4BU8A

Crystal structure of human tankyrase 2 in complex with 4-(4-oxo-1,4- dihydroquinazolin-2-yl)benzonitrile
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu8A00
5AEHA 4L7LA 5AL2A 3SMIA 4PNMA 4J21A 2RF5A 4HLFA 4L0BA 1WOKA 4BUWA 4UVTA 4R5WA 4UVLA 5C5PA 4L0VA 5C5RA 3KR7A 4TJWA 4PNNA 4TORA 4MSKA 5A00A 4L2GA 4X52A 4UFYA 4TK0A 4L6SA 4L70A 3KCZA 3KJDA 4GV7A 4L09A 4L6ZA 4TKGA 4UVZA 5ETYA 4BU5A 3GN7A 4MT9A 1A26A 4UXBA 4BUSA 3PAXA 4BU6A 3BLJA 4L34A 4PMLA 4BS4A 4BJ9A 4TKIA 4DQYC 3FHBA 4HHYA 4HLMA 4PJVA 2PQFA 4HHZA 4UI5A 4HLGA 3GOYA 4BUEA 3U9YA 3W51A 3UA9A 4RV6A 4L7RA 4BU8A 4HLHA 4BJBA 3SE2A 4UW1A 4PY4A 4J3MA 4L33A 4AVWA 4LI8A 4U6AA 5LYHA 4UVPA 5AKWA 4N4VA 4PNRA 4J22A 5ADRA 4UFUA 4TJUA 1UK0A 4UI7A 5AL4A 3GJWA 4PNQA 3SMJA 4HL5A 4L2FA 4ZZXA 4KZUA 4L0TA 4N4TA 4GV4A 4L7NA 4L2KA 4M7BA 5LXPA 4HYFA 5ECEA 4TOSA 4L31A 4W6EA 4TKFA 4OQAC 4BUFA 4BUDA 4BJCA 4UHGA 4PNSA 4PJTA 4F1QA 4HKNA 4K4EA 4BU9A 4L0SA 4LI7A 3CE0A 4KRSA 4OQBC 1EFYA 4UVXA 4BUTA 4BUAA 4AVUA 4K4FA 4UVSA 4UI3A 5ADQA 4MSGA 4OA7A 3KR8A 3P0PA 4GV2A 4BUXA 5LX6A 1PAXA 3MHJA 4BFPA 3GEYA 3C4HA 2RCWA 4TK5A 4UX4A 4I9IA 4N3RA 4UI6A 4UVVA 3HKVA 5C5QA 5AKUA 4UI8A 5AL3A 4BU7A 3UH4A 4BUVA 5FPFA 3L3LA 4UVYA 4F0EA 4F1LA 4BU3A 4OPXC 4TVJA 4HKKA 1GS0A 4L7OA 4UUHA 2RD6A 4UVWA 4UNDA 3P0QA 4BUIA 4LI6A 2X5YA 3UH2A 3P0NA 4ZZZA 4ZZYA 4L10A 3C49A 4J3LA 5FPGA 3L3MA 4PNTA 4L7PA 4PNLA 2PAWA 5EBTA 5DCZA 4L32A 5ADSA 3U9HA 4HKIA 4DVIA 2PAXA 4UVNA 4IUEA 4W5SA 4UVUA 4BUUA 4GV0A 4L0IA 5AL5A 4UI4A 3MHKA 5ADTA 4TJYA 1UK1A 4KZLA 4HLKA 4XHUA 4L7UA 4HMHA 4UVOA 4BUYA 4R6EA 4PAXA 3UDDA 4W5IA 4J1ZA 4KZQA 5AL1A
chains in the Genus database with same CATH superfamily
5AEHA 2OLRA 4L7LA 5AL2A 3SMIA 4PNMA 4J21A 2RF5A 4GMMA 4HLFA 4L0BA 1II2A 5FH3A 1YGGA 1WOKA 4BUWA 4UVTA 4R5WA 1M51A 4UVLA 5C5PA 4L0VA 5C5RA 3KR7A 4TJWA 4PNNA 4TORA 4MSKA 5A00A 4L2GA 1J3BA 4UFYA 4X52A 4L6SA 4TK0A 4WPUA 4L70A 3KCZA 3KJDA 4GV7A 4L09A 4L6ZA 4TKGA 1OS1A 4UVZA 4WPVA 3GN7A 5ETYA 4BU5A 4MT9A 1A26A 4UXBA 4BUSA 3PAXA 4GNPA 4R43A 4BU6A 4WIEA 3BLJA 4L34A 4PMLA 4BS4A 2PY7X 4TKIA 4YW8A 4BJ9A 4DQYC 3FHBA 4HHYA 4HLMA 2QZYA 2PQFA 4HHZA 1OENA 2QF2A 4PJVA 4UI5A 4HLGA 3GOYA 2RKDA 4BUEA 2FAHA 3U9YA 3W51A 3UA9A 4BU8A 4RV6A 4L7RA 4GMWA 4YWBA 2FAFA 4HLHA 4BJBA 1YLHA 2PXZX 2QEWA 4UW1A 4PY4A 3SE2A 4J3MA 4L33A 4AVWA 4LI8A 4U6AA 5LYHA 4UVPA 5AKWA 4N4VA 4PNRA 2QF1A 4J22A 5ADRA 4UFUA 4TJUA 1UK0A 4UI7A 4GNOA 4OX2A 3GJWA 5AL4A 4YW9A 5I67A 4PNQA 3SMJA 1KHEA 1YVYA 2RKAA 4HL5A 4L2FA 4ZZXA 4KZUA 4L0TA 4GNMA 4N4TA 4GV4A 4L7NA 4L2KA 4M7BA 4GNLA 4HYFA 4WOUA 4RCGA 5ECEA 5LXPA 3DT2A 4TOSA 1K3DA 3DT4A 4L31A 4W6EA 1XKVA 4TKFA 4YWDA 4BUFA 4OQAC 4BUDA 1KHFA 4BJCA 4UHGA 3MOEA 4PNSA 2RK7A 4PJTA 4F1QA 4HKNA 4K4EA 4BU9A 4L0SA 4LI7A 3CE0A 4KRSA 4OQBC 1EFYA 4WL8A 4UVXA 4BUTA 4BUAA 1K3CA 4AVUA 4K4FA 4UVSA 3DT7A 4UI3A 4MSGA 4OA7A 3KR8A 3P0PA 4GV2A 4BUXA 5ADQA 5LX6A 1PAXA 3MHJA 4GMUA 4BFPA 2PC9A 3GEYA 3C4HA 2RCWA 5FH0A 3MOHA 4TK5A 4UX4A 4I9IA 4N3RA 4UI6A 5FH1A 1AQ2A 4UVVA 3HKVA 5C5QA 5AKUA 2RK8A 4UI8A 5AL3A 2OLQA 3UH4A 4BU7A 4BUVA 5FPFA 3L3LA 4UVYA 4F0EA 5FH2A 4F1LA 4BU3A 4OPXC 4TVJA 4HKKA 1NHXA 1GS0A 5FH4A 4L7OA 4UUHA 2RD6A 4UVWA 4UNDA 1KHGA 3P0QA 4GNQA 4BUIA 5FH5A 4LI6A 1YTMA 2X5YA 3MOFA 3UH2A 2RKEA 3P0NA 2GMVA 4WPTA 4ZZYA 4ZZZA 4L10A 3C49A 4J3LA 5FPGA 3L3MA 4PNTA 4L7PA 4PNLA 2PAWA 5EBTA 2QEYA 1AYLA 5DCZA 4L32A 5ADSA 3U9HA 4HKIA 4WIUA 1KHBA 2PAXA 4DVIA 4UVNA 4IUEA 4W5SA 2ZCIA 4UVUA 4BUUA 4GV0A 4L0IA 5AL5A 4UI4A 3MHKA 5ADTA 4TJYA 1UK1A 3DTBA 4KZLA 4HLKA 4XHUA 4GMZA 4L7UA 4HMHA 4UVOA 4BUYA 4R6EA 4PAXA 3UDDA 4W5IA 4J1ZA 4KZQA 5AL1A
chains in the Genus database with same CATH topology
5AEHA 2OLRA 4L7LA 5AL2A 3SMIA 4PNMA 4J21A 2RF5A 4GMMA 4HLFA 4L0BA 1II2A 5FH3A 1YGGA 1WOKA 4BUWA 4UVTA 4R5WA 1M51A 4UVLA 5C5PA 4L0VA 5C5RA 3KR7A 4TJWA 4PNNA 4TORA 4MSKA 5A00A 4L2GA 1J3BA 4UFYA 4X52A 4L6SA 4TK0A 4WPUA 4L70A 3KCZA 3KJDA 4GV7A 4L09A 4L6ZA 4TKGA 1OS1A 4UVZA 4WPVA 3GN7A 5ETYA 4BU5A 4MT9A 1A26A 4UXBA 4BUSA 3PAXA 4GNPA 4R43A 4BU6A 4WIEA 3BLJA 4L34A 4PMLA 4BS4A 2PY7X 4TKIA 4YW8A 4BJ9A 4DQYC 3FHBA 4HHYA 4HLMA 2QZYA 2PQFA 4HHZA 1OENA 2QF2A 4PJVA 4UI5A 4HLGA 3GOYA 2RKDA 4BUEA 2FAHA 3U9YA 3W51A 3UA9A 4BU8A 4RV6A 4L7RA 4GMWA 4YWBA 2FAFA 4HLHA 4BJBA 1YLHA 2PXZX 2QEWA 4UW1A 4PY4A 3SE2A 4J3MA 4L33A 4AVWA 4LI8A 4U6AA 5LYHA 4UVPA 5AKWA 4N4VA 4PNRA 2QF1A 4J22A 5ADRA 4UFUA 4TJUA 1UK0A 4UI7A 4GNOA 4OX2A 3GJWA 5AL4A 4YW9A 5I67A 4PNQA 3SMJA 1KHEA 1YVYA 2RKAA 4HL5A 4L2FA 4ZZXA 4KZUA 4L0TA 4GNMA 4N4TA 4GV4A 4L7NA 4L2KA 4M7BA 4GNLA 4HYFA 4WOUA 4RCGA 5ECEA 5LXPA 3DT2A 4TOSA 1K3DA 3DT4A 4L31A 4W6EA 1XKVA 4TKFA 4YWDA 4BUFA 4OQAC 4BUDA 1KHFA 4BJCA 4UHGA 3MOEA 4PNSA 2RK7A 4PJTA 4F1QA 4HKNA 4K4EA 4BU9A 4L0SA 4LI7A 3CE0A 4KRSA 4OQBC 1EFYA 4WL8A 4UVXA 4BUTA 4BUAA 1K3CA 4AVUA 4K4FA 4UVSA 3DT7A 4UI3A 4MSGA 4OA7A 3KR8A 3P0PA 4GV2A 4BUXA 5ADQA 5LX6A 1PAXA 3MHJA 4GMUA 4BFPA 2PC9A 3GEYA 3C4HA 2RCWA 5FH0A 3MOHA 4TK5A 4UX4A 4I9IA 4N3RA 4UI6A 5FH1A 1AQ2A 4UVVA 3HKVA 5C5QA 5AKUA 2RK8A 4UI8A 5AL3A 2OLQA 3UH4A 4BU7A 4BUVA 5FPFA 3L3LA 4UVYA 4F0EA 5FH2A 4F1LA 4BU3A 4OPXC 4TVJA 4HKKA 1NHXA 1GS0A 5FH4A 4L7OA 4UUHA 2RD6A 4UVWA 4UNDA 1KHGA 3P0QA 4GNQA 4BUIA 5FH5A 4LI6A 1YTMA 2X5YA 3MOFA 3UH2A 2RKEA 3P0NA 2GMVA 4WPTA 4ZZYA 4ZZZA 4L10A 3C49A 4J3LA 5FPGA 3L3MA 4PNTA 4L7PA 4PNLA 2PAWA 5EBTA 2QEYA 1AYLA 5DCZA 4L32A 5ADSA 3U9HA 4HKIA 4WIUA 1KHBA 2PAXA 4DVIA 4UVNA 4IUEA 4W5SA 2ZCIA 4UVUA 4BUUA 4GV0A 4L0IA 5AL5A 4UI4A 3MHKA 5ADTA 4TJYA 1UK1A 3DTBA 4KZLA 4HLKA 4XHUA 4GMZA 4L7UA 4HMHA 4UVOA 4BUYA 4R6EA 4PAXA 3UDDA 4W5IA 4J1ZA 4KZQA 5AL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEH A;  4L7L A;  5AL2 A;  3SMI A;  4PNM A;  4J21 A;  2RF5 A;  4HLF A;  4L0B A;  1WOK A;  4BUW A;  4UVT A;  4R5W A;  4UVL A;  5C5P A;  4L0V A;  5C5R A;  3KR7 A;  4TJW A;  4PNN A;  4TOR A;  4MSK A;  5A00 A;  4L2G A;  4X52 A;  4UFY A;  4TK0 A;  4L6S A;  4L70 A;  3KCZ A;  3KJD A;  4GV7 A;  4L09 A;  4L6Z A;  4TKG A;  4UVZ A;  5ETY A;  4BU5 A;  3GN7 A;  4MT9 A;  1A26 A;  4UXB A;  4BUS A;  3PAX A;  4BU6 A;  3BLJ A;  4L34 A;  4PML A;  4BS4 A;  4BJ9 A;  4TKI A;  4DQY C;  3FHB A;  4HHY A;  4HLM A;  4PJV A;  2PQF A;  4HHZ A;  4UI5 A;  4HLG A;  3GOY A;  4BUE A;  3U9Y A;  3W51 A;  3UA9 A;  4RV6 A;  4L7R A;  4BU8 A;  4HLH A;  4BJB A;  3SE2 A;  4UW1 A;  4PY4 A;  4J3M A;  4L33 A;  4AVW A;  4LI8 A;  4U6A A;  5LYH A;  4UVP A;  5AKW A;  4N4V A;  4PNR A;  4J22 A;  5ADR A;  4UFU A;  4TJU A;  1UK0 A;  4UI7 A;  5AL4 A;  3GJW A;  4PNQ A;  3SMJ A;  4HL5 A;  4L2F A;  4ZZX A;  4KZU A;  4L0T A;  4N4T A;  4GV4 A;  4L7N A;  4L2K A;  4M7B A;  5LXP A;  4HYF A;  5ECE A;  4TOS A;  4L31 A;  4W6E A;  4TKF A;  4OQA C;  4BUF A;  4BUD A;  4BJC A;  4UHG A;  4PNS A;  4PJT A;  4F1Q A;  4HKN A;  4K4E A;  4BU9 A;  4L0S A;  4LI7 A;  3CE0 A;  4KRS A;  4OQB C;  1EFY A;  4UVX A;  4BUT A;  4BUA A;  4AVU A;  4K4F A;  4UVS A;  4UI3 A;  5ADQ A;  4MSG A;  4OA7 A;  3KR8 A;  3P0P A;  4GV2 A;  4BUX A;  5LX6 A;  1PAX A;  3MHJ A;  4BFP A;  3GEY A;  3C4H A;  2RCW A;  4TK5 A;  4UX4 A;  4I9I A;  4N3R A;  4UI6 A;  4UVV A;  3HKV A;  5C5Q A;  5AKU A;  4UI8 A;  5AL3 A;  4BU7 A;  3UH4 A;  4BUV A;  5FPF A;  3L3L A;  4UVY A;  4F0E A;  4F1L A;  4BU3 A;  4OPX C;  4TVJ A;  4HKK A;  1GS0 A;  4L7O A;  4UUH A;  2RD6 A;  4UVW A;  4UND A;  3P0Q A;  4BUI A;  4LI6 A;  2X5Y A;  3UH2 A;  3P0N A;  4ZZZ A;  4ZZY A;  4L10 A;  3C49 A;  4J3L A;  5FPG A;  3L3M A;  4PNT A;  4L7P A;  4PNL A;  2PAW A;  5EBT A;  5DCZ A;  4L32 A;  5ADS A;  3U9H A;  4HKI A;  4DVI A;  2PAX A;  4UVN A;  4IUE A;  4W5S A;  4UVU A;  4BUU A;  4GV0 A;  4L0I A;  5AL5 A;  4UI4 A;  3MHK A;  5ADT A;  4TJY A;  1UK1 A;  4KZL A;  4HLK A;  4XHU A;  4L7U A;  4HMH A;  4UVO A;  4BUY A;  4R6E A;  4PAX A;  3UDD A;  4W5I A;  4J1Z A;  4KZQ A;  5AL1 A; 
#chains in the Genus database with same CATH topology
 5AEH A;  2OLR A;  4L7L A;  5AL2 A;  3SMI A;  4PNM A;  4J21 A;  2RF5 A;  4GMM A;  4HLF A;  4L0B A;  1II2 A;  5FH3 A;  1YGG A;  1WOK A;  4BUW A;  4UVT A;  4R5W A;  1M51 A;  4UVL A;  5C5P A;  4L0V A;  5C5R A;  3KR7 A;  4TJW A;  4PNN A;  4TOR A;  4MSK A;  5A00 A;  4L2G A;  1J3B A;  4UFY A;  4X52 A;  4L6S A;  4TK0 A;  4WPU A;  4L70 A;  3KCZ A;  3KJD A;  4GV7 A;  4L09 A;  4L6Z A;  4TKG A;  1OS1 A;  4UVZ A;  4WPV A;  3GN7 A;  5ETY A;  4BU5 A;  4MT9 A;  1A26 A;  4UXB A;  4BUS A;  3PAX A;  4GNP A;  4R43 A;  4BU6 A;  4WIE A;  3BLJ A;  4L34 A;  4PML A;  4BS4 A;  2PY7 X;  4TKI A;  4YW8 A;  4BJ9 A;  4DQY C;  3FHB A;  4HHY A;  4HLM A;  2QZY A;  2PQF A;  4HHZ A;  1OEN A;  2QF2 A;  4PJV A;  4UI5 A;  4HLG A;  3GOY A;  2RKD A;  4BUE A;  2FAH A;  3U9Y A;  3W51 A;  3UA9 A;  4BU8 A;  4RV6 A;  4L7R A;  4GMW A;  4YWB A;  2FAF A;  4HLH A;  4BJB A;  1YLH A;  2PXZ X;  2QEW A;  4UW1 A;  4PY4 A;  3SE2 A;  4J3M A;  4L33 A;  4AVW A;  4LI8 A;  4U6A A;  5LYH A;  4UVP A;  5AKW A;  4N4V A;  4PNR A;  2QF1 A;  4J22 A;  5ADR A;  4UFU A;  4TJU A;  1UK0 A;  4UI7 A;  4GNO A;  4OX2 A;  3GJW A;  5AL4 A;  4YW9 A;  5I67 A;  4PNQ A;  3SMJ A;  1KHE A;  1YVY A;  2RKA A;  4HL5 A;  4L2F A;  4ZZX A;  4KZU A;  4L0T A;  4GNM A;  4N4T A;  4GV4 A;  4L7N A;  4L2K A;  4M7B A;  4GNL A;  4HYF A;  4WOU A;  4RCG A;  5ECE A;  5LXP A;  3DT2 A;  4TOS A;  1K3D A;  3DT4 A;  4L31 A;  4W6E A;  1XKV A;  4TKF A;  4YWD A;  4BUF A;  4OQA C;  4BUD A;  1KHF A;  4BJC A;  4UHG A;  3MOE A;  4PNS A;  2RK7 A;  4PJT A;  4F1Q A;  4HKN A;  4K4E A;  4BU9 A;  4L0S A;  4LI7 A;  3CE0 A;  4KRS A;  4OQB C;  1EFY A;  4WL8 A;  4UVX A;  4BUT A;  4BUA A;  1K3C A;  4AVU A;  4K4F A;  4UVS A;  3DT7 A;  4UI3 A;  4MSG A;  4OA7 A;  3KR8 A;  3P0P A;  4GV2 A;  4BUX A;  5ADQ A;  5LX6 A;  1PAX A;  3MHJ A;  4GMU A;  4BFP A;  2PC9 A;  3GEY A;  3C4H A;  2RCW A;  5FH0 A;  3MOH A;  4TK5 A;  4UX4 A;  4I9I A;  4N3R A;  4UI6 A;  5FH1 A;  1AQ2 A;  4UVV A;  3HKV A;  5C5Q A;  5AKU A;  2RK8 A;  4UI8 A;  5AL3 A;  2OLQ A;  3UH4 A;  4BU7 A;  4BUV A;  5FPF A;  3L3L A;  4UVY A;  4F0E A;  5FH2 A;  4F1L A;  4BU3 A;  4OPX C;  4TVJ A;  4HKK A;  1NHX A;  1GS0 A;  5FH4 A;  4L7O A;  4UUH A;  2RD6 A;  4UVW A;  4UND A;  1KHG A;  3P0Q A;  4GNQ A;  4BUI A;  5FH5 A;  4LI6 A;  1YTM A;  2X5Y A;  3MOF A;  3UH2 A;  2RKE A;  3P0N A;  2GMV A;  4WPT A;  4ZZY A;  4ZZZ A;  4L10 A;  3C49 A;  4J3L A;  5FPG A;  3L3M A;  4PNT A;  4L7P A;  4PNL A;  2PAW A;  5EBT A;  2QEY A;  1AYL A;  5DCZ A;  4L32 A;  5ADS A;  3U9H A;  4HKI A;  4WIU A;  1KHB A;  2PAX A;  4DVI A;  4UVN A;  4IUE A;  4W5S A;  2ZCI A;  4UVU A;  4BUU A;  4GV0 A;  4L0I A;  5AL5 A;  4UI4 A;  3MHK A;  5ADT A;  4TJY A;  1UK1 A;  3DTB A;  4KZL A;  4HLK A;  4XHU A;  4GMZ A;  4L7U A;  4HMH A;  4UVO A;  4BUY A;  4R6E A;  4PAX A;  3UDD A;  4W5I A;  4J1Z A;  4KZQ A;  5AL1 A; 
#chains in the Genus database with same CATH homology
 5AEH A;  2OLR A;  4L7L A;  5AL2 A;  3SMI A;  4PNM A;  4J21 A;  2RF5 A;  4GMM A;  4HLF A;  4L0B A;  1II2 A;  5FH3 A;  1YGG A;  1WOK A;  4BUW A;  4UVT A;  4R5W A;  1M51 A;  4UVL A;  5C5P A;  4L0V A;  5C5R A;  3KR7 A;  4TJW A;  4PNN A;  4TOR A;  4MSK A;  5A00 A;  4L2G A;  1J3B A;  4UFY A;  4X52 A;  4L6S A;  4TK0 A;  4WPU A;  4L70 A;  3KCZ A;  3KJD A;  4GV7 A;  4L09 A;  4L6Z A;  4TKG A;  1OS1 A;  4UVZ A;  4WPV A;  3GN7 A;  5ETY A;  4BU5 A;  4MT9 A;  1A26 A;  4UXB A;  4BUS A;  3PAX A;  4GNP A;  4R43 A;  4BU6 A;  4WIE A;  3BLJ A;  4L34 A;  4PML A;  4BS4 A;  2PY7 X;  4TKI A;  4YW8 A;  4BJ9 A;  4DQY C;  3FHB A;  4HHY A;  4HLM A;  2QZY A;  2PQF A;  4HHZ A;  1OEN A;  2QF2 A;  4PJV A;  4UI5 A;  4HLG A;  3GOY A;  2RKD A;  4BUE A;  2FAH A;  3U9Y A;  3W51 A;  3UA9 A;  4BU8 A;  4RV6 A;  4L7R A;  4GMW A;  4YWB A;  2FAF A;  4HLH A;  4BJB A;  1YLH A;  2PXZ X;  2QEW A;  4UW1 A;  4PY4 A;  3SE2 A;  4J3M A;  4L33 A;  4AVW A;  4LI8 A;  4U6A A;  5LYH A;  4UVP A;  5AKW A;  4N4V A;  4PNR A;  2QF1 A;  4J22 A;  5ADR A;  4UFU A;  4TJU A;  1UK0 A;  4UI7 A;  4GNO A;  4OX2 A;  3GJW A;  5AL4 A;  4YW9 A;  5I67 A;  4PNQ A;  3SMJ A;  1KHE A;  1YVY A;  2RKA A;  4HL5 A;  4L2F A;  4ZZX A;  4KZU A;  4L0T A;  4GNM A;  4N4T A;  4GV4 A;  4L7N A;  4L2K A;  4M7B A;  4GNL A;  4HYF A;  4WOU A;  4RCG A;  5ECE A;  5LXP A;  3DT2 A;  4TOS A;  1K3D A;  3DT4 A;  4L31 A;  4W6E A;  1XKV A;  4TKF A;  4YWD A;  4BUF A;  4OQA C;  4BUD A;  1KHF A;  4BJC A;  4UHG A;  3MOE A;  4PNS A;  2RK7 A;  4PJT A;  4F1Q A;  4HKN A;  4K4E A;  4BU9 A;  4L0S A;  4LI7 A;  3CE0 A;  4KRS A;  4OQB C;  1EFY A;  4WL8 A;  4UVX A;  4BUT A;  4BUA A;  1K3C A;  4AVU A;  4K4F A;  4UVS A;  3DT7 A;  4UI3 A;  4MSG A;  4OA7 A;  3KR8 A;  3P0P A;  4GV2 A;  4BUX A;  5ADQ A;  5LX6 A;  1PAX A;  3MHJ A;  4GMU A;  4BFP A;  2PC9 A;  3GEY A;  3C4H A;  2RCW A;  5FH0 A;  3MOH A;  4TK5 A;  4UX4 A;  4I9I A;  4N3R A;  4UI6 A;  5FH1 A;  1AQ2 A;  4UVV A;  3HKV A;  5C5Q A;  5AKU A;  2RK8 A;  4UI8 A;  5AL3 A;  2OLQ A;  3UH4 A;  4BU7 A;  4BUV A;  5FPF A;  3L3L A;  4UVY A;  4F0E A;  5FH2 A;  4F1L A;  4BU3 A;  4OPX C;  4TVJ A;  4HKK A;  1NHX A;  1GS0 A;  5FH4 A;  4L7O A;  4UUH A;  2RD6 A;  4UVW A;  4UND A;  1KHG A;  3P0Q A;  4GNQ A;  4BUI A;  5FH5 A;  4LI6 A;  1YTM A;  2X5Y A;  3MOF A;  3UH2 A;  2RKE A;  3P0N A;  2GMV A;  4WPT A;  4ZZY A;  4ZZZ A;  4L10 A;  3C49 A;  4J3L A;  5FPG A;  3L3M A;  4PNT A;  4L7P A;  4PNL A;  2PAW A;  5EBT A;  2QEY A;  1AYL A;  5DCZ A;  4L32 A;  5ADS A;  3U9H A;  4HKI A;  4WIU A;  1KHB A;  2PAX A;  4DVI A;  4UVN A;  4IUE A;  4W5S A;  2ZCI A;  4UVU A;  4BUU A;  4GV0 A;  4L0I A;  5AL5 A;  4UI4 A;  3MHK A;  5ADT A;  4TJY A;  1UK1 A;  3DTB A;  4KZL A;  4HLK A;  4XHU A;  4GMZ A;  4L7U A;  4HMH A;  4UVO A;  4BUY A;  4R6E A;  4PAX A;  3UDD A;  4W5I A;  4J1Z A;  4KZQ A;  5AL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...