4BU9A

Crystal structure of human tankyrase 2 in complex with 2-(4- methoxyphenyl)-3,4-dihydroquinazolin-4-one
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu9A00
4PNLA 4BU7A 3L3LA 4TJUA 4UVYA 4BUEA 4UI7A 4L32A 4BU5A 4LI6A 3UDDA 4KZLA 4X52A 1A26A 3SMIA 4BS4A 4RV6A 4DVIA 4HLMA 4J3MA 5ADTA 4UFYA 4W5IA 4UVPA 4TJYA 4J22A 4K4EA 5AL5A 4TORA 4PJTA 3UH2A 4M7BA 4IUEA 5AL1A 4L09A 4AVWA 4BU8A 4UVZA 4OQBC 4L7UA 3BLJA 4UVVA 3GOYA 5LX6A 4L2GA 4GV4A 4TK5A 4HL5A 4KRSA 5DCZA 4L2KA 5FPFA 3L3MA 4L7LA 2PQFA 4N3RA 4LI7A 3MHJA 4L0VA 1WOKA 4L7NA 4BUUA 3KJDA 4OA7A 4UFUA 2RF5A 3W51A 4PNNA 4UI5A 4MT9A 4F0EA 4HKNA 5EBTA 4PY4A 4BUDA 5C5QA 4L33A 5ADSA 4PJVA 4F1QA 4UXBA 5AL3A 3U9HA 4GV2A 3P0QA 4UVTA 5LYHA 4BUYA 4BUVA 3GEYA 4PNTA 4BUSA 4HKKA 4OQAC 4BUIA 4HKIA 5ECEA 3P0PA 3SMJA 2RCWA 4BJ9A 1PAXA 4PNMA 3UA9A 3C49A 4L7PA 3UH4A 5AL4A 4W6EA 4DQYC 3MHKA 4K4FA 4MSGA 4ZZXA 4L10A 4PNQA 5ADQA 4L6SA 4UVWA 4R5WA 4UVNA 3KR7A 4UX4A 4L0SA 4U6AA 4BUTA 4L31A 3KR8A 4R6EA 5FPGA 4HMHA 4LI8A 4MSKA 4F1LA 4UNDA 2X5YA 4L34A 1EFYA 3HKVA 4UVXA 4BUFA 4W5SA 5A00A 4BUWA 5C5PA 4BFPA 4PMLA 2PAWA 1GS0A 4L70A 4GV0A 4TVJA 4TKGA 4PNSA 4BUXA 4UVSA 4J21A 3CE0A 5AKUA 4KZQA 4I9IA 4ZZYA 4L2FA 5AKWA 4HHYA 5ADRA 4BJBA 4HLKA 4UVUA 4BU3A 4HLHA 4UUHA 4UI8A 4TJWA 3GJWA 4TKFA 4UW1A 4N4VA 5AL2A 4XHUA 4J3LA 4UI3A 3P0NA 2PAXA 4UVLA 4N4TA 4UHGA 3C4HA 4TKIA 4L7RA 5C5RA 4AVUA 4KZUA 4UVOA 4ZZZA 4HHZA 4BU9A 3PAXA 4TOSA 4BUAA 3KCZA 4TK0A 4J1ZA 5LXPA 4L0IA 4BU6A 4PAXA 3FHBA 4HLGA 4PNRA 4HYFA 5ETYA 4L6ZA 4UI6A 2RD6A 4UI4A 3U9YA 4OPXC 4L0BA 4L7OA 4L0TA 4GV7A 1UK0A 4HLFA 3SE2A 4BJCA 5AEHA 3GN7A 1UK1A
chains in the Genus database with same CATH superfamily
4PNLA 1YLHA 4BU7A 3MOEA 3L3LA 4TJUA 4UVYA 4BUEA 1YTMA 2PY7X 4UI7A 4L32A 4BU5A 4LI6A 3UDDA 4KZLA 4X52A 1A26A 3SMIA 4BS4A 4RV6A 4DVIA 1YVYA 4HLMA 4J3MA 5ADTA 4UFYA 2OLQA 4W5IA 4UVPA 4TJYA 4J22A 4K4EA 2OLRA 5AL5A 4TORA 4PJTA 2RKDA 4YWDA 4M7BA 4IUEA 5AL1A 4L09A 3UH2A 4AVWA 4BU8A 1AYLA 4UVZA 4YWBA 4OQBC 4L7UA 3BLJA 2QF1A 3GOYA 4GNQA 4UVVA 5LX6A 4L2GA 4GV4A 4TK5A 4GNMA 2RKAA 4HL5A 4KRSA 4GNPA 2ZCIA 4L2KA 5DCZA 5FPFA 3L3MA 4L7LA 2PQFA 4N3RA 4WOUA 4LI7A 5FH3A 3MHJA 4L0VA 1WOKA 5FH5A 4L7NA 4BUUA 3KJDA 4RCGA 4OA7A 4UFUA 5FH2A 2RF5A 3W51A 4PNNA 4GMZA 4UI5A 4WPTA 4MT9A 4F0EA 4HKNA 5EBTA 4PY4A 4WIEA 4OX2A 4BUDA 5C5QA 4L33A 4WIUA 5ADSA 4PJVA 4F1QA 4WPUA 3DT7A 4UXBA 5AL3A 3U9HA 4GV2A 3P0QA 4UVTA 5LYHA 5FH4A 4BUYA 4BUVA 3GEYA 4PNTA 4BUSA 1KHGA 1OENA 2QF2A 4GMUA 5FH0A 4HKKA 4OQAC 4BUIA 4HKIA 5ECEA 3P0PA 3SMJA 5I67A 2RCWA 1KHBA 4BJ9A 1PAXA 4PNMA 3UA9A 3C49A 4L7PA 3UH4A 4WPVA 5AL4A 4R43A 4W6EA 4DQYC 3MHKA 4K4FA 4MSGA 4ZZXA 4GNLA 4L10A 4PNQA 5ADQA 4L6SA 1AQ2A 4UVWA 1YGGA 4R5WA 3KR7A 4UVNA 2FAHA 4L0SA 4U6AA 4UX4A 4YW8A 4BUTA 1K3DA 4L31A 3KR8A 4R6EA 5FPGA 4HMHA 4LI8A 1KHEA 4MSKA 4F1LA 4UNDA 2QEWA 2X5YA 4L34A 1EFYA 3HKVA 4UVXA 4BUFA 4W5SA 5A00A 2QEYA 4BUWA 5C5PA 4BFPA 4PMLA 2PAWA 1GS0A 4L70A 4GV0A 4TVJA 4TKGA 4PNSA 2PC9A 4UVSA 4BUXA 4J21A 3CE0A 2GMVA 4KZQA 4I9IA 5AKUA 4ZZYA 4L2FA 5FH1A 5AKWA 4HHYA 5ADRA 4GMMA 4BJBA 1OS1A 4HLKA 4UVUA 4BU3A 3DT4A 2RKEA 4HLHA 4UUHA 4UI8A 4TJWA 3GJWA 4TKFA 1UK1A 4N4VA 4UW1A 4WL8A 5AL2A 2FAFA 4GMWA 4XHUA 4J3LA 1J3BA 4UI3A 1II2A 3P0NA 2RK8A 2PAXA 4UVLA 4N4TA 4UHGA 3C4HA 4TKIA 4L7RA 5C5RA 1M51A 3DT2A 4AVUA 4KZUA 4UVOA 4ZZZA 4HHZA 4BU9A 4YW9A 3PAXA 4TOSA 4BUAA 3KCZA 4TK0A 1NHXA 2RK7A 4J1ZA 5LXPA 2QZYA 3MOHA 4L0IA 4BU6A 4PAXA 3MOFA 2PXZX 3FHBA 4HLGA 4PNRA 1KHFA 1XKVA 4HYFA 4GNOA 5ETYA 1K3CA 4L6ZA 2RD6A 4UI6A 4UI4A 3U9YA 4L0BA 4L7OA 4L0TA 4GV7A 4OPXC 1UK0A 4HLFA 3SE2A 4BJCA 5AEHA 3GN7A 3DTBA
chains in the Genus database with same CATH topology
4PNLA 1YLHA 4BU7A 3MOEA 3L3LA 4TJUA 4UVYA 4BUEA 1YTMA 2PY7X 4UI7A 4L32A 4BU5A 4LI6A 3UDDA 4KZLA 4X52A 1A26A 3SMIA 4BS4A 4RV6A 4DVIA 1YVYA 4HLMA 4J3MA 5ADTA 4UFYA 2OLQA 4W5IA 4UVPA 4TJYA 4J22A 4K4EA 2OLRA 5AL5A 4TORA 4PJTA 2RKDA 4YWDA 4M7BA 4IUEA 5AL1A 4L09A 3UH2A 4AVWA 4BU8A 1AYLA 4UVZA 4YWBA 4OQBC 4L7UA 3BLJA 2QF1A 3GOYA 4GNQA 4UVVA 5LX6A 4L2GA 4GV4A 4TK5A 4GNMA 2RKAA 4HL5A 4KRSA 4GNPA 2ZCIA 4L2KA 5DCZA 5FPFA 3L3MA 4L7LA 2PQFA 4N3RA 4WOUA 4LI7A 5FH3A 3MHJA 4L0VA 1WOKA 5FH5A 4L7NA 4BUUA 3KJDA 4RCGA 4OA7A 4UFUA 5FH2A 2RF5A 3W51A 4PNNA 4GMZA 4UI5A 4WPTA 4MT9A 4F0EA 4HKNA 5EBTA 4PY4A 4WIEA 4OX2A 4BUDA 5C5QA 4L33A 4WIUA 5ADSA 4PJVA 4F1QA 4WPUA 3DT7A 4UXBA 5AL3A 3U9HA 4GV2A 3P0QA 4UVTA 5LYHA 5FH4A 4BUYA 4BUVA 3GEYA 4PNTA 4BUSA 1KHGA 1OENA 2QF2A 4GMUA 5FH0A 4HKKA 4OQAC 4BUIA 4HKIA 5ECEA 3P0PA 3SMJA 5I67A 2RCWA 1KHBA 4BJ9A 1PAXA 4PNMA 3UA9A 3C49A 4L7PA 3UH4A 4WPVA 5AL4A 4R43A 4W6EA 4DQYC 3MHKA 4K4FA 4MSGA 4ZZXA 4GNLA 4L10A 4PNQA 5ADQA 4L6SA 1AQ2A 4UVWA 1YGGA 4R5WA 3KR7A 4UVNA 2FAHA 4L0SA 4U6AA 4UX4A 4YW8A 4BUTA 1K3DA 4L31A 3KR8A 4R6EA 5FPGA 4HMHA 4LI8A 1KHEA 4MSKA 4F1LA 4UNDA 2QEWA 2X5YA 4L34A 1EFYA 3HKVA 4UVXA 4BUFA 4W5SA 5A00A 2QEYA 4BUWA 5C5PA 4BFPA 4PMLA 2PAWA 1GS0A 4L70A 4GV0A 4TVJA 4TKGA 4PNSA 2PC9A 4UVSA 4BUXA 4J21A 3CE0A 2GMVA 4KZQA 4I9IA 5AKUA 4ZZYA 4L2FA 5FH1A 5AKWA 4HHYA 5ADRA 4GMMA 4BJBA 1OS1A 4HLKA 4UVUA 4BU3A 3DT4A 2RKEA 4HLHA 4UUHA 4UI8A 4TJWA 3GJWA 4TKFA 1UK1A 4N4VA 4UW1A 4WL8A 5AL2A 2FAFA 4GMWA 4XHUA 4J3LA 1J3BA 4UI3A 1II2A 3P0NA 2RK8A 2PAXA 4UVLA 4N4TA 4UHGA 3C4HA 4TKIA 4L7RA 5C5RA 1M51A 3DT2A 4AVUA 4KZUA 4UVOA 4ZZZA 4HHZA 4BU9A 4YW9A 3PAXA 4TOSA 4BUAA 3KCZA 4TK0A 1NHXA 2RK7A 4J1ZA 5LXPA 2QZYA 3MOHA 4L0IA 4BU6A 4PAXA 3MOFA 2PXZX 3FHBA 4HLGA 4PNRA 1KHFA 1XKVA 4HYFA 4GNOA 5ETYA 1K3CA 4L6ZA 2RD6A 4UI6A 4UI4A 3U9YA 4L0BA 4L7OA 4L0TA 4GV7A 4OPXC 1UK0A 4HLFA 3SE2A 4BJCA 5AEHA 3GN7A 3DTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNL A;  4BU7 A;  3L3L A;  4TJU A;  4UVY A;  4BUE A;  4UI7 A;  4L32 A;  4BU5 A;  4LI6 A;  3UDD A;  4KZL A;  4X52 A;  1A26 A;  3SMI A;  4BS4 A;  4RV6 A;  4DVI A;  4HLM A;  4J3M A;  5ADT A;  4UFY A;  4W5I A;  4UVP A;  4TJY A;  4J22 A;  4K4E A;  5AL5 A;  4TOR A;  4PJT A;  3UH2 A;  4M7B A;  4IUE A;  5AL1 A;  4L09 A;  4AVW A;  4BU8 A;  4UVZ A;  4OQB C;  4L7U A;  3BLJ A;  4UVV A;  3GOY A;  5LX6 A;  4L2G A;  4GV4 A;  4TK5 A;  4HL5 A;  4KRS A;  5DCZ A;  4L2K A;  5FPF A;  3L3M A;  4L7L A;  2PQF A;  4N3R A;  4LI7 A;  3MHJ A;  4L0V A;  1WOK A;  4L7N A;  4BUU A;  3KJD A;  4OA7 A;  4UFU A;  2RF5 A;  3W51 A;  4PNN A;  4UI5 A;  4MT9 A;  4F0E A;  4HKN A;  5EBT A;  4PY4 A;  4BUD A;  5C5Q A;  4L33 A;  5ADS A;  4PJV A;  4F1Q A;  4UXB A;  5AL3 A;  3U9H A;  4GV2 A;  3P0Q A;  4UVT A;  5LYH A;  4BUY A;  4BUV A;  3GEY A;  4PNT A;  4BUS A;  4HKK A;  4OQA C;  4BUI A;  4HKI A;  5ECE A;  3P0P A;  3SMJ A;  2RCW A;  4BJ9 A;  1PAX A;  4PNM A;  3UA9 A;  3C49 A;  4L7P A;  3UH4 A;  5AL4 A;  4W6E A;  4DQY C;  3MHK A;  4K4F A;  4MSG A;  4ZZX A;  4L10 A;  4PNQ A;  5ADQ A;  4L6S A;  4UVW A;  4R5W A;  4UVN A;  3KR7 A;  4UX4 A;  4L0S A;  4U6A A;  4BUT A;  4L31 A;  3KR8 A;  4R6E A;  5FPG A;  4HMH A;  4LI8 A;  4MSK A;  4F1L A;  4UND A;  2X5Y A;  4L34 A;  1EFY A;  3HKV A;  4UVX A;  4BUF A;  4W5S A;  5A00 A;  4BUW A;  5C5P A;  4BFP A;  4PML A;  2PAW A;  1GS0 A;  4L70 A;  4GV0 A;  4TVJ A;  4TKG A;  4PNS A;  4BUX A;  4UVS A;  4J21 A;  3CE0 A;  5AKU A;  4KZQ A;  4I9I A;  4ZZY A;  4L2F A;  5AKW A;  4HHY A;  5ADR A;  4BJB A;  4HLK A;  4UVU A;  4BU3 A;  4HLH A;  4UUH A;  4UI8 A;  4TJW A;  3GJW A;  4TKF A;  4UW1 A;  4N4V A;  5AL2 A;  4XHU A;  4J3L A;  4UI3 A;  3P0N A;  2PAX A;  4UVL A;  4N4T A;  4UHG A;  3C4H A;  4TKI A;  4L7R A;  5C5R A;  4AVU A;  4KZU A;  4UVO A;  4ZZZ A;  4HHZ A;  4BU9 A;  3PAX A;  4TOS A;  4BUA A;  3KCZ A;  4TK0 A;  4J1Z A;  5LXP A;  4L0I A;  4BU6 A;  4PAX A;  3FHB A;  4HLG A;  4PNR A;  4HYF A;  5ETY A;  4L6Z A;  4UI6 A;  2RD6 A;  4UI4 A;  3U9Y A;  4OPX C;  4L0B A;  4L7O A;  4L0T A;  4GV7 A;  1UK0 A;  4HLF A;  3SE2 A;  4BJC A;  5AEH A;  3GN7 A;  1UK1 A; 
#chains in the Genus database with same CATH topology
 4PNL A;  1YLH A;  4BU7 A;  3MOE A;  3L3L A;  4TJU A;  4UVY A;  4BUE A;  1YTM A;  2PY7 X;  4UI7 A;  4L32 A;  4BU5 A;  4LI6 A;  3UDD A;  4KZL A;  4X52 A;  1A26 A;  3SMI A;  4BS4 A;  4RV6 A;  4DVI A;  1YVY A;  4HLM A;  4J3M A;  5ADT A;  4UFY A;  2OLQ A;  4W5I A;  4UVP A;  4TJY A;  4J22 A;  4K4E A;  2OLR A;  5AL5 A;  4TOR A;  4PJT A;  2RKD A;  4YWD A;  4M7B A;  4IUE A;  5AL1 A;  4L09 A;  3UH2 A;  4AVW A;  4BU8 A;  1AYL A;  4UVZ A;  4YWB A;  4OQB C;  4L7U A;  3BLJ A;  2QF1 A;  3GOY A;  4GNQ A;  4UVV A;  5LX6 A;  4L2G A;  4GV4 A;  4TK5 A;  4GNM A;  2RKA A;  4HL5 A;  4KRS A;  4GNP A;  2ZCI A;  4L2K A;  5DCZ A;  5FPF A;  3L3M A;  4L7L A;  2PQF A;  4N3R A;  4WOU A;  4LI7 A;  5FH3 A;  3MHJ A;  4L0V A;  1WOK A;  5FH5 A;  4L7N A;  4BUU A;  3KJD A;  4RCG A;  4OA7 A;  4UFU A;  5FH2 A;  2RF5 A;  3W51 A;  4PNN A;  4GMZ A;  4UI5 A;  4WPT A;  4MT9 A;  4F0E A;  4HKN A;  5EBT A;  4PY4 A;  4WIE A;  4OX2 A;  4BUD A;  5C5Q A;  4L33 A;  4WIU A;  5ADS A;  4PJV A;  4F1Q A;  4WPU A;  3DT7 A;  4UXB A;  5AL3 A;  3U9H A;  4GV2 A;  3P0Q A;  4UVT A;  5LYH A;  5FH4 A;  4BUY A;  4BUV A;  3GEY A;  4PNT A;  4BUS A;  1KHG A;  1OEN A;  2QF2 A;  4GMU A;  5FH0 A;  4HKK A;  4OQA C;  4BUI A;  4HKI A;  5ECE A;  3P0P A;  3SMJ A;  5I67 A;  2RCW A;  1KHB A;  4BJ9 A;  1PAX A;  4PNM A;  3UA9 A;  3C49 A;  4L7P A;  3UH4 A;  4WPV A;  5AL4 A;  4R43 A;  4W6E A;  4DQY C;  3MHK A;  4K4F A;  4MSG A;  4ZZX A;  4GNL A;  4L10 A;  4PNQ A;  5ADQ A;  4L6S A;  1AQ2 A;  4UVW A;  1YGG A;  4R5W A;  3KR7 A;  4UVN A;  2FAH A;  4L0S A;  4U6A A;  4UX4 A;  4YW8 A;  4BUT A;  1K3D A;  4L31 A;  3KR8 A;  4R6E A;  5FPG A;  4HMH A;  4LI8 A;  1KHE A;  4MSK A;  4F1L A;  4UND A;  2QEW A;  2X5Y A;  4L34 A;  1EFY A;  3HKV A;  4UVX A;  4BUF A;  4W5S A;  5A00 A;  2QEY A;  4BUW A;  5C5P A;  4BFP A;  4PML A;  2PAW A;  1GS0 A;  4L70 A;  4GV0 A;  4TVJ A;  4TKG A;  4PNS A;  2PC9 A;  4UVS A;  4BUX A;  4J21 A;  3CE0 A;  2GMV A;  4KZQ A;  4I9I A;  5AKU A;  4ZZY A;  4L2F A;  5FH1 A;  5AKW A;  4HHY A;  5ADR A;  4GMM A;  4BJB A;  1OS1 A;  4HLK A;  4UVU A;  4BU3 A;  3DT4 A;  2RKE A;  4HLH A;  4UUH A;  4UI8 A;  4TJW A;  3GJW A;  4TKF A;  1UK1 A;  4N4V A;  4UW1 A;  4WL8 A;  5AL2 A;  2FAF A;  4GMW A;  4XHU A;  4J3L A;  1J3B A;  4UI3 A;  1II2 A;  3P0N A;  2RK8 A;  2PAX A;  4UVL A;  4N4T A;  4UHG A;  3C4H A;  4TKI A;  4L7R A;  5C5R A;  1M51 A;  3DT2 A;  4AVU A;  4KZU A;  4UVO A;  4ZZZ A;  4HHZ A;  4BU9 A;  4YW9 A;  3PAX A;  4TOS A;  4BUA A;  3KCZ A;  4TK0 A;  1NHX A;  2RK7 A;  4J1Z A;  5LXP A;  2QZY A;  3MOH A;  4L0I A;  4BU6 A;  4PAX A;  3MOF A;  2PXZ X;  3FHB A;  4HLG A;  4PNR A;  1KHF A;  1XKV A;  4HYF A;  4GNO A;  5ETY A;  1K3C A;  4L6Z A;  2RD6 A;  4UI6 A;  4UI4 A;  3U9Y A;  4L0B A;  4L7O A;  4L0T A;  4GV7 A;  4OPX C;  1UK0 A;  4HLF A;  3SE2 A;  4BJC A;  5AEH A;  3GN7 A;  3DTB A; 
#chains in the Genus database with same CATH homology
 4PNL A;  1YLH A;  4BU7 A;  3MOE A;  3L3L A;  4TJU A;  4UVY A;  4BUE A;  1YTM A;  2PY7 X;  4UI7 A;  4L32 A;  4BU5 A;  4LI6 A;  3UDD A;  4KZL A;  4X52 A;  1A26 A;  3SMI A;  4BS4 A;  4RV6 A;  4DVI A;  1YVY A;  4HLM A;  4J3M A;  5ADT A;  4UFY A;  2OLQ A;  4W5I A;  4UVP A;  4TJY A;  4J22 A;  4K4E A;  2OLR A;  5AL5 A;  4TOR A;  4PJT A;  2RKD A;  4YWD A;  4M7B A;  4IUE A;  5AL1 A;  4L09 A;  3UH2 A;  4AVW A;  4BU8 A;  1AYL A;  4UVZ A;  4YWB A;  4OQB C;  4L7U A;  3BLJ A;  2QF1 A;  3GOY A;  4GNQ A;  4UVV A;  5LX6 A;  4L2G A;  4GV4 A;  4TK5 A;  4GNM A;  2RKA A;  4HL5 A;  4KRS A;  4GNP A;  2ZCI A;  4L2K A;  5DCZ A;  5FPF A;  3L3M A;  4L7L A;  2PQF A;  4N3R A;  4WOU A;  4LI7 A;  5FH3 A;  3MHJ A;  4L0V A;  1WOK A;  5FH5 A;  4L7N A;  4BUU A;  3KJD A;  4RCG A;  4OA7 A;  4UFU A;  5FH2 A;  2RF5 A;  3W51 A;  4PNN A;  4GMZ A;  4UI5 A;  4WPT A;  4MT9 A;  4F0E A;  4HKN A;  5EBT A;  4PY4 A;  4WIE A;  4OX2 A;  4BUD A;  5C5Q A;  4L33 A;  4WIU A;  5ADS A;  4PJV A;  4F1Q A;  4WPU A;  3DT7 A;  4UXB A;  5AL3 A;  3U9H A;  4GV2 A;  3P0Q A;  4UVT A;  5LYH A;  5FH4 A;  4BUY A;  4BUV A;  3GEY A;  4PNT A;  4BUS A;  1KHG A;  1OEN A;  2QF2 A;  4GMU A;  5FH0 A;  4HKK A;  4OQA C;  4BUI A;  4HKI A;  5ECE A;  3P0P A;  3SMJ A;  5I67 A;  2RCW A;  1KHB A;  4BJ9 A;  1PAX A;  4PNM A;  3UA9 A;  3C49 A;  4L7P A;  3UH4 A;  4WPV A;  5AL4 A;  4R43 A;  4W6E A;  4DQY C;  3MHK A;  4K4F A;  4MSG A;  4ZZX A;  4GNL A;  4L10 A;  4PNQ A;  5ADQ A;  4L6S A;  1AQ2 A;  4UVW A;  1YGG A;  4R5W A;  3KR7 A;  4UVN A;  2FAH A;  4L0S A;  4U6A A;  4UX4 A;  4YW8 A;  4BUT A;  1K3D A;  4L31 A;  3KR8 A;  4R6E A;  5FPG A;  4HMH A;  4LI8 A;  1KHE A;  4MSK A;  4F1L A;  4UND A;  2QEW A;  2X5Y A;  4L34 A;  1EFY A;  3HKV A;  4UVX A;  4BUF A;  4W5S A;  5A00 A;  2QEY A;  4BUW A;  5C5P A;  4BFP A;  4PML A;  2PAW A;  1GS0 A;  4L70 A;  4GV0 A;  4TVJ A;  4TKG A;  4PNS A;  2PC9 A;  4UVS A;  4BUX A;  4J21 A;  3CE0 A;  2GMV A;  4KZQ A;  4I9I A;  5AKU A;  4ZZY A;  4L2F A;  5FH1 A;  5AKW A;  4HHY A;  5ADR A;  4GMM A;  4BJB A;  1OS1 A;  4HLK A;  4UVU A;  4BU3 A;  3DT4 A;  2RKE A;  4HLH A;  4UUH A;  4UI8 A;  4TJW A;  3GJW A;  4TKF A;  1UK1 A;  4N4V A;  4UW1 A;  4WL8 A;  5AL2 A;  2FAF A;  4GMW A;  4XHU A;  4J3L A;  1J3B A;  4UI3 A;  1II2 A;  3P0N A;  2RK8 A;  2PAX A;  4UVL A;  4N4T A;  4UHG A;  3C4H A;  4TKI A;  4L7R A;  5C5R A;  1M51 A;  3DT2 A;  4AVU A;  4KZU A;  4UVO A;  4ZZZ A;  4HHZ A;  4BU9 A;  4YW9 A;  3PAX A;  4TOS A;  4BUA A;  3KCZ A;  4TK0 A;  1NHX A;  2RK7 A;  4J1Z A;  5LXP A;  2QZY A;  3MOH A;  4L0I A;  4BU6 A;  4PAX A;  3MOF A;  2PXZ X;  3FHB A;  4HLG A;  4PNR A;  1KHF A;  1XKV A;  4HYF A;  4GNO A;  5ETY A;  1K3C A;  4L6Z A;  2RD6 A;  4UI6 A;  4UI4 A;  3U9Y A;  4L0B A;  4L7O A;  4L0T A;  4GV7 A;  4OPX C;  1UK0 A;  4HLF A;  3SE2 A;  4BJC A;  5AEH A;  3GN7 A;  3DTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...