4BU9A

Crystal structure of human tankyrase 2 in complex with 2-(4- methoxyphenyl)-3,4-dihydroquinazolin-4-one
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bu9A00
4HLKA 3SE2A 4MSKA 1UK1A 3CE0A 4L0IA 4UNDA 4UVLA 4UI3A 5AL4A 4PNQA 4UFYA 4ZZZA 4W5SA 4BUTA 5ADSA 4N4VA 3GOYA 4UVWA 4BU7A 4HKNA 4MT9A 4AVUA 4HMHA 4N4TA 3GN7A 4PMLA 5C5QA 3U9HA 5ECEA 3UDDA 5EBTA 3KR8A 4L70A 4HHZA 4OA7A 4TJYA 4KZUA 4UUHA 4HYFA 4UVYA 4BUWA 4PNRA 4J22A 4J3MA 4BFPA 1EFYA 4HLGA 2RD6A 4BU3A 5ADRA 4UVXA 4UI4A 4UI7A 4BUSA 4K4FA 4DVIA 3KR7A 4L2GA 4LI8A 4UFUA 4TVJA 4TK0A 3HKVA 4L7NA 4LI6A 4L7RA 1WOKA 4PAXA 4AVWA 5A00A 4F1QA 3UH2A 4N3RA 4M7BA 4TKIA 4PNTA 3C49A 4MSGA 4L32A 1GS0A 4BS4A 4L7PA 3SMIA 4BUAA 5C5PA 3C4HA 4L0TA 5ADQA 5FPGA 2PAWA 4TORA 3L3LA 5AKUA 4BUYA 4L7OA 4UI6A 4L31A 4RV6A 4X52A 3P0NA 4L33A 4L2KA 5LX6A 4GV4A 4L0VA 4BUDA 4UX4A 3SMJA 4L2FA 3MHKA 4U6AA 1UK0A 2RCWA 4HLFA 4TJWA 1A26A 4ZZXA 4BJ9A 4UVUA 2PQFA 4PNSA 5DCZA 3UH4A 4J21A 5AL5A 3GEYA 4PNNA 4UI8A 3GJWA 3P0PA 4TKFA 4BUUA 4UI5A 4TK5A 4BJBA 5AL2A 5AL3A 4L6ZA 4R5WA 3PAXA 4BU6A 5AL1A 4PNMA 4BJCA 3UA9A 4OQAC 4DQYC 4PJTA 4GV0A 3U9YA 4XHUA 4GV2A 4PNLA 4L6SA 4IUEA 4UVTA 4BU5A 3W51A 4HKKA 4TKGA 4R6EA 4W6EA 4HLMA 4KRSA 2RF5A 4BUEA 4UVVA 4BUVA 4HKIA 5LYHA 2PAXA 5ETYA 4LI7A 4KZLA 3MHJA 1PAXA 5AKWA 4HL5A 4L10A 4GV7A 4HLHA 4L34A 3KCZA 4PY4A 4TOSA 4ZZYA 3L3MA 4UVOA 4BU9A 4L0BA 5LXPA 4UVSA 5C5RA 4L09A 5ADTA 3BLJA 4TJUA 4OPXC 4KZQA 4UVPA 3KJDA 4I9IA 4UVZA 4UW1A 4UXBA 4BUIA 4BUXA 2X5YA 4PJVA 5FPFA 5AEHA 4HHYA 4J3LA 4J1ZA 4F1LA 4UHGA 4L7LA 4F0EA 3FHBA 4BUFA 4UVNA 4BU8A 4W5IA 3P0QA 4L7UA 4OQBC 4L0SA 4K4EA
chains in the Genus database with same CATH superfamily
4HLKA 3SE2A 4MSKA 1UK1A 3CE0A 5I67A 4L0IA 4UNDA 4UVLA 4UI3A 4GMZA 4PNQA 5AL4A 4UFYA 4ZZZA 1XKVA 3MOFA 4GNLA 4W5SA 2RKEA 4N4VA 4BUTA 2ZCIA 5ADSA 3GOYA 4UVWA 4BU7A 4HKNA 4MT9A 4AVUA 1KHBA 2FAFA 4HMHA 4N4TA 3GN7A 4PMLA 5C5QA 3U9HA 5ECEA 5FH4A 5EBTA 3KR8A 3UDDA 4GMMA 4L70A 4HHZA 4OA7A 4TJYA 4KZUA 4UUHA 4HYFA 4UVYA 4BUWA 4PNRA 4J22A 4J3MA 5FH2A 4GMWA 4BFPA 1EFYA 4HLGA 2RD6A 4BU3A 1M51A 2PXZX 5ADRA 4YW8A 4UVXA 3DT7A 4UI4A 4UI7A 3DTBA 4WIUA 4BUSA 4K4FA 2QEYA 4DVIA 1AQ2A 1YVYA 3KR7A 4L2GA 4LI8A 4UFUA 1KHFA 1KHEA 2QEWA 4TVJA 4TK0A 3HKVA 4GNMA 1K3DA 4L7NA 4LI6A 4L7RA 1WOKA 1YGGA 4PAXA 4AVWA 5A00A 4F1QA 3UH2A 4N3RA 4M7BA 4TKIA 4PNTA 3C49A 4MSGA 4YWDA 4L32A 1GS0A 3DT2A 4BS4A 4L7PA 3SMIA 4BUAA 5C5PA 3C4HA 4L0TA 4WPUA 5ADQA 5FH5A 5FPGA 2PAWA 4TORA 2FAHA 2RK8A 3L3LA 5AKUA 5FH3A 4BUYA 4L7OA 4UI6A 4L31A 4RV6A 4X52A 4YWBA 3P0NA 4L33A 4L2KA 2GMVA 4WPTA 5LX6A 4GV4A 4L0VA 4BUDA 4UX4A 3SMJA 3MOHA 3MHKA 4L2FA 4U6AA 1UK0A 1YTMA 2RCWA 4HLFA 1A26A 4TJWA 5FH0A 4ZZXA 4BJ9A 4UVUA 1OS1A 2PQFA 4PNSA 5DCZA 4YW9A 4J21A 3UH4A 5AL5A 2RK7A 4RCGA 3GEYA 4PNNA 4UI8A 3GJWA 3P0PA 4TKFA 4BUUA 4UI5A 4WIEA 4WL8A 4TK5A 4BJBA 5AL2A 5AL3A 4L6ZA 4R5WA 3PAXA 4BU6A 1YLHA 4PNMA 5AL1A 1OENA 2PY7X 3UA9A 4BJCA 4OQAC 4DQYC 4PJTA 4GV0A 3U9YA 4XHUA 4GV2A 4PNLA 4L6SA 4IUEA 4UVTA 4BU5A 3W51A 4HKKA 4TKGA 4R6EA 1J3BA 4W6EA 4HLMA 4OX2A 2OLRA 4KRSA 2RF5A 4BUEA 4UVVA 4BUVA 4HKIA 2QF1A 2PAXA 5ETYA 5LYHA 4GNQA 4LI7A 4KZLA 3MHJA 1PAXA 2QZYA 2QF2A 1II2A 5AKWA 4HL5A 4L10A 4GV7A 2RKAA 4HLHA 4L34A 3KCZA 4PY4A 4TOSA 4ZZYA 3L3MA 4UVOA 4BU9A 4L0BA 5LXPA 4UVSA 4WOUA 5C5RA 2RKDA 4L09A 5FH1A 5ADTA 3BLJA 4TJUA 3DT4A 4OPXC 4KZQA 4UVPA 1AYLA 1KHGA 1NHXA 3KJDA 4I9IA 4R43A 4UVZA 3MOEA 4UW1A 4UXBA 4BUIA 4GNPA 4BUXA 2X5YA 4PJVA 4WPVA 5FPFA 5AEHA 4HHYA 4GMUA 4J3LA 4J1ZA 4F1LA 1K3CA 2PC9A 4UHGA 4L7LA 4F0EA 3FHBA 4BUFA 4UVNA 4BU8A 4W5IA 3P0QA 4GNOA 4L7UA 4OQBC 2OLQA 4L0SA 4K4EA
chains in the Genus database with same CATH topology
4HLKA 3SE2A 4MSKA 1UK1A 3CE0A 5I67A 4L0IA 4UNDA 4UVLA 4UI3A 4GMZA 4PNQA 5AL4A 4UFYA 4ZZZA 1XKVA 3MOFA 4GNLA 4W5SA 2RKEA 4N4VA 4BUTA 2ZCIA 5ADSA 3GOYA 4UVWA 4BU7A 4HKNA 4MT9A 4AVUA 1KHBA 2FAFA 4HMHA 4N4TA 3GN7A 4PMLA 5C5QA 3U9HA 5ECEA 5FH4A 5EBTA 3KR8A 3UDDA 4GMMA 4L70A 4HHZA 4OA7A 4TJYA 4KZUA 4UUHA 4HYFA 4UVYA 4BUWA 4PNRA 4J22A 4J3MA 5FH2A 4GMWA 4BFPA 1EFYA 4HLGA 2RD6A 4BU3A 1M51A 2PXZX 5ADRA 4YW8A 4UVXA 3DT7A 4UI4A 4UI7A 3DTBA 4WIUA 4BUSA 4K4FA 2QEYA 4DVIA 1AQ2A 1YVYA 3KR7A 4L2GA 4LI8A 4UFUA 1KHFA 1KHEA 2QEWA 4TVJA 4TK0A 3HKVA 4GNMA 1K3DA 4L7NA 4LI6A 4L7RA 1WOKA 1YGGA 4PAXA 4AVWA 5A00A 4F1QA 3UH2A 4N3RA 4M7BA 4TKIA 4PNTA 3C49A 4MSGA 4YWDA 4L32A 1GS0A 3DT2A 4BS4A 4L7PA 3SMIA 4BUAA 5C5PA 3C4HA 4L0TA 4WPUA 5ADQA 5FH5A 5FPGA 2PAWA 4TORA 2FAHA 2RK8A 3L3LA 5AKUA 5FH3A 4BUYA 4L7OA 4UI6A 4L31A 4RV6A 4X52A 4YWBA 3P0NA 4L33A 4L2KA 2GMVA 4WPTA 5LX6A 4GV4A 4L0VA 4BUDA 4UX4A 3SMJA 3MOHA 3MHKA 4L2FA 4U6AA 1UK0A 1YTMA 2RCWA 4HLFA 1A26A 4TJWA 5FH0A 4ZZXA 4BJ9A 4UVUA 1OS1A 2PQFA 4PNSA 5DCZA 4YW9A 4J21A 3UH4A 5AL5A 2RK7A 4RCGA 3GEYA 4PNNA 4UI8A 3GJWA 3P0PA 4TKFA 4BUUA 4UI5A 4WIEA 4WL8A 4TK5A 4BJBA 5AL2A 5AL3A 4L6ZA 4R5WA 3PAXA 4BU6A 1YLHA 4PNMA 5AL1A 1OENA 2PY7X 3UA9A 4BJCA 4OQAC 4DQYC 4PJTA 4GV0A 3U9YA 4XHUA 4GV2A 4PNLA 4L6SA 4IUEA 4UVTA 4BU5A 3W51A 4HKKA 4TKGA 4R6EA 1J3BA 4W6EA 4HLMA 4OX2A 2OLRA 4KRSA 2RF5A 4BUEA 4UVVA 4BUVA 4HKIA 2QF1A 2PAXA 5ETYA 5LYHA 4GNQA 4LI7A 4KZLA 3MHJA 1PAXA 2QZYA 2QF2A 1II2A 5AKWA 4HL5A 4L10A 4GV7A 2RKAA 4HLHA 4L34A 3KCZA 4PY4A 4TOSA 4ZZYA 3L3MA 4UVOA 4BU9A 4L0BA 5LXPA 4UVSA 4WOUA 5C5RA 2RKDA 4L09A 5FH1A 5ADTA 3BLJA 4TJUA 3DT4A 4OPXC 4KZQA 4UVPA 1AYLA 1KHGA 1NHXA 3KJDA 4I9IA 4R43A 4UVZA 3MOEA 4UW1A 4UXBA 4BUIA 4GNPA 4BUXA 2X5YA 4PJVA 4WPVA 5FPFA 5AEHA 4HHYA 4GMUA 4J3LA 4J1ZA 4F1LA 1K3CA 2PC9A 4UHGA 4L7LA 4F0EA 3FHBA 4BUFA 4UVNA 4BU8A 4W5IA 3P0QA 4GNOA 4L7UA 4OQBC 2OLQA 4L0SA 4K4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HLK A;  3SE2 A;  4MSK A;  1UK1 A;  3CE0 A;  4L0I A;  4UND A;  4UVL A;  4UI3 A;  5AL4 A;  4PNQ A;  4UFY A;  4ZZZ A;  4W5S A;  4BUT A;  5ADS A;  4N4V A;  3GOY A;  4UVW A;  4BU7 A;  4HKN A;  4MT9 A;  4AVU A;  4HMH A;  4N4T A;  3GN7 A;  4PML A;  5C5Q A;  3U9H A;  5ECE A;  3UDD A;  5EBT A;  3KR8 A;  4L70 A;  4HHZ A;  4OA7 A;  4TJY A;  4KZU A;  4UUH A;  4HYF A;  4UVY A;  4BUW A;  4PNR A;  4J22 A;  4J3M A;  4BFP A;  1EFY A;  4HLG A;  2RD6 A;  4BU3 A;  5ADR A;  4UVX A;  4UI4 A;  4UI7 A;  4BUS A;  4K4F A;  4DVI A;  3KR7 A;  4L2G A;  4LI8 A;  4UFU A;  4TVJ A;  4TK0 A;  3HKV A;  4L7N A;  4LI6 A;  4L7R A;  1WOK A;  4PAX A;  4AVW A;  5A00 A;  4F1Q A;  3UH2 A;  4N3R A;  4M7B A;  4TKI A;  4PNT A;  3C49 A;  4MSG A;  4L32 A;  1GS0 A;  4BS4 A;  4L7P A;  3SMI A;  4BUA A;  5C5P A;  3C4H A;  4L0T A;  5ADQ A;  5FPG A;  2PAW A;  4TOR A;  3L3L A;  5AKU A;  4BUY A;  4L7O A;  4UI6 A;  4L31 A;  4RV6 A;  4X52 A;  3P0N A;  4L33 A;  4L2K A;  5LX6 A;  4GV4 A;  4L0V A;  4BUD A;  4UX4 A;  3SMJ A;  4L2F A;  3MHK A;  4U6A A;  1UK0 A;  2RCW A;  4HLF A;  4TJW A;  1A26 A;  4ZZX A;  4BJ9 A;  4UVU A;  2PQF A;  4PNS A;  5DCZ A;  3UH4 A;  4J21 A;  5AL5 A;  3GEY A;  4PNN A;  4UI8 A;  3GJW A;  3P0P A;  4TKF A;  4BUU A;  4UI5 A;  4TK5 A;  4BJB A;  5AL2 A;  5AL3 A;  4L6Z A;  4R5W A;  3PAX A;  4BU6 A;  5AL1 A;  4PNM A;  4BJC A;  3UA9 A;  4OQA C;  4DQY C;  4PJT A;  4GV0 A;  3U9Y A;  4XHU A;  4GV2 A;  4PNL A;  4L6S A;  4IUE A;  4UVT A;  4BU5 A;  3W51 A;  4HKK A;  4TKG A;  4R6E A;  4W6E A;  4HLM A;  4KRS A;  2RF5 A;  4BUE A;  4UVV A;  4BUV A;  4HKI A;  5LYH A;  2PAX A;  5ETY A;  4LI7 A;  4KZL A;  3MHJ A;  1PAX A;  5AKW A;  4HL5 A;  4L10 A;  4GV7 A;  4HLH A;  4L34 A;  3KCZ A;  4PY4 A;  4TOS A;  4ZZY A;  3L3M A;  4UVO A;  4BU9 A;  4L0B A;  5LXP A;  4UVS A;  5C5R A;  4L09 A;  5ADT A;  3BLJ A;  4TJU A;  4OPX C;  4KZQ A;  4UVP A;  3KJD A;  4I9I A;  4UVZ A;  4UW1 A;  4UXB A;  4BUI A;  4BUX A;  2X5Y A;  4PJV A;  5FPF A;  5AEH A;  4HHY A;  4J3L A;  4J1Z A;  4F1L A;  4UHG A;  4L7L A;  4F0E A;  3FHB A;  4BUF A;  4UVN A;  4BU8 A;  4W5I A;  3P0Q A;  4L7U A;  4OQB C;  4L0S A;  4K4E A; 
#chains in the Genus database with same CATH topology
 4HLK A;  3SE2 A;  4MSK A;  1UK1 A;  3CE0 A;  5I67 A;  4L0I A;  4UND A;  4UVL A;  4UI3 A;  4GMZ A;  4PNQ A;  5AL4 A;  4UFY A;  4ZZZ A;  1XKV A;  3MOF A;  4GNL A;  4W5S A;  2RKE A;  4N4V A;  4BUT A;  2ZCI A;  5ADS A;  3GOY A;  4UVW A;  4BU7 A;  4HKN A;  4MT9 A;  4AVU A;  1KHB A;  2FAF A;  4HMH A;  4N4T A;  3GN7 A;  4PML A;  5C5Q A;  3U9H A;  5ECE A;  5FH4 A;  5EBT A;  3KR8 A;  3UDD A;  4GMM A;  4L70 A;  4HHZ A;  4OA7 A;  4TJY A;  4KZU A;  4UUH A;  4HYF A;  4UVY A;  4BUW A;  4PNR A;  4J22 A;  4J3M A;  5FH2 A;  4GMW A;  4BFP A;  1EFY A;  4HLG A;  2RD6 A;  4BU3 A;  1M51 A;  2PXZ X;  5ADR A;  4YW8 A;  4UVX A;  3DT7 A;  4UI4 A;  4UI7 A;  3DTB A;  4WIU A;  4BUS A;  4K4F A;  2QEY A;  4DVI A;  1AQ2 A;  1YVY A;  3KR7 A;  4L2G A;  4LI8 A;  4UFU A;  1KHF A;  1KHE A;  2QEW A;  4TVJ A;  4TK0 A;  3HKV A;  4GNM A;  1K3D A;  4L7N A;  4LI6 A;  4L7R A;  1WOK A;  1YGG A;  4PAX A;  4AVW A;  5A00 A;  4F1Q A;  3UH2 A;  4N3R A;  4M7B A;  4TKI A;  4PNT A;  3C49 A;  4MSG A;  4YWD A;  4L32 A;  1GS0 A;  3DT2 A;  4BS4 A;  4L7P A;  3SMI A;  4BUA A;  5C5P A;  3C4H A;  4L0T A;  4WPU A;  5ADQ A;  5FH5 A;  5FPG A;  2PAW A;  4TOR A;  2FAH A;  2RK8 A;  3L3L A;  5AKU A;  5FH3 A;  4BUY A;  4L7O A;  4UI6 A;  4L31 A;  4RV6 A;  4X52 A;  4YWB A;  3P0N A;  4L33 A;  4L2K A;  2GMV A;  4WPT A;  5LX6 A;  4GV4 A;  4L0V A;  4BUD A;  4UX4 A;  3SMJ A;  3MOH A;  3MHK A;  4L2F A;  4U6A A;  1UK0 A;  1YTM A;  2RCW A;  4HLF A;  1A26 A;  4TJW A;  5FH0 A;  4ZZX A;  4BJ9 A;  4UVU A;  1OS1 A;  2PQF A;  4PNS A;  5DCZ A;  4YW9 A;  4J21 A;  3UH4 A;  5AL5 A;  2RK7 A;  4RCG A;  3GEY A;  4PNN A;  4UI8 A;  3GJW A;  3P0P A;  4TKF A;  4BUU A;  4UI5 A;  4WIE A;  4WL8 A;  4TK5 A;  4BJB A;  5AL2 A;  5AL3 A;  4L6Z A;  4R5W A;  3PAX A;  4BU6 A;  1YLH A;  4PNM A;  5AL1 A;  1OEN A;  2PY7 X;  3UA9 A;  4BJC A;  4OQA C;  4DQY C;  4PJT A;  4GV0 A;  3U9Y A;  4XHU A;  4GV2 A;  4PNL A;  4L6S A;  4IUE A;  4UVT A;  4BU5 A;  3W51 A;  4HKK A;  4TKG A;  4R6E A;  1J3B A;  4W6E A;  4HLM A;  4OX2 A;  2OLR A;  4KRS A;  2RF5 A;  4BUE A;  4UVV A;  4BUV A;  4HKI A;  2QF1 A;  2PAX A;  5ETY A;  5LYH A;  4GNQ A;  4LI7 A;  4KZL A;  3MHJ A;  1PAX A;  2QZY A;  2QF2 A;  1II2 A;  5AKW A;  4HL5 A;  4L10 A;  4GV7 A;  2RKA A;  4HLH A;  4L34 A;  3KCZ A;  4PY4 A;  4TOS A;  4ZZY A;  3L3M A;  4UVO A;  4BU9 A;  4L0B A;  5LXP A;  4UVS A;  4WOU A;  5C5R A;  2RKD A;  4L09 A;  5FH1 A;  5ADT A;  3BLJ A;  4TJU A;  3DT4 A;  4OPX C;  4KZQ A;  4UVP A;  1AYL A;  1KHG A;  1NHX A;  3KJD A;  4I9I A;  4R43 A;  4UVZ A;  3MOE A;  4UW1 A;  4UXB A;  4BUI A;  4GNP A;  4BUX A;  2X5Y A;  4PJV A;  4WPV A;  5FPF A;  5AEH A;  4HHY A;  4GMU A;  4J3L A;  4J1Z A;  4F1L A;  1K3C A;  2PC9 A;  4UHG A;  4L7L A;  4F0E A;  3FHB A;  4BUF A;  4UVN A;  4BU8 A;  4W5I A;  3P0Q A;  4GNO A;  4L7U A;  4OQB C;  2OLQ A;  4L0S A;  4K4E A; 
#chains in the Genus database with same CATH homology
 4HLK A;  3SE2 A;  4MSK A;  1UK1 A;  3CE0 A;  5I67 A;  4L0I A;  4UND A;  4UVL A;  4UI3 A;  4GMZ A;  4PNQ A;  5AL4 A;  4UFY A;  4ZZZ A;  1XKV A;  3MOF A;  4GNL A;  4W5S A;  2RKE A;  4N4V A;  4BUT A;  2ZCI A;  5ADS A;  3GOY A;  4UVW A;  4BU7 A;  4HKN A;  4MT9 A;  4AVU A;  1KHB A;  2FAF A;  4HMH A;  4N4T A;  3GN7 A;  4PML A;  5C5Q A;  3U9H A;  5ECE A;  5FH4 A;  5EBT A;  3KR8 A;  3UDD A;  4GMM A;  4L70 A;  4HHZ A;  4OA7 A;  4TJY A;  4KZU A;  4UUH A;  4HYF A;  4UVY A;  4BUW A;  4PNR A;  4J22 A;  4J3M A;  5FH2 A;  4GMW A;  4BFP A;  1EFY A;  4HLG A;  2RD6 A;  4BU3 A;  1M51 A;  2PXZ X;  5ADR A;  4YW8 A;  4UVX A;  3DT7 A;  4UI4 A;  4UI7 A;  3DTB A;  4WIU A;  4BUS A;  4K4F A;  2QEY A;  4DVI A;  1AQ2 A;  1YVY A;  3KR7 A;  4L2G A;  4LI8 A;  4UFU A;  1KHF A;  1KHE A;  2QEW A;  4TVJ A;  4TK0 A;  3HKV A;  4GNM A;  1K3D A;  4L7N A;  4LI6 A;  4L7R A;  1WOK A;  1YGG A;  4PAX A;  4AVW A;  5A00 A;  4F1Q A;  3UH2 A;  4N3R A;  4M7B A;  4TKI A;  4PNT A;  3C49 A;  4MSG A;  4YWD A;  4L32 A;  1GS0 A;  3DT2 A;  4BS4 A;  4L7P A;  3SMI A;  4BUA A;  5C5P A;  3C4H A;  4L0T A;  4WPU A;  5ADQ A;  5FH5 A;  5FPG A;  2PAW A;  4TOR A;  2FAH A;  2RK8 A;  3L3L A;  5AKU A;  5FH3 A;  4BUY A;  4L7O A;  4UI6 A;  4L31 A;  4RV6 A;  4X52 A;  4YWB A;  3P0N A;  4L33 A;  4L2K A;  2GMV A;  4WPT A;  5LX6 A;  4GV4 A;  4L0V A;  4BUD A;  4UX4 A;  3SMJ A;  3MOH A;  3MHK A;  4L2F A;  4U6A A;  1UK0 A;  1YTM A;  2RCW A;  4HLF A;  1A26 A;  4TJW A;  5FH0 A;  4ZZX A;  4BJ9 A;  4UVU A;  1OS1 A;  2PQF A;  4PNS A;  5DCZ A;  4YW9 A;  4J21 A;  3UH4 A;  5AL5 A;  2RK7 A;  4RCG A;  3GEY A;  4PNN A;  4UI8 A;  3GJW A;  3P0P A;  4TKF A;  4BUU A;  4UI5 A;  4WIE A;  4WL8 A;  4TK5 A;  4BJB A;  5AL2 A;  5AL3 A;  4L6Z A;  4R5W A;  3PAX A;  4BU6 A;  1YLH A;  4PNM A;  5AL1 A;  1OEN A;  2PY7 X;  3UA9 A;  4BJC A;  4OQA C;  4DQY C;  4PJT A;  4GV0 A;  3U9Y A;  4XHU A;  4GV2 A;  4PNL A;  4L6S A;  4IUE A;  4UVT A;  4BU5 A;  3W51 A;  4HKK A;  4TKG A;  4R6E A;  1J3B A;  4W6E A;  4HLM A;  4OX2 A;  2OLR A;  4KRS A;  2RF5 A;  4BUE A;  4UVV A;  4BUV A;  4HKI A;  2QF1 A;  2PAX A;  5ETY A;  5LYH A;  4GNQ A;  4LI7 A;  4KZL A;  3MHJ A;  1PAX A;  2QZY A;  2QF2 A;  1II2 A;  5AKW A;  4HL5 A;  4L10 A;  4GV7 A;  2RKA A;  4HLH A;  4L34 A;  3KCZ A;  4PY4 A;  4TOS A;  4ZZY A;  3L3M A;  4UVO A;  4BU9 A;  4L0B A;  5LXP A;  4UVS A;  4WOU A;  5C5R A;  2RKD A;  4L09 A;  5FH1 A;  5ADT A;  3BLJ A;  4TJU A;  3DT4 A;  4OPX C;  4KZQ A;  4UVP A;  1AYL A;  1KHG A;  1NHX A;  3KJD A;  4I9I A;  4R43 A;  4UVZ A;  3MOE A;  4UW1 A;  4UXB A;  4BUI A;  4GNP A;  4BUX A;  2X5Y A;  4PJV A;  4WPV A;  5FPF A;  5AEH A;  4HHY A;  4GMU A;  4J3L A;  4J1Z A;  4F1L A;  1K3C A;  2PC9 A;  4UHG A;  4L7L A;  4F0E A;  3FHB A;  4BUF A;  4UVN A;  4BU8 A;  4W5I A;  3P0Q A;  4GNO A;  4L7U A;  4OQB C;  2OLQ A;  4L0S A;  4K4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...