5AL1 A;  5FH5 A;  4PJT A;  4L7P A;  1II2 A;  4WPV A;  4BU3 A;  5ADS A;  4YWD A;  4UVN A;  4WL8 A;  4HLH A;  3DT7 A;  1GS0 A;  4HLK A;  4DQY C;  1YGG A;  4I9I A;  4L34 A;  3MOF A;  4ZZX A;  4OQA C;  4UVL A;  4UVX A;  4YWB A;  3C49 A;  4PNQ A;  3KR7 A;  3P0P A;  4HMH A;  4OA7 A;  4PNN A;  2PY7 X;  4L70 A;  4L0S A;  5FH4 A;  5I67 A;  4GMM A;  4L2G A;  5LX6 A;  2RCW A;  4L7L A;  5ECE A;  1KHG A;  4N3R A;  3U9H A;  4F1Q A;  4WOU A;  1AQ2 A;  4RV6 A;  3KCZ A;  4HL5 A;  1YTM A;  4BJC A;  4GNP A;  4HHY A;  4MSK A;  4UVY A;  2PQF A;  4UVW A;  4TJW A;  4LI8 A;  4TK5 A;  1WOK A; 
#chains in the Genus database with same CATH homology
 5FH2 A;  4MSG A;  4J21 A;  5AKU A;  4RCG A;  1AYL A;  5C5Q A;  4L2F A;  4TJU A;  4UVU A;  5EBT A;  3L3L A;  4BUS A;  4UVS A;  2ZCI A;  4L2K A;  2RKA A;  4L7R A;  4GNO A;  4UXB A;  4N4T A;  4BUY A;  4UHG A;  3GJW A;  4L0I A;  4HLG A;  4GV4 A;  4TOS A;  4WIU A;  3DTB A;  4WPU A;  2PAW A;  3KR8 A;  4BUA A;  4GV0 A;  4J3L A;  3U9Y A;  2QF2 A;  3MOH A;  4HLM A;  5ADT A;  4UVV A;  4N4V A;  2OLQ A;  4UVO A;  4BU9 A;  4HKK A;  4MT9 A;  3FHB A;  4GV2 A;  4PNM A;  5ETY A;  4GMU A;  4KZL A;  3MHK A;  4L31 A;  3UH2 A;  2FAH A;  2X5Y A;  4R6E A;  3C4H A;  3P0N A;  5AL5 A;  4BUT A;  4K4E A;  4L6Z A;  4BU5 A;  4BUE A;  4LI7 A;  4M7B A;  1KHF A;  4GMZ A;  4J1Z A;  4L0B A;  4UI6 A;  1K3D A;  2RF5 A;  4OX2 A;  4R5W A;  4W6E A;  3P0Q A;  3SMI A;  4L10 A;  2PAX A;  1KHB A;  5ADQ A;  5LYH A;  4KZU A;  1UK1 A;  4YW9 A;  4UFY A;  3DT4 A;  4BJB A;  5C5R A;  5AL2 A;  4YW8 A;  1NHX A;  4UND A;  4KZQ A;  4F1L A;  4GNM A;  4BUW A;  4HHZ A;  4L09 A;  4WIE A;  4PML A;  4L0T A;  1J3B A;  5AL4 A;  4BFP A;  4BJ9 A;  4BUI A;  5LXP A;  4TK0 A;  3MOE A;  4HLF A;  4TKF A;  2PXZ X;  4TJY A;  4L7U A;  4K4F A;  4UUH A;  1KHE A;  1EFY A;  3CE0 A;  4PAX A;  4UVZ A;  4UI7 A;  4BS4 A;  2QZY A;  2RK7 A;  3GEY A;  1OS1 A;  2PC9 A;  4L33 A;  2RKD A;  5FPG A;  4TOR A;  4HKN A;  1YVY A;  4TKI A;  4L32 A;  4TKG A;  3HKV A;  4PNR A;  3PAX A;  4F0E A;  4GNQ A;  2GMV A;  3MHJ A;  3SMJ A;  4L6S A;  2RKE A;  4UI8 A;  3W51 A;  3BLJ A;  4PNL A;  3UDD A;  5ADR A;  4BUV A;  4BU8 A;  2RK8 A;  4HKI A;  4J3M A;  4UVP A;  4BUF A;  5AL3 A;  3UA9 A;  3GOY A;  4GNL A;  4AVW A;  4GMW A;  5DCZ A;  4LI6 A;  5C5P A;  3L3M A;  4OQB C;  1PAX A;  5AEH A;  4PNT A;  2QEY A;  4ZZZ A;  1UK0 A;  2QF1 A;  4UI5 A;  4L0V A;  4AVU A;  4UX4 A;  3KJD A;  4L7N A;  4GV7 A;  4XHU A;  1OEN A;  2OLR A;  2FAF A;  5A00 A;  4BU6 A;  5FPF A;  4OPX C;  1XKV A;  4PY4 A;  4BU7 A;  4PNS A;  1A26 A;  3SE2 A;  3UH4 A;  2QEW A;  1K3C A;  4UFU A;  4U6A A;  4BUD A;  5AKW A;  4IUE A;  4UW1 A;  4X52 A;  4J22 A;  4TVJ A;  5FH0 A;  4W5S A;  4W5I A;  5FH3 A;  4L7O A;  4HYF A;  5FH1 A;  4ZZY A;  3GN7 A;  4WPT A;  3DT2 A;  1YLH A;  4KRS A;  4PJV A;  4R43 A;  4UI3 A;  1M51 A;  4UI4 A;  4UVT A;  4BUU A;  4BUX A;  4DVI A;  2RD6 A;  5AL1 A;  5FH5 A;  4PJT A;  4L7P A;  1II2 A;  4WPV A;  4BU3 A;  5ADS A;  4YWD A;  4UVN A;  4WL8 A;  4HLH A;  3DT7 A;  1GS0 A;  4HLK A;  4DQY C;  1YGG A;  4I9I A;  4L34 A;  3MOF A;  4ZZX A;  4OQA C;  4UVL A;  4UVX A;  4YWB A;  3C49 A;  4PNQ A;  3KR7 A;  3P0P A;  4HMH A;  4OA7 A;  4PNN A;  2PY7 X;  4L70 A;  4L0S A;  5FH4 A;  5I67 A;  4GMM A;  4L2G A;  5LX6 A;  2RCW A;  4L7L A;  5ECE A;  1KHG A;  4N3R A;  3U9H A;  4F1Q A;  4WOU A;  1AQ2 A;  4RV6 A;  3KCZ A;  4HL5 A;  1YTM A;  4BJC A;  4GNP A;  4HHY A;  4MSK A;  4UVY A;  2PQF A;  4UVW A;  4TJW A;  4LI8 A;  4TK5 A;  1WOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...