4BUAA

Crystal structure of human tankyrase 2 in complex with 2-(4-(methylsulfanyl)phenyl)-3,4-dihydroquinazolin-4-one
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buaA00
4KRSA 4L0BA 4F0EA 1UK0A 4MT9A 4L7UA 4UVTA 4BUAA 4DQYC 4BU8A 4J21A 4TJUA 4BUIA 4TKGA 4M7BA 4BUSA 4BUDA 4HHYA 5C5RA 4HKIA 4UI5A 4HLGA 4L34A 4UI7A 4BU7A 4UW1A 3KR7A 2RCWA 4HLMA 3U9YA 4BJ9A 1WOKA 5AKWA 4DVIA 4L31A 4L2GA 4J3LA 4UI3A 4OPXC 4F1LA 4K4FA 4L2KA 4LI6A 4TOSA 4LI7A 4HYFA 4L7NA 4UVXA 4TKFA 4J1ZA 3W51A 5A00A 4BS4A 5LYHA 5ADTA 4AVUA 4TK0A 5ADQA 4AVWA 4L7PA 4L0IA 5C5QA 4UVNA 3P0NA 4UVZA 5ECEA 4PNSA 4MSGA 4L70A 4HHZA 5ADRA 4GV0A 4BUEA 4KZQA 5AL3A 4UI6A 4BU5A 5AKUA 3C49A 3GOYA 3MHJA 1GS0A 4BJBA 4PMLA 3L3MA 4TJWA 4KZLA 4UXBA 4ZZZA 4GV7A 4UI4A 2RD6A 5AEHA 4PJVA 5FPFA 4W5SA 4PNLA 5AL4A 4BU6A 4PNRA 4PNTA 3L3LA 1EFYA 4HKNA 4IUEA 4L2FA 4BUWA 4TORA 4W6EA 4GV2A 4J22A 4F1QA 2PAXA 4BUVA 4J3MA 4UNDA 1PAXA 4OA7A 4XHUA 5LX6A 4UVSA 4ZZXA 4LI8A 3SMIA 4UVOA 1UK1A 3KJDA 4TK5A 4UVYA 4L6SA 4L0VA 4BU3A 4HL5A 5EBTA 4BUTA 4PNQA 4L09A 3GEYA 3UDDA 3PAXA 4L7LA 4TVJA 3GN7A 4L33A 3SE2A 4UVLA 4GV4A 4R5WA 4L7RA 4U6AA 3MHKA 4I9IA 3KR8A 4PNNA 4HMHA 4L10A 3GJWA 3HKVA 3CE0A 4PAXA 3C4HA 4N3RA 4PY4A 2X5YA 3SMJA 4HLFA 4UVVA 3U9HA 5ETYA 4HLKA 1A26A 3FHBA 4UVPA 3P0PA 4L7OA 4X52A 2PQFA 2RF5A 5AL1A 5AL5A 4UUHA 4TJYA 4K4EA 4TKIA 5FPGA 4UVWA 4ZZYA 3KCZA 4UI8A 4BUYA 4HLHA 4L6ZA 4UX4A 4N4VA 5C5PA 4PNMA 3BLJA 5LXPA 3UH4A 5AL2A 4BU9A 4N4TA 4UFYA 4BJCA 3UA9A 3P0QA 4UHGA 4BFPA 4OQBC 4BUUA 4MSKA 4KZUA 4R6EA 5DCZA 4BUFA 4L0TA 4BUXA 4W5IA 4HKKA 3UH2A 4OQAC 4UFUA 2PAWA 4L0SA 4L32A 4UVUA 4RV6A 4PJTA 5ADSA
chains in the Genus database with same CATH superfamily
3MOEA 4KRSA 4RCGA 4L0BA 1YTMA 4F0EA 1UK0A 4GMMA 2QZYA 4L7UA 4MT9A 4UVTA 4BUAA 4DQYC 4BU8A 2PY7X 4J21A 4TJUA 4GNOA 5FH2A 4BUIA 4TKGA 4M7BA 4BUSA 4BUDA 4HHYA 5C5RA 4YWDA 4HKIA 4UI5A 4WOUA 4HLGA 4L34A 4UI7A 5LX6A 4BU7A 4UW1A 3KR7A 2RCWA 2FAHA 2RKEA 4HLMA 3U9YA 1WOKA 5AKWA 4BJ9A 4DVIA 4L31A 4WIUA 4L2GA 4J3LA 4UI3A 4OPXC 4F1LA 4K4FA 3MOFA 4L2KA 4GMZA 4LI6A 4TOSA 4LI7A 4HYFA 4L7NA 4UVXA 4TKFA 4J1ZA 4GNQA 5A00A 3W51A 4BS4A 5I67A 5ADTA 4AVUA 4TK0A 3DT7A 4AVWA 4L7PA 4L0IA 5C5QA 5ADQA 4UVNA 3P0NA 4UVZA 5ECEA 4PNSA 2RK7A 4MSGA 3DTBA 4L70A 4HHZA 2QF2A 1AQ2A 5ADRA 2QEYA 4GV0A 5FH0A 4BUEA 4KZQA 3DT4A 4UI6A 5AL3A 4YWBA 2OLRA 4WPUA 4BU5A 2QF1A 5AKUA 3C49A 1KHBA 3GOYA 3MHJA 1GS0A 4BJBA 4PMLA 2ZCIA 3L3MA 4TJWA 4KZLA 4UXBA 4ZZZA 4GV7A 4UI4A 2RD6A 5AEHA 1YVYA 4GNPA 4PJVA 5FPFA 4W5SA 4PNLA 5AL4A 4BU6A 5FH5A 4PNRA 4PNTA 3L3LA 1EFYA 4HKNA 4IUEA 4L2FA 4BUWA 4TORA 4W6EA 4GV2A 4J22A 4F1QA 2PAXA 4OX2A 4J3MA 4UNDA 1PAXA 4OA7A 2QEWA 1XKVA 4XHUA 4BUVA 4UVSA 4WIEA 4ZZXA 2PXZX 4LI8A 3SMIA 1NHXA 4UVOA 1UK1A 4R43A 5FH4A 3KJDA 4TK5A 4UVYA 4L6SA 4L0VA 4BU3A 4HL5A 5EBTA 4BUTA 1M51A 4PNQA 4L09A 3GEYA 3UDDA 5FH3A 4YW9A 3PAXA 4L7LA 1K3CA 1K3DA 4TVJA 1AYLA 3GN7A 4L33A 3SE2A 4UVLA 4GV4A 1YGGA 4R5WA 4L7RA 4U6AA 3MHKA 2OLQA 4I9IA 3KR8A 4PNNA 4HMHA 4L10A 3DT2A 3GJWA 3HKVA 3CE0A 4PAXA 3C4HA 4N3RA 4PY4A 4WPTA 2X5YA 3SMJA 4HLFA 4UVVA 4YW8A 1II2A 5ETYA 3U9HA 1A26A 3FHBA 4HLKA 4UVPA 3P0PA 4L7OA 4WL8A 4X52A 2PC9A 2PQFA 2RK8A 2RF5A 5AL1A 5AL5A 4UUHA 4TJYA 4K4EA 5LYHA 4TKIA 5FPGA 4WPVA 4UVWA 4ZZYA 2RKAA 3KCZA 4UI8A 4BUYA 4GMWA 4HLHA 4L6ZA 4UX4A 4N4VA 5C5PA 4GNMA 4PNMA 3BLJA 4GNLA 3UH4A 5LXPA 2GMVA 5AL2A 4BU9A 4GMUA 4N4TA 4UFYA 4BJCA 3UA9A 5FH1A 3MOHA 3P0QA 4BFPA 4UHGA 4OQBC 4BUUA 4MSKA 4KZUA 1YLHA 2FAFA 4R6EA 1J3BA 5DCZA 4BUFA 1OS1A 1KHEA 4L0TA 4BUXA 4W5IA 1KHFA 4HKKA 1KHGA 3UH2A 4UFUA 2PAWA 4L0SA 1OENA 4L32A 4UVUA 4OQAC 4RV6A 4PJTA 2RKDA 5ADSA
chains in the Genus database with same CATH topology
3MOEA 4KRSA 4RCGA 4L0BA 1YTMA 4F0EA 1UK0A 4GMMA 2QZYA 4L7UA 4MT9A 4UVTA 4BUAA 4DQYC 4BU8A 2PY7X 4J21A 4TJUA 4GNOA 5FH2A 4BUIA 4TKGA 4M7BA 4BUSA 4BUDA 4HHYA 5C5RA 4YWDA 4HKIA 4UI5A 4WOUA 4HLGA 4L34A 4UI7A 5LX6A 4BU7A 4UW1A 3KR7A 2RCWA 2FAHA 2RKEA 4HLMA 3U9YA 1WOKA 5AKWA 4BJ9A 4DVIA 4L31A 4WIUA 4L2GA 4J3LA 4UI3A 4OPXC 4F1LA 4K4FA 3MOFA 4L2KA 4GMZA 4LI6A 4TOSA 4LI7A 4HYFA 4L7NA 4UVXA 4TKFA 4J1ZA 4GNQA 5A00A 3W51A 4BS4A 5I67A 5ADTA 4AVUA 4TK0A 3DT7A 4AVWA 4L7PA 4L0IA 5C5QA 5ADQA 4UVNA 3P0NA 4UVZA 5ECEA 4PNSA 2RK7A 4MSGA 3DTBA 4L70A 4HHZA 2QF2A 1AQ2A 5ADRA 2QEYA 4GV0A 5FH0A 4BUEA 4KZQA 3DT4A 4UI6A 5AL3A 4YWBA 2OLRA 4WPUA 4BU5A 2QF1A 5AKUA 3C49A 1KHBA 3GOYA 3MHJA 1GS0A 4BJBA 4PMLA 2ZCIA 3L3MA 4TJWA 4KZLA 4UXBA 4ZZZA 4GV7A 4UI4A 2RD6A 5AEHA 1YVYA 4GNPA 4PJVA 5FPFA 4W5SA 4PNLA 5AL4A 4BU6A 5FH5A 4PNRA 4PNTA 3L3LA 1EFYA 4HKNA 4IUEA 4L2FA 4BUWA 4TORA 4W6EA 4GV2A 4J22A 4F1QA 2PAXA 4OX2A 4J3MA 4UNDA 1PAXA 4OA7A 2QEWA 1XKVA 4XHUA 4BUVA 4UVSA 4WIEA 4ZZXA 2PXZX 4LI8A 3SMIA 1NHXA 4UVOA 1UK1A 4R43A 5FH4A 3KJDA 4TK5A 4UVYA 4L6SA 4L0VA 4BU3A 4HL5A 5EBTA 4BUTA 1M51A 4PNQA 4L09A 3GEYA 3UDDA 5FH3A 4YW9A 3PAXA 4L7LA 1K3CA 1K3DA 4TVJA 1AYLA 3GN7A 4L33A 3SE2A 4UVLA 4GV4A 1YGGA 4R5WA 4L7RA 4U6AA 3MHKA 2OLQA 4I9IA 3KR8A 4PNNA 4HMHA 4L10A 3DT2A 3GJWA 3HKVA 3CE0A 4PAXA 3C4HA 4N3RA 4PY4A 4WPTA 2X5YA 3SMJA 4HLFA 4UVVA 4YW8A 1II2A 5ETYA 3U9HA 1A26A 3FHBA 4HLKA 4UVPA 3P0PA 4L7OA 4WL8A 4X52A 2PC9A 2PQFA 2RK8A 2RF5A 5AL1A 5AL5A 4UUHA 4TJYA 4K4EA 5LYHA 4TKIA 5FPGA 4WPVA 4UVWA 4ZZYA 2RKAA 3KCZA 4UI8A 4BUYA 4GMWA 4HLHA 4L6ZA 4UX4A 4N4VA 5C5PA 4GNMA 4PNMA 3BLJA 4GNLA 3UH4A 5LXPA 2GMVA 5AL2A 4BU9A 4GMUA 4N4TA 4UFYA 4BJCA 3UA9A 5FH1A 3MOHA 3P0QA 4BFPA 4UHGA 4OQBC 4BUUA 4MSKA 4KZUA 1YLHA 2FAFA 4R6EA 1J3BA 5DCZA 4BUFA 1OS1A 1KHEA 4L0TA 4BUXA 4W5IA 1KHFA 4HKKA 1KHGA 3UH2A 4UFUA 2PAWA 4L0SA 1OENA 4L32A 4UVUA 4OQAC 4RV6A 4PJTA 2RKDA 5ADSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KRS A;  4L0B A;  4F0E A;  1UK0 A;  4MT9 A;  4L7U A;  4UVT A;  4BUA A;  4DQY C;  4BU8 A;  4J21 A;  4TJU A;  4BUI A;  4TKG A;  4M7B A;  4BUS A;  4BUD A;  4HHY A;  5C5R A;  4HKI A;  4UI5 A;  4HLG A;  4L34 A;  4UI7 A;  4BU7 A;  4UW1 A;  3KR7 A;  2RCW A;  4HLM A;  3U9Y A;  4BJ9 A;  1WOK A;  5AKW A;  4DVI A;  4L31 A;  4L2G A;  4J3L A;  4UI3 A;  4OPX C;  4F1L A;  4K4F A;  4L2K A;  4LI6 A;  4TOS A;  4LI7 A;  4HYF A;  4L7N A;  4UVX A;  4TKF A;  4J1Z A;  3W51 A;  5A00 A;  4BS4 A;  5LYH A;  5ADT A;  4AVU A;  4TK0 A;  5ADQ A;  4AVW A;  4L7P A;  4L0I A;  5C5Q A;  4UVN A;  3P0N A;  4UVZ A;  5ECE A;  4PNS A;  4MSG A;  4L70 A;  4HHZ A;  5ADR A;  4GV0 A;  4BUE A;  4KZQ A;  5AL3 A;  4UI6 A;  4BU5 A;  5AKU A;  3C49 A;  3GOY A;  3MHJ A;  1GS0 A;  4BJB A;  4PML A;  3L3M A;  4TJW A;  4KZL A;  4UXB A;  4ZZZ A;  4GV7 A;  4UI4 A;  2RD6 A;  5AEH A;  4PJV A;  5FPF A;  4W5S A;  4PNL A;  5AL4 A;  4BU6 A;  4PNR A;  4PNT A;  3L3L A;  1EFY A;  4HKN A;  4IUE A;  4L2F A;  4BUW A;  4TOR A;  4W6E A;  4GV2 A;  4J22 A;  4F1Q A;  2PAX A;  4BUV A;  4J3M A;  4UND A;  1PAX A;  4OA7 A;  4XHU A;  5LX6 A;  4UVS A;  4ZZX A;  4LI8 A;  3SMI A;  4UVO A;  1UK1 A;  3KJD A;  4TK5 A;  4UVY A;  4L6S A;  4L0V A;  4BU3 A;  4HL5 A;  5EBT A;  4BUT A;  4PNQ A;  4L09 A;  3GEY A;  3UDD A;  3PAX A;  4L7L A;  4TVJ A;  3GN7 A;  4L33 A;  3SE2 A;  4UVL A;  4GV4 A;  4R5W A;  4L7R A;  4U6A A;  3MHK A;  4I9I A;  3KR8 A;  4PNN A;  4HMH A;  4L10 A;  3GJW A;  3HKV A;  3CE0 A;  4PAX A;  3C4H A;  4N3R A;  4PY4 A;  2X5Y A;  3SMJ A;  4HLF A;  4UVV A;  3U9H A;  5ETY A;  4HLK A;  1A26 A;  3FHB A;  4UVP A;  3P0P A;  4L7O A;  4X52 A;  2PQF A;  2RF5 A;  5AL1 A;  5AL5 A;  4UUH A;  4TJY A;  4K4E A;  4TKI A;  5FPG A;  4UVW A;  4ZZY A;  3KCZ A;  4UI8 A;  4BUY A;  4HLH A;  4L6Z A;  4UX4 A;  4N4V A;  5C5P A;  4PNM A;  3BLJ A;  5LXP A;  3UH4 A;  5AL2 A;  4BU9 A;  4N4T A;  4UFY A;  4BJC A;  3UA9 A;  3P0Q A;  4UHG A;  4BFP A;  4OQB C;  4BUU A;  4MSK A;  4KZU A;  4R6E A;  5DCZ A;  4BUF A;  4L0T A;  4BUX A;  4W5I A;  4HKK A;  3UH2 A;  4OQA C;  4UFU A;  2PAW A;  4L0S A;  4L32 A;  4UVU A;  4RV6 A;  4PJT A;  5ADS A; 
#chains in the Genus database with same CATH topology
 3MOE A;  4KRS A;  4RCG A;  4L0B A;  1YTM A;  4F0E A;  1UK0 A;  4GMM A;  2QZY A;  4L7U A;  4MT9 A;  4UVT A;  4BUA A;  4DQY C;  4BU8 A;  2PY7 X;  4J21 A;  4TJU A;  4GNO A;  5FH2 A;  4BUI A;  4TKG A;  4M7B A;  4BUS A;  4BUD A;  4HHY A;  5C5R A;  4YWD A;  4HKI A;  4UI5 A;  4WOU A;  4HLG A;  4L34 A;  4UI7 A;  5LX6 A;  4BU7 A;  4UW1 A;  3KR7 A;  2RCW A;  2FAH A;  2RKE A;  4HLM A;  3U9Y A;  1WOK A;  5AKW A;  4BJ9 A;  4DVI A;  4L31 A;  4WIU A;  4L2G A;  4J3L A;  4UI3 A;  4OPX C;  4F1L A;  4K4F A;  3MOF A;  4L2K A;  4GMZ A;  4LI6 A;  4TOS A;  4LI7 A;  4HYF A;  4L7N A;  4UVX A;  4TKF A;  4J1Z A;  4GNQ A;  5A00 A;  3W51 A;  4BS4 A;  5I67 A;  5ADT A;  4AVU A;  4TK0 A;  3DT7 A;  4AVW A;  4L7P A;  4L0I A;  5C5Q A;  5ADQ A;  4UVN A;  3P0N A;  4UVZ A;  5ECE A;  4PNS A;  2RK7 A;  4MSG A;  3DTB A;  4L70 A;  4HHZ A;  2QF2 A;  1AQ2 A;  5ADR A;  2QEY A;  4GV0 A;  5FH0 A;  4BUE A;  4KZQ A;  3DT4 A;  4UI6 A;  5AL3 A;  4YWB A;  2OLR A;  4WPU A;  4BU5 A;  2QF1 A;  5AKU A;  3C49 A;  1KHB A;  3GOY A;  3MHJ A;  1GS0 A;  4BJB A;  4PML A;  2ZCI A;  3L3M A;  4TJW A;  4KZL A;  4UXB A;  4ZZZ A;  4GV7 A;  4UI4 A;  2RD6 A;  5AEH A;  1YVY A;  4GNP A;  4PJV A;  5FPF A;  4W5S A;  4PNL A;  5AL4 A;  4BU6 A;  5FH5 A;  4PNR A;  4PNT A;  3L3L A;  1EFY A;  4HKN A;  4IUE A;  4L2F A;  4BUW A;  4TOR A;  4W6E A;  4GV2 A;  4J22 A;  4F1Q A;  2PAX A;  4OX2 A;  4J3M A;  4UND A;  1PAX A;  4OA7 A;  2QEW A;  1XKV A;  4XHU A;  4BUV A;  4UVS A;  4WIE A;  4ZZX A;  2PXZ X;  4LI8 A;  3SMI A;  1NHX A;  4UVO A;  1UK1 A;  4R43 A;  5FH4 A;  3KJD A;  4TK5 A;  4UVY A;  4L6S A;  4L0V A;  4BU3 A;  4HL5 A;  5EBT A;  4BUT A;  1M51 A;  4PNQ A;  4L09 A;  3GEY A;  3UDD A;  5FH3 A;  4YW9 A;  3PAX A;  4L7L A;  1K3C A;  1K3D A;  4TVJ A;  1AYL A;  3GN7 A;  4L33 A;  3SE2 A;  4UVL A;  4GV4 A;  1YGG A;  4R5W A;  4L7R A;  4U6A A;  3MHK A;  2OLQ A;  4I9I A;  3KR8 A;  4PNN A;  4HMH A;  4L10 A;  3DT2 A;  3GJW A;  3HKV A;  3CE0 A;  4PAX A;  3C4H A;  4N3R A;  4PY4 A;  4WPT A;  2X5Y A;  3SMJ A;  4HLF A;  4UVV A;  4YW8 A;  1II2 A;  5ETY A;  3U9H A;  1A26 A;  3FHB A;  4HLK A;  4UVP A;  3P0P A;  4L7O A;  4WL8 A;  4X52 A;  2PC9 A;  2PQF A;  2RK8 A;  2RF5 A;  5AL1 A;  5AL5 A;  4UUH A;  4TJY A;  4K4E A;  5LYH A;  4TKI A;  5FPG A;  4WPV A;  4UVW A;  4ZZY A;  2RKA A;  3KCZ A;  4UI8 A;  4BUY A;  4GMW A;  4HLH A;  4L6Z A;  4UX4 A;  4N4V A;  5C5P A;  4GNM A;  4PNM A;  3BLJ A;  4GNL A;  3UH4 A;  5LXP A;  2GMV A;  5AL2 A;  4BU9 A;  4GMU A;  4N4T A;  4UFY A;  4BJC A;  3UA9 A;  5FH1 A;  3MOH A;  3P0Q A;  4BFP A;  4UHG A;  4OQB C;  4BUU A;  4MSK A;  4KZU A;  1YLH A;  2FAF A;  4R6E A;  1J3B A;  5DCZ A;  4BUF A;  1OS1 A;  1KHE A;  4L0T A;  4BUX A;  4W5I A;  1KHF A;  4HKK A;  1KHG A;  3UH2 A;  4UFU A;  2PAW A;  4L0S A;  1OEN A;  4L32 A;  4UVU A;  4OQA C;  4RV6 A;  4PJT A;  2RKD A;  5ADS A; 
#chains in the Genus database with same CATH homology
 3MOE A;  4KRS A;  4RCG A;  4L0B A;  1YTM A;  4F0E A;  1UK0 A;  4GMM A;  2QZY A;  4L7U A;  4MT9 A;  4UVT A;  4BUA A;  4DQY C;  4BU8 A;  2PY7 X;  4J21 A;  4TJU A;  4GNO A;  5FH2 A;  4BUI A;  4TKG A;  4M7B A;  4BUS A;  4BUD A;  4HHY A;  5C5R A;  4YWD A;  4HKI A;  4UI5 A;  4WOU A;  4HLG A;  4L34 A;  4UI7 A;  5LX6 A;  4BU7 A;  4UW1 A;  3KR7 A;  2RCW A;  2FAH A;  2RKE A;  4HLM A;  3U9Y A;  1WOK A;  5AKW A;  4BJ9 A;  4DVI A;  4L31 A;  4WIU A;  4L2G A;  4J3L A;  4UI3 A;  4OPX C;  4F1L A;  4K4F A;  3MOF A;  4L2K A;  4GMZ A;  4LI6 A;  4TOS A;  4LI7 A;  4HYF A;  4L7N A;  4UVX A;  4TKF A;  4J1Z A;  4GNQ A;  5A00 A;  3W51 A;  4BS4 A;  5I67 A;  5ADT A;  4AVU A;  4TK0 A;  3DT7 A;  4AVW A;  4L7P A;  4L0I A;  5C5Q A;  5ADQ A;  4UVN A;  3P0N A;  4UVZ A;  5ECE A;  4PNS A;  2RK7 A;  4MSG A;  3DTB A;  4L70 A;  4HHZ A;  2QF2 A;  1AQ2 A;  5ADR A;  2QEY A;  4GV0 A;  5FH0 A;  4BUE A;  4KZQ A;  3DT4 A;  4UI6 A;  5AL3 A;  4YWB A;  2OLR A;  4WPU A;  4BU5 A;  2QF1 A;  5AKU A;  3C49 A;  1KHB A;  3GOY A;  3MHJ A;  1GS0 A;  4BJB A;  4PML A;  2ZCI A;  3L3M A;  4TJW A;  4KZL A;  4UXB A;  4ZZZ A;  4GV7 A;  4UI4 A;  2RD6 A;  5AEH A;  1YVY A;  4GNP A;  4PJV A;  5FPF A;  4W5S A;  4PNL A;  5AL4 A;  4BU6 A;  5FH5 A;  4PNR A;  4PNT A;  3L3L A;  1EFY A;  4HKN A;  4IUE A;  4L2F A;  4BUW A;  4TOR A;  4W6E A;  4GV2 A;  4J22 A;  4F1Q A;  2PAX A;  4OX2 A;  4J3M A;  4UND A;  1PAX A;  4OA7 A;  2QEW A;  1XKV A;  4XHU A;  4BUV A;  4UVS A;  4WIE A;  4ZZX A;  2PXZ X;  4LI8 A;  3SMI A;  1NHX A;  4UVO A;  1UK1 A;  4R43 A;  5FH4 A;  3KJD A;  4TK5 A;  4UVY A;  4L6S A;  4L0V A;  4BU3 A;  4HL5 A;  5EBT A;  4BUT A;  1M51 A;  4PNQ A;  4L09 A;  3GEY A;  3UDD A;  5FH3 A;  4YW9 A;  3PAX A;  4L7L A;  1K3C A;  1K3D A;  4TVJ A;  1AYL A;  3GN7 A;  4L33 A;  3SE2 A;  4UVL A;  4GV4 A;  1YGG A;  4R5W A;  4L7R A;  4U6A A;  3MHK A;  2OLQ A;  4I9I A;  3KR8 A;  4PNN A;  4HMH A;  4L10 A;  3DT2 A;  3GJW A;  3HKV A;  3CE0 A;  4PAX A;  3C4H A;  4N3R A;  4PY4 A;  4WPT A;  2X5Y A;  3SMJ A;  4HLF A;  4UVV A;  4YW8 A;  1II2 A;  5ETY A;  3U9H A;  1A26 A;  3FHB A;  4HLK A;  4UVP A;  3P0P A;  4L7O A;  4WL8 A;  4X52 A;  2PC9 A;  2PQF A;  2RK8 A;  2RF5 A;  5AL1 A;  5AL5 A;  4UUH A;  4TJY A;  4K4E A;  5LYH A;  4TKI A;  5FPG A;  4WPV A;  4UVW A;  4ZZY A;  2RKA A;  3KCZ A;  4UI8 A;  4BUY A;  4GMW A;  4HLH A;  4L6Z A;  4UX4 A;  4N4V A;  5C5P A;  4GNM A;  4PNM A;  3BLJ A;  4GNL A;  3UH4 A;  5LXP A;  2GMV A;  5AL2 A;  4BU9 A;  4GMU A;  4N4T A;  4UFY A;  4BJC A;  3UA9 A;  5FH1 A;  3MOH A;  3P0Q A;  4BFP A;  4UHG A;  4OQB C;  4BUU A;  4MSK A;  4KZU A;  1YLH A;  2FAF A;  4R6E A;  1J3B A;  5DCZ A;  4BUF A;  1OS1 A;  1KHE A;  4L0T A;  4BUX A;  4W5I A;  1KHF A;  4HKK A;  1KHG A;  3UH2 A;  4UFU A;  2PAW A;  4L0S A;  1OEN A;  4L32 A;  4UVU A;  4OQA C;  4RV6 A;  4PJT A;  2RKD A;  5ADS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...