4BU8A

Crystal structure of human tankyrase 2 in complex with 4-(4-oxo-1,4- dihydroquinazolin-2-yl)benzonitrile
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 68
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu8A00
4PNQA 4HHZA 5ADRA 4BU8A 4TK0A 3GN7A 4HLKA 4UVLA 4TK5A 4UI8A 3GEYA 4PNMA 4W5IA 4AVWA 4BUTA 4BUIA 4HLGA 4BUDA 4BUFA 4L0IA 4L7PA 5AKUA 4ZZYA 4L0BA 4PJTA 4TKIA 5AL5A 5AL3A 4F0EA 2PAXA 4BUEA 2PQFA 4BFPA 4UVPA 4BUUA 5ETYA 4N3RA 4TJUA 4F1QA 4MSGA 4BUVA 1WOKA 4L10A 4L6ZA 4L34A 4OQAC 4MT9A 3UH4A 5FPFA 4J3MA 4BJBA 4L09A 4MSKA 4X52A 4IUEA 1A26A 4L70A 3P0QA 3UDDA 2RCWA 4L7UA 5LXPA 4BJCA 3CE0A 1PAXA 4GV2A 4L7OA 4N4TA 4TORA 4DQYC 3KJDA 4BU5A 5AEHA 5ADQA 4OQBC 4LI6A 4GV4A 4L0SA 4UFUA 4DVIA 4LI8A 4PNSA 4UVTA 4PNNA 5LX6A 3UH2A 5ADTA 4UFYA 4L32A 4TJYA 4BS4A 4PNRA 4R5WA 4UW1A 4PMLA 4L33A 3P0NA 4GV0A 4HLHA 4L7LA 4L7NA 5AKWA 3U9HA 4UVZA 5C5PA 4GV7A 4BU3A 4UI6A 3PAXA 4HHYA 2RF5A 3KCZA 3UA9A 3MHKA 4UVNA 4BUWA 3SMJA 5C5RA 4I9IA 4K4FA 4PNTA 1EFYA 4BUYA 4UI3A 4TOSA 4LI7A 5C5QA 4HLMA 5LYHA 4BU7A 4OPXC 4L7RA 4M7BA 4L31A 1UK0A 4BU6A 4L2FA 4KRSA 4BUSA 3HKVA 4HL5A 4J21A 4R6EA 5AL1A 4ZZXA 4L0VA 4PJVA 4TKFA 3SE2A 4J1ZA 4PY4A 4UVUA 4U6AA 2PAWA 3W51A 3MHJA 3L3MA 4UVSA 4W5SA 4HKNA 4ZZZA 5FPGA 4UVVA 4J3LA 3BLJA 3GJWA 4UNDA 4BU9A 4HMHA 4UX4A 4UXBA 5AL4A 3U9YA 4PAXA 4BUAA 4AVUA 3L3LA 4TVJA 4W6EA 4L6SA 3C4HA 4HLFA 4HKIA 1UK1A 4PNLA 4UVWA 4OA7A 4F1LA 4HKKA 3C49A 4UVOA 4L0TA 4UI7A 4K4EA 4HYFA 4KZUA 4UUHA 5DCZA 4TJWA 4J22A 5ADSA 5EBTA 5ECEA 2RD6A 1GS0A 3GOYA 3P0PA 4KZQA 4UVYA 4BUXA 4N4VA 5A00A 4XHUA 4KZLA 4UI4A 3SMIA 4UHGA 3KR7A 4L2GA 4L2KA 3FHBA 4RV6A 4UI5A 2X5YA 4UVXA 5AL2A 4BJ9A 4TKGA 3KR8A
chains in the Genus database with same CATH superfamily
4GMUA 4PNQA 4HHZA 5ADRA 4BU8A 4TK0A 3GN7A 4HLKA 4UVLA 2QF1A 4TK5A 1KHGA 4UI8A 4GNLA 1NHXA 3GEYA 4PNMA 4W5IA 4AVWA 4BUTA 4BUIA 2OLQA 4HLGA 4BUDA 4GMZA 4BUFA 4YWDA 4WPVA 4L0IA 4L7PA 4WOUA 5AKUA 4WPUA 4ZZYA 4GNOA 4L0BA 4PJTA 2ZCIA 4TKIA 4RCGA 5AL5A 5AL3A 4F0EA 2PAXA 3MOFA 1KHEA 4BUEA 2PQFA 2FAFA 2QEWA 4UVPA 5ETYA 4BFPA 4N3RA 3MOHA 4TJUA 4BUUA 4YW9A 4F1QA 1YTMA 4MSGA 4BUVA 1WOKA 3DT7A 4L10A 4L6ZA 2QEYA 4L34A 2PC9A 5FH5A 4OQAC 4MT9A 3UH4A 5FPFA 4J3MA 4BJBA 4L09A 5FH1A 2PXZX 4MSKA 4X52A 4IUEA 5I67A 1A26A 4YWBA 4L70A 3P0QA 3UDDA 2RCWA 4L7UA 5LXPA 4BJCA 3CE0A 1PAXA 4GV2A 4L7OA 4N4TA 4TORA 4DQYC 3KJDA 4BU5A 4GNMA 5AEHA 5ADQA 4OQBC 4LI6A 4GV4A 4L0SA 4UFUA 1AQ2A 1OS1A 4YW8A 4DVIA 4LI8A 4PNSA 4UVTA 4PNNA 5LX6A 3UH2A 5ADTA 4UFYA 4L32A 4TJYA 4WIEA 3DT4A 4PNRA 4BS4A 4R5WA 4UW1A 4PMLA 4L33A 3P0NA 2RKDA 2RK8A 4GV0A 4HLHA 4L7LA 4L7NA 4UVZA 4WL8A 4GV7A 5C5PA 4BU3A 4UI6A 3PAXA 2RKAA 2RF5A 4HHYA 3KCZA 3UA9A 3MHKA 4UVNA 5FH2A 4BUWA 1YGGA 3SMJA 5C5RA 4I9IA 4K4FA 4PNTA 2OLRA 5FH0A 1EFYA 5AKWA 4BUYA 4UI3A 1M51A 4TOSA 4LI7A 5C5QA 5FH4A 4HLMA 4OX2A 5LYHA 4BU7A 4OPXC 4L7RA 4WIUA 4M7BA 2RKEA 1KHFA 1UK0A 4L31A 4BU6A 4L2FA 4KRSA 4BUSA 3DTBA 3HKVA 1K3CA 4HL5A 4J21A 4R6EA 5AL1A 4ZZXA 4GNPA 4L0VA 4PJVA 4TKFA 4J1ZA 2QZYA 3SE2A 4PY4A 4UVUA 1AYLA 2GMVA 4U6AA 2PAWA 3W51A 1YLHA 3L3MA 3MHJA 4GNQA 4HKNA 4R43A 4UVSA 4W5SA 4ZZZA 5FPGA 1YVYA 4GMWA 4J3LA 4UVVA 3U9HA 3BLJA 3GJWA 4UNDA 2PY7X 4HMHA 4BU9A 3DT2A 4UX4A 4UXBA 1OENA 5AL4A 3U9YA 4PAXA 4BUAA 1K3DA 3L3LA 4TVJA 4W6EA 1II2A 4AVUA 4L6SA 2RK7A 5FH3A 3C4HA 4HLFA 4GMMA 4HKIA 1UK1A 4PNLA 4UVWA 4OA7A 1J3BA 4WPTA 4HKKA 2FAHA 3C49A 4F1LA 4UVOA 4L0TA 4UI7A 1KHBA 4K4EA 4HYFA 4KZUA 4UUHA 5DCZA 4TJWA 4J22A 5ADSA 3MOEA 5EBTA 5ECEA 2RD6A 1GS0A 3GOYA 3P0PA 1XKVA 4KZQA 4UVYA 4N4VA 4BUXA 5A00A 4XHUA 4KZLA 4UI4A 3SMIA 4UHGA 3KR7A 4L2GA 2QF2A 4L2KA 3FHBA 4RV6A 4UI5A 2X5YA 4UVXA 5AL2A 4BJ9A 4TKGA 3KR8A
chains in the Genus database with same CATH topology
4GMUA 4PNQA 4HHZA 5ADRA 4BU8A 4TK0A 3GN7A 4HLKA 4UVLA 2QF1A 4TK5A 1KHGA 4UI8A 4GNLA 1NHXA 3GEYA 4PNMA 4W5IA 4AVWA 4BUTA 4BUIA 2OLQA 4HLGA 4BUDA 4GMZA 4BUFA 4YWDA 4WPVA 4L0IA 4L7PA 4WOUA 5AKUA 4WPUA 4ZZYA 4GNOA 4L0BA 4PJTA 2ZCIA 4TKIA 4RCGA 5AL5A 5AL3A 4F0EA 2PAXA 3MOFA 1KHEA 4BUEA 2PQFA 2FAFA 2QEWA 4UVPA 5ETYA 4BFPA 4N3RA 3MOHA 4TJUA 4BUUA 4YW9A 4F1QA 1YTMA 4MSGA 4BUVA 1WOKA 3DT7A 4L10A 4L6ZA 2QEYA 4L34A 2PC9A 5FH5A 4OQAC 4MT9A 3UH4A 5FPFA 4J3MA 4BJBA 4L09A 5FH1A 2PXZX 4MSKA 4X52A 4IUEA 5I67A 1A26A 4YWBA 4L70A 3P0QA 3UDDA 2RCWA 4L7UA 5LXPA 4BJCA 3CE0A 1PAXA 4GV2A 4L7OA 4N4TA 4TORA 4DQYC 3KJDA 4BU5A 4GNMA 5AEHA 5ADQA 4OQBC 4LI6A 4GV4A 4L0SA 4UFUA 1AQ2A 1OS1A 4YW8A 4DVIA 4LI8A 4PNSA 4UVTA 4PNNA 5LX6A 3UH2A 5ADTA 4UFYA 4L32A 4TJYA 4WIEA 3DT4A 4PNRA 4BS4A 4R5WA 4UW1A 4PMLA 4L33A 3P0NA 2RKDA 2RK8A 4GV0A 4HLHA 4L7LA 4L7NA 4UVZA 4WL8A 4GV7A 5C5PA 4BU3A 4UI6A 3PAXA 2RKAA 2RF5A 4HHYA 3KCZA 3UA9A 3MHKA 4UVNA 5FH2A 4BUWA 1YGGA 3SMJA 5C5RA 4I9IA 4K4FA 4PNTA 2OLRA 5FH0A 1EFYA 5AKWA 4BUYA 4UI3A 1M51A 4TOSA 4LI7A 5C5QA 5FH4A 4HLMA 4OX2A 5LYHA 4BU7A 4OPXC 4L7RA 4WIUA 4M7BA 2RKEA 1KHFA 1UK0A 4L31A 4BU6A 4L2FA 4KRSA 4BUSA 3DTBA 3HKVA 1K3CA 4HL5A 4J21A 4R6EA 5AL1A 4ZZXA 4GNPA 4L0VA 4PJVA 4TKFA 4J1ZA 2QZYA 3SE2A 4PY4A 4UVUA 1AYLA 2GMVA 4U6AA 2PAWA 3W51A 1YLHA 3L3MA 3MHJA 4GNQA 4HKNA 4R43A 4UVSA 4W5SA 4ZZZA 5FPGA 1YVYA 4GMWA 4J3LA 4UVVA 3U9HA 3BLJA 3GJWA 4UNDA 2PY7X 4HMHA 4BU9A 3DT2A 4UX4A 4UXBA 1OENA 5AL4A 3U9YA 4PAXA 4BUAA 1K3DA 3L3LA 4TVJA 4W6EA 1II2A 4AVUA 4L6SA 2RK7A 5FH3A 3C4HA 4HLFA 4GMMA 4HKIA 1UK1A 4PNLA 4UVWA 4OA7A 1J3BA 4WPTA 4HKKA 2FAHA 3C49A 4F1LA 4UVOA 4L0TA 4UI7A 1KHBA 4K4EA 4HYFA 4KZUA 4UUHA 5DCZA 4TJWA 4J22A 5ADSA 3MOEA 5EBTA 5ECEA 2RD6A 1GS0A 3GOYA 3P0PA 1XKVA 4KZQA 4UVYA 4N4VA 4BUXA 5A00A 4XHUA 4KZLA 4UI4A 3SMIA 4UHGA 3KR7A 4L2GA 2QF2A 4L2KA 3FHBA 4RV6A 4UI5A 2X5YA 4UVXA 5AL2A 4BJ9A 4TKGA 3KR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNQ A;  4HHZ A;  5ADR A;  4BU8 A;  4TK0 A;  3GN7 A;  4HLK A;  4UVL A;  4TK5 A;  4UI8 A;  3GEY A;  4PNM A;  4W5I A;  4AVW A;  4BUT A;  4BUI A;  4HLG A;  4BUD A;  4BUF A;  4L0I A;  4L7P A;  5AKU A;  4ZZY A;  4L0B A;  4PJT A;  4TKI A;  5AL5 A;  5AL3 A;  4F0E A;  2PAX A;  4BUE A;  2PQF A;  4BFP A;  4UVP A;  4BUU A;  5ETY A;  4N3R A;  4TJU A;  4F1Q A;  4MSG A;  4BUV A;  1WOK A;  4L10 A;  4L6Z A;  4L34 A;  4OQA C;  4MT9 A;  3UH4 A;  5FPF A;  4J3M A;  4BJB A;  4L09 A;  4MSK A;  4X52 A;  4IUE A;  1A26 A;  4L70 A;  3P0Q A;  3UDD A;  2RCW A;  4L7U A;  5LXP A;  4BJC A;  3CE0 A;  1PAX A;  4GV2 A;  4L7O A;  4N4T A;  4TOR A;  4DQY C;  3KJD A;  4BU5 A;  5AEH A;  5ADQ A;  4OQB C;  4LI6 A;  4GV4 A;  4L0S A;  4UFU A;  4DVI A;  4LI8 A;  4PNS A;  4UVT A;  4PNN A;  5LX6 A;  3UH2 A;  5ADT A;  4UFY A;  4L32 A;  4TJY A;  4BS4 A;  4PNR A;  4R5W A;  4UW1 A;  4PML A;  4L33 A;  3P0N A;  4GV0 A;  4HLH A;  4L7L A;  4L7N A;  5AKW A;  3U9H A;  4UVZ A;  5C5P A;  4GV7 A;  4BU3 A;  4UI6 A;  3PAX A;  4HHY A;  2RF5 A;  3KCZ A;  3UA9 A;  3MHK A;  4UVN A;  4BUW A;  3SMJ A;  5C5R A;  4I9I A;  4K4F A;  4PNT A;  1EFY A;  4BUY A;  4UI3 A;  4TOS A;  4LI7 A;  5C5Q A;  4HLM A;  5LYH A;  4BU7 A;  4OPX C;  4L7R A;  4M7B A;  4L31 A;  1UK0 A;  4BU6 A;  4L2F A;  4KRS A;  4BUS A;  3HKV A;  4HL5 A;  4J21 A;  4R6E A;  5AL1 A;  4ZZX A;  4L0V A;  4PJV A;  4TKF A;  3SE2 A;  4J1Z A;  4PY4 A;  4UVU A;  4U6A A;  2PAW A;  3W51 A;  3MHJ A;  3L3M A;  4UVS A;  4W5S A;  4HKN A;  4ZZZ A;  5FPG A;  4UVV A;  4J3L A;  3BLJ A;  3GJW A;  4UND A;  4BU9 A;  4HMH A;  4UX4 A;  4UXB A;  5AL4 A;  3U9Y A;  4PAX A;  4BUA A;  4AVU A;  3L3L A;  4TVJ A;  4W6E A;  4L6S A;  3C4H A;  4HLF A;  4HKI A;  1UK1 A;  4PNL A;  4UVW A;  4OA7 A;  4F1L A;  4HKK A;  3C49 A;  4UVO A;  4L0T A;  4UI7 A;  4K4E A;  4HYF A;  4KZU A;  4UUH A;  5DCZ A;  4TJW A;  4J22 A;  5ADS A;  5EBT A;  5ECE A;  2RD6 A;  1GS0 A;  3GOY A;  3P0P A;  4KZQ A;  4UVY A;  4BUX A;  4N4V A;  5A00 A;  4XHU A;  4KZL A;  4UI4 A;  3SMI A;  4UHG A;  3KR7 A;  4L2G A;  4L2K A;  3FHB A;  4RV6 A;  4UI5 A;  2X5Y A;  4UVX A;  5AL2 A;  4BJ9 A;  4TKG A;  3KR8 A; 
#chains in the Genus database with same CATH topology
 4GMU A;  4PNQ A;  4HHZ A;  5ADR A;  4BU8 A;  4TK0 A;  3GN7 A;  4HLK A;  4UVL A;  2QF1 A;  4TK5 A;  1KHG A;  4UI8 A;  4GNL A;  1NHX A;  3GEY A;  4PNM A;  4W5I A;  4AVW A;  4BUT A;  4BUI A;  2OLQ A;  4HLG A;  4BUD A;  4GMZ A;  4BUF A;  4YWD A;  4WPV A;  4L0I A;  4L7P A;  4WOU A;  5AKU A;  4WPU A;  4ZZY A;  4GNO A;  4L0B A;  4PJT A;  2ZCI A;  4TKI A;  4RCG A;  5AL5 A;  5AL3 A;  4F0E A;  2PAX A;  3MOF A;  1KHE A;  4BUE A;  2PQF A;  2FAF A;  2QEW A;  4UVP A;  5ETY A;  4BFP A;  4N3R A;  3MOH A;  4TJU A;  4BUU A;  4YW9 A;  4F1Q A;  1YTM A;  4MSG A;  4BUV A;  1WOK A;  3DT7 A;  4L10 A;  4L6Z A;  2QEY A;  4L34 A;  2PC9 A;  5FH5 A;  4OQA C;  4MT9 A;  3UH4 A;  5FPF A;  4J3M A;  4BJB A;  4L09 A;  5FH1 A;  2PXZ X;  4MSK A;  4X52 A;  4IUE A;  5I67 A;  1A26 A;  4YWB A;  4L70 A;  3P0Q A;  3UDD A;  2RCW A;  4L7U A;  5LXP A;  4BJC A;  3CE0 A;  1PAX A;  4GV2 A;  4L7O A;  4N4T A;  4TOR A;  4DQY C;  3KJD A;  4BU5 A;  4GNM A;  5AEH A;  5ADQ A;  4OQB C;  4LI6 A;  4GV4 A;  4L0S A;  4UFU A;  1AQ2 A;  1OS1 A;  4YW8 A;  4DVI A;  4LI8 A;  4PNS A;  4UVT A;  4PNN A;  5LX6 A;  3UH2 A;  5ADT A;  4UFY A;  4L32 A;  4TJY A;  4WIE A;  3DT4 A;  4PNR A;  4BS4 A;  4R5W A;  4UW1 A;  4PML A;  4L33 A;  3P0N A;  2RKD A;  2RK8 A;  4GV0 A;  4HLH A;  4L7L A;  4L7N A;  4UVZ A;  4WL8 A;  4GV7 A;  5C5P A;  4BU3 A;  4UI6 A;  3PAX A;  2RKA A;  2RF5 A;  4HHY A;  3KCZ A;  3UA9 A;  3MHK A;  4UVN A;  5FH2 A;  4BUW A;  1YGG A;  3SMJ A;  5C5R A;  4I9I A;  4K4F A;  4PNT A;  2OLR A;  5FH0 A;  1EFY A;  5AKW A;  4BUY A;  4UI3 A;  1M51 A;  4TOS A;  4LI7 A;  5C5Q A;  5FH4 A;  4HLM A;  4OX2 A;  5LYH A;  4BU7 A;  4OPX C;  4L7R A;  4WIU A;  4M7B A;  2RKE A;  1KHF A;  1UK0 A;  4L31 A;  4BU6 A;  4L2F A;  4KRS A;  4BUS A;  3DTB A;  3HKV A;  1K3C A;  4HL5 A;  4J21 A;  4R6E A;  5AL1 A;  4ZZX A;  4GNP A;  4L0V A;  4PJV A;  4TKF A;  4J1Z A;  2QZY A;  3SE2 A;  4PY4 A;  4UVU A;  1AYL A;  2GMV A;  4U6A A;  2PAW A;  3W51 A;  1YLH A;  3L3M A;  3MHJ A;  4GNQ A;  4HKN A;  4R43 A;  4UVS A;  4W5S A;  4ZZZ A;  5FPG A;  1YVY A;  4GMW A;  4J3L A;  4UVV A;  3U9H A;  3BLJ A;  3GJW A;  4UND A;  2PY7 X;  4HMH A;  4BU9 A;  3DT2 A;  4UX4 A;  4UXB A;  1OEN A;  5AL4 A;  3U9Y A;  4PAX A;  4BUA A;  1K3D A;  3L3L A;  4TVJ A;  4W6E A;  1II2 A;  4AVU A;  4L6S A;  2RK7 A;  5FH3 A;  3C4H A;  4HLF A;  4GMM A;  4HKI A;  1UK1 A;  4PNL A;  4UVW A;  4OA7 A;  1J3B A;  4WPT A;  4HKK A;  2FAH A;  3C49 A;  4F1L A;  4UVO A;  4L0T A;  4UI7 A;  1KHB A;  4K4E A;  4HYF A;  4KZU A;  4UUH A;  5DCZ A;  4TJW A;  4J22 A;  5ADS A;  3MOE A;  5EBT A;  5ECE A;  2RD6 A;  1GS0 A;  3GOY A;  3P0P A;  1XKV A;  4KZQ A;  4UVY A;  4N4V A;  4BUX A;  5A00 A;  4XHU A;  4KZL A;  4UI4 A;  3SMI A;  4UHG A;  3KR7 A;  4L2G A;  2QF2 A;  4L2K A;  3FHB A;  4RV6 A;  4UI5 A;  2X5Y A;  4UVX A;  5AL2 A;  4BJ9 A;  4TKG A;  3KR8 A; 
#chains in the Genus database with same CATH homology
 4GMU A;  4PNQ A;  4HHZ A;  5ADR A;  4BU8 A;  4TK0 A;  3GN7 A;  4HLK A;  4UVL A;  2QF1 A;  4TK5 A;  1KHG A;  4UI8 A;  4GNL A;  1NHX A;  3GEY A;  4PNM A;  4W5I A;  4AVW A;  4BUT A;  4BUI A;  2OLQ A;  4HLG A;  4BUD A;  4GMZ A;  4BUF A;  4YWD A;  4WPV A;  4L0I A;  4L7P A;  4WOU A;  5AKU A;  4WPU A;  4ZZY A;  4GNO A;  4L0B A;  4PJT A;  2ZCI A;  4TKI A;  4RCG A;  5AL5 A;  5AL3 A;  4F0E A;  2PAX A;  3MOF A;  1KHE A;  4BUE A;  2PQF A;  2FAF A;  2QEW A;  4UVP A;  5ETY A;  4BFP A;  4N3R A;  3MOH A;  4TJU A;  4BUU A;  4YW9 A;  4F1Q A;  1YTM A;  4MSG A;  4BUV A;  1WOK A;  3DT7 A;  4L10 A;  4L6Z A;  2QEY A;  4L34 A;  2PC9 A;  5FH5 A;  4OQA C;  4MT9 A;  3UH4 A;  5FPF A;  4J3M A;  4BJB A;  4L09 A;  5FH1 A;  2PXZ X;  4MSK A;  4X52 A;  4IUE A;  5I67 A;  1A26 A;  4YWB A;  4L70 A;  3P0Q A;  3UDD A;  2RCW A;  4L7U A;  5LXP A;  4BJC A;  3CE0 A;  1PAX A;  4GV2 A;  4L7O A;  4N4T A;  4TOR A;  4DQY C;  3KJD A;  4BU5 A;  4GNM A;  5AEH A;  5ADQ A;  4OQB C;  4LI6 A;  4GV4 A;  4L0S A;  4UFU A;  1AQ2 A;  1OS1 A;  4YW8 A;  4DVI A;  4LI8 A;  4PNS A;  4UVT A;  4PNN A;  5LX6 A;  3UH2 A;  5ADT A;  4UFY A;  4L32 A;  4TJY A;  4WIE A;  3DT4 A;  4PNR A;  4BS4 A;  4R5W A;  4UW1 A;  4PML A;  4L33 A;  3P0N A;  2RKD A;  2RK8 A;  4GV0 A;  4HLH A;  4L7L A;  4L7N A;  4UVZ A;  4WL8 A;  4GV7 A;  5C5P A;  4BU3 A;  4UI6 A;  3PAX A;  2RKA A;  2RF5 A;  4HHY A;  3KCZ A;  3UA9 A;  3MHK A;  4UVN A;  5FH2 A;  4BUW A;  1YGG A;  3SMJ A;  5C5R A;  4I9I A;  4K4F A;  4PNT A;  2OLR A;  5FH0 A;  1EFY A;  5AKW A;  4BUY A;  4UI3 A;  1M51 A;  4TOS A;  4LI7 A;  5C5Q A;  5FH4 A;  4HLM A;  4OX2 A;  5LYH A;  4BU7 A;  4OPX C;  4L7R A;  4WIU A;  4M7B A;  2RKE A;  1KHF A;  1UK0 A;  4L31 A;  4BU6 A;  4L2F A;  4KRS A;  4BUS A;  3DTB A;  3HKV A;  1K3C A;  4HL5 A;  4J21 A;  4R6E A;  5AL1 A;  4ZZX A;  4GNP A;  4L0V A;  4PJV A;  4TKF A;  4J1Z A;  2QZY A;  3SE2 A;  4PY4 A;  4UVU A;  1AYL A;  2GMV A;  4U6A A;  2PAW A;  3W51 A;  1YLH A;  3L3M A;  3MHJ A;  4GNQ A;  4HKN A;  4R43 A;  4UVS A;  4W5S A;  4ZZZ A;  5FPG A;  1YVY A;  4GMW A;  4J3L A;  4UVV A;  3U9H A;  3BLJ A;  3GJW A;  4UND A;  2PY7 X;  4HMH A;  4BU9 A;  3DT2 A;  4UX4 A;  4UXB A;  1OEN A;  5AL4 A;  3U9Y A;  4PAX A;  4BUA A;  1K3D A;  3L3L A;  4TVJ A;  4W6E A;  1II2 A;  4AVU A;  4L6S A;  2RK7 A;  5FH3 A;  3C4H A;  4HLF A;  4GMM A;  4HKI A;  1UK1 A;  4PNL A;  4UVW A;  4OA7 A;  1J3B A;  4WPT A;  4HKK A;  2FAH A;  3C49 A;  4F1L A;  4UVO A;  4L0T A;  4UI7 A;  1KHB A;  4K4E A;  4HYF A;  4KZU A;  4UUH A;  5DCZ A;  4TJW A;  4J22 A;  5ADS A;  3MOE A;  5EBT A;  5ECE A;  2RD6 A;  1GS0 A;  3GOY A;  3P0P A;  1XKV A;  4KZQ A;  4UVY A;  4N4V A;  4BUX A;  5A00 A;  4XHU A;  4KZL A;  4UI4 A;  3SMI A;  4UHG A;  3KR7 A;  4L2G A;  2QF2 A;  4L2K A;  3FHB A;  4RV6 A;  4UI5 A;  2X5Y A;  4UVX A;  5AL2 A;  4BJ9 A;  4TKG A;  3KR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...