4BUDA

Crystal structure of human tankyrase 2 in complex with 2-(4-tert- butylphenyl)-1,4-dihydroquinazolin-4-one
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 64
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4budA00
3U9HA 4HLKA 4HKKA 4TKIA 4BS4A 3SMIA 4BUTA 4PJTA 4UVOA 1PAXA 1WOKA 5AL4A 4L0SA 1A26A 4BU5A 2RF5A 3SMJA 4UVVA 4AVUA 4TKGA 4RV6A 4HLGA 3GJWA 4PNSA 4TVJA 5AL5A 4BUFA 4KZQA 4TORA 3PAXA 4L31A 4BUYA 4HLHA 5EBTA 5ECEA 4HHZA 5AKUA 4UI6A 4DQYC 4PY4A 3UA9A 4L6SA 4UI4A 4BU7A 3GEYA 4BUUA 4J3LA 4PNLA 4ZZZA 3FHBA 3UDDA 4UVTA 3KJDA 3UH2A 4ZZXA 3P0NA 3C49A 4J1ZA 3MHJA 4IUEA 4LI8A 4BUWA 4BUSA 4L32A 4F1QA 4L2KA 4N4TA 4HKIA 4UVXA 1EFYA 4OA7A 4OQAC 4R6EA 4BFPA 4BUDA 4UVPA 4PAXA 4BUXA 4L6ZA 1UK1A 4MT9A 3L3LA 5C5PA 5ADQA 3C4HA 4DVIA 3CE0A 3U9YA 4K4FA 3KCZA 4HHYA 4J3MA 5C5QA 5DCZA 5AL2A 4L7PA 2X5YA 4HKNA 4UVUA 4LI7A 5AKWA 4L7RA 4TOSA 4TJYA 4KZUA 4UI3A 4HL5A 4J22A 4PNRA 5FPGA 4UHGA 4UVNA 4N4VA 4L10A 4UFUA 5A00A 3MHKA 3L3MA 3KR8A 4HLMA 4L70A 4PMLA 3UH4A 5LYHA 5AL1A 4L2GA 5LXPA 3GOYA 4U6AA 4UX4A 4BJCA 4UI5A 4UVZA 2PAWA 4X52A 4BU3A 4PNQA 4W6EA 5LX6A 4KZLA 4PNTA 4OQBC 4HMHA 4M7BA 4TK5A 4KRSA 4BJ9A 4LI6A 4L7LA 4UXBA 2PAXA 3HKVA 4GV0A 4L0TA 4BJBA 4R5WA 4L0BA 4BUEA 4UVWA 3KR7A 4GV7A 4L33A 4I9IA 4L7OA 4L7NA 4F1LA 4K4EA 4TJWA 4UFYA 5FPFA 4PJVA 4HLFA 4BU6A 4L2FA 4XHUA 4BU8A 5C5RA 4OPXC 4UVSA 4UW1A 4UUHA 3W51A 5ADTA 5ETYA 4TJUA 4UNDA 4PNMA 1GS0A 4L09A 4BUAA 4ZZYA 4L0IA 4TKFA 2PQFA 4J21A 1UK0A 5ADRA 4F0EA 4AVWA 4MSKA 4BUVA 4L34A 4UVYA 4UVLA 4UI8A 4N3RA 4TK0A 4W5SA 4GV2A 4L0VA 5ADSA 3GN7A 4GV4A 4HYFA 4W5IA 2RD6A 4BU9A 4L7UA 5AL3A 4PNNA 5AEHA 4MSGA 4UI7A 3SE2A 3P0PA 4BUIA 3BLJA 2RCWA 3P0QA
chains in the Genus database with same CATH superfamily
3U9HA 4HLKA 1II2A 3DT2A 4HKKA 4TKIA 3MOEA 3SMIA 4BS4A 4BUTA 2RK7A 4PJTA 4UVOA 1PAXA 1WOKA 5AL4A 4GNOA 4GNQA 1A26A 4L0SA 4BU5A 2RF5A 3DT7A 4WPVA 4UVVA 3SMJA 4TKGA 4AVUA 4RV6A 2RKAA 3GJWA 4HLGA 4PNSA 4GMUA 4TVJA 5AL5A 4KZQA 4BUFA 1XKVA 1KHGA 3PAXA 4TORA 4L31A 4WIEA 4BUYA 4HLHA 4RCGA 5EBTA 5ECEA 4HHZA 5AKUA 1AQ2A 4UI6A 4DQYC 4PY4A 1OS1A 5FH4A 4L6SA 4UI4A 3UA9A 3GEYA 4BU7A 4BUUA 4J3LA 4PNLA 4ZZZA 3FHBA 3UDDA 4UVTA 3KJDA 3UH2A 4ZZXA 3P0NA 3C49A 4J1ZA 3MHJA 4IUEA 4LI8A 5FH1A 4BUWA 4WIUA 4BUSA 1K3DA 4L32A 4F1QA 4L2KA 4N4TA 4HKIA 4UVXA 2ZCIA 1EFYA 4OA7A 4OQAC 4R6EA 4BFPA 4BUDA 4UVPA 4PAXA 3DTBA 4BUXA 4L6ZA 1UK1A 2QEYA 4MT9A 3L3LA 5C5PA 4WPTA 5ADQA 3C4HA 4DVIA 3CE0A 4OX2A 4K4FA 3U9YA 3KCZA 4HHYA 3DT4A 4J3MA 5DCZA 5C5QA 5AL2A 4L7PA 2X5YA 5FH5A 4YWBA 4HKNA 4UVUA 4LI7A 2QEWA 5AKWA 4L7RA 4TOSA 2PXZX 4GMZA 4KZUA 4TJYA 4UI3A 4HL5A 4J22A 4PNRA 5FPGA 4UHGA 4UVNA 4N4VA 2PC9A 4L10A 4UFUA 5A00A 3MHKA 1OENA 3L3MA 2QF1A 2RCWA 3KR8A 1YVYA 4HLMA 4L70A 4PMLA 3UH4A 5LYHA 5AL1A 1J3BA 1YGGA 4R43A 4L2GA 5FH0A 5LXPA 3GOYA 4U6AA 4UX4A 4BJCA 4UI5A 4UVZA 2PAWA 4X52A 4BU3A 4PNQA 5FH3A 4WOUA 2QZYA 4W6EA 4GNMA 5LX6A 4KZLA 4PNTA 4OQBC 2PY7X 4HMHA 4M7BA 4TK5A 4WL8A 4KRSA 4BJ9A 1NHXA 4LI6A 4L7LA 2FAHA 4UXBA 2PAXA 5I67A 3HKVA 4GV0A 4L0TA 4BJBA 4R5WA 4L0BA 4BUEA 4YW8A 2FAFA 4UVWA 1YLHA 3KR7A 4GV7A 4L33A 2QF2A 4I9IA 1KHFA 4L7OA 4K4EA 4L7NA 4TJWA 4UFYA 4GNPA 4HLFA 4PJVA 4F1LA 5FPFA 4BU6A 4L2FA 4GNLA 4XHUA 4BU8A 1KHEA 2RKEA 5C5RA 4OPXC 1M51A 4GMWA 4UVSA 4UW1A 2OLRA 4UUHA 4WPUA 2RKDA 3W51A 5ETYA 4TJUA 5ADTA 4UNDA 2RK8A 1GS0A 4L09A 1AYLA 4PNMA 4BUAA 4YWDA 2GMVA 4ZZYA 3MOFA 4L0IA 4TKFA 2PQFA 4J21A 1UK0A 5FH2A 1K3CA 5ADRA 4F0EA 1YTMA 4AVWA 4MSKA 4BUVA 4L34A 4UVYA 4UVLA 4UI8A 4GMMA 4N3RA 4TK0A 4W5SA 3MOHA 4GV2A 4L0VA 5ADSA 3GN7A 4GV4A 4HYFA 4W5IA 2RD6A 4BU9A 4L7UA 4YW9A 5AL3A 4PNNA 5AEHA 4MSGA 4UI7A 3SE2A 3P0PA 4BUIA 3BLJA 2OLQA 3P0QA 1KHBA
chains in the Genus database with same CATH topology
3U9HA 4HLKA 1II2A 3DT2A 4HKKA 4TKIA 3MOEA 3SMIA 4BS4A 4BUTA 2RK7A 4PJTA 4UVOA 1PAXA 1WOKA 5AL4A 4GNOA 4GNQA 1A26A 4L0SA 4BU5A 2RF5A 3DT7A 4WPVA 4UVVA 3SMJA 4TKGA 4AVUA 4RV6A 2RKAA 3GJWA 4HLGA 4PNSA 4GMUA 4TVJA 5AL5A 4KZQA 4BUFA 1XKVA 1KHGA 3PAXA 4TORA 4L31A 4WIEA 4BUYA 4HLHA 4RCGA 5EBTA 5ECEA 4HHZA 5AKUA 1AQ2A 4UI6A 4DQYC 4PY4A 1OS1A 5FH4A 4L6SA 4UI4A 3UA9A 3GEYA 4BU7A 4BUUA 4J3LA 4PNLA 4ZZZA 3FHBA 3UDDA 4UVTA 3KJDA 3UH2A 4ZZXA 3P0NA 3C49A 4J1ZA 3MHJA 4IUEA 4LI8A 5FH1A 4BUWA 4WIUA 4BUSA 1K3DA 4L32A 4F1QA 4L2KA 4N4TA 4HKIA 4UVXA 2ZCIA 1EFYA 4OA7A 4OQAC 4R6EA 4BFPA 4BUDA 4UVPA 4PAXA 3DTBA 4BUXA 4L6ZA 1UK1A 2QEYA 4MT9A 3L3LA 5C5PA 4WPTA 5ADQA 3C4HA 4DVIA 3CE0A 4OX2A 4K4FA 3U9YA 3KCZA 4HHYA 3DT4A 4J3MA 5DCZA 5C5QA 5AL2A 4L7PA 2X5YA 5FH5A 4YWBA 4HKNA 4UVUA 4LI7A 2QEWA 5AKWA 4L7RA 4TOSA 2PXZX 4GMZA 4KZUA 4TJYA 4UI3A 4HL5A 4J22A 4PNRA 5FPGA 4UHGA 4UVNA 4N4VA 2PC9A 4L10A 4UFUA 5A00A 3MHKA 1OENA 3L3MA 2QF1A 2RCWA 3KR8A 1YVYA 4HLMA 4L70A 4PMLA 3UH4A 5LYHA 5AL1A 1J3BA 1YGGA 4R43A 4L2GA 5FH0A 5LXPA 3GOYA 4U6AA 4UX4A 4BJCA 4UI5A 4UVZA 2PAWA 4X52A 4BU3A 4PNQA 5FH3A 4WOUA 2QZYA 4W6EA 4GNMA 5LX6A 4KZLA 4PNTA 4OQBC 2PY7X 4HMHA 4M7BA 4TK5A 4WL8A 4KRSA 4BJ9A 1NHXA 4LI6A 4L7LA 2FAHA 4UXBA 2PAXA 5I67A 3HKVA 4GV0A 4L0TA 4BJBA 4R5WA 4L0BA 4BUEA 4YW8A 2FAFA 4UVWA 1YLHA 3KR7A 4GV7A 4L33A 2QF2A 4I9IA 1KHFA 4L7OA 4K4EA 4L7NA 4TJWA 4UFYA 4GNPA 4HLFA 4PJVA 4F1LA 5FPFA 4BU6A 4L2FA 4GNLA 4XHUA 4BU8A 1KHEA 2RKEA 5C5RA 4OPXC 1M51A 4GMWA 4UVSA 4UW1A 2OLRA 4UUHA 4WPUA 2RKDA 3W51A 5ETYA 4TJUA 5ADTA 4UNDA 2RK8A 1GS0A 4L09A 1AYLA 4PNMA 4BUAA 4YWDA 2GMVA 4ZZYA 3MOFA 4L0IA 4TKFA 2PQFA 4J21A 1UK0A 5FH2A 1K3CA 5ADRA 4F0EA 1YTMA 4AVWA 4MSKA 4BUVA 4L34A 4UVYA 4UVLA 4UI8A 4GMMA 4N3RA 4TK0A 4W5SA 3MOHA 4GV2A 4L0VA 5ADSA 3GN7A 4GV4A 4HYFA 4W5IA 2RD6A 4BU9A 4L7UA 4YW9A 5AL3A 4PNNA 5AEHA 4MSGA 4UI7A 3SE2A 3P0PA 4BUIA 3BLJA 2OLQA 3P0QA 1KHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9H A;  4HLK A;  4HKK A;  4TKI A;  4BS4 A;  3SMI A;  4BUT A;  4PJT A;  4UVO A;  1PAX A;  1WOK A;  5AL4 A;  4L0S A;  1A26 A;  4BU5 A;  2RF5 A;  3SMJ A;  4UVV A;  4AVU A;  4TKG A;  4RV6 A;  4HLG A;  3GJW A;  4PNS A;  4TVJ A;  5AL5 A;  4BUF A;  4KZQ A;  4TOR A;  3PAX A;  4L31 A;  4BUY A;  4HLH A;  5EBT A;  5ECE A;  4HHZ A;  5AKU A;  4UI6 A;  4DQY C;  4PY4 A;  3UA9 A;  4L6S A;  4UI4 A;  4BU7 A;  3GEY A;  4BUU A;  4J3L A;  4PNL A;  4ZZZ A;  3FHB A;  3UDD A;  4UVT A;  3KJD A;  3UH2 A;  4ZZX A;  3P0N A;  3C49 A;  4J1Z A;  3MHJ A;  4IUE A;  4LI8 A;  4BUW A;  4BUS A;  4L32 A;  4F1Q A;  4L2K A;  4N4T A;  4HKI A;  4UVX A;  1EFY A;  4OA7 A;  4OQA C;  4R6E A;  4BFP A;  4BUD A;  4UVP A;  4PAX A;  4BUX A;  4L6Z A;  1UK1 A;  4MT9 A;  3L3L A;  5C5P A;  5ADQ A;  3C4H A;  4DVI A;  3CE0 A;  3U9Y A;  4K4F A;  3KCZ A;  4HHY A;  4J3M A;  5C5Q A;  5DCZ A;  5AL2 A;  4L7P A;  2X5Y A;  4HKN A;  4UVU A;  4LI7 A;  5AKW A;  4L7R A;  4TOS A;  4TJY A;  4KZU A;  4UI3 A;  4HL5 A;  4J22 A;  4PNR A;  5FPG A;  4UHG A;  4UVN A;  4N4V A;  4L10 A;  4UFU A;  5A00 A;  3MHK A;  3L3M A;  3KR8 A;  4HLM A;  4L70 A;  4PML A;  3UH4 A;  5LYH A;  5AL1 A;  4L2G A;  5LXP A;  3GOY A;  4U6A A;  4UX4 A;  4BJC A;  4UI5 A;  4UVZ A;  2PAW A;  4X52 A;  4BU3 A;  4PNQ A;  4W6E A;  5LX6 A;  4KZL A;  4PNT A;  4OQB C;  4HMH A;  4M7B A;  4TK5 A;  4KRS A;  4BJ9 A;  4LI6 A;  4L7L A;  4UXB A;  2PAX A;  3HKV A;  4GV0 A;  4L0T A;  4BJB A;  4R5W A;  4L0B A;  4BUE A;  4UVW A;  3KR7 A;  4GV7 A;  4L33 A;  4I9I A;  4L7O A;  4L7N A;  4F1L A;  4K4E A;  4TJW A;  4UFY A;  5FPF A;  4PJV A;  4HLF A;  4BU6 A;  4L2F A;  4XHU A;  4BU8 A;  5C5R A;  4OPX C;  4UVS A;  4UW1 A;  4UUH A;  3W51 A;  5ADT A;  5ETY A;  4TJU A;  4UND A;  4PNM A;  1GS0 A;  4L09 A;  4BUA A;  4ZZY A;  4L0I A;  4TKF A;  2PQF A;  4J21 A;  1UK0 A;  5ADR A;  4F0E A;  4AVW A;  4MSK A;  4BUV A;  4L34 A;  4UVY A;  4UVL A;  4UI8 A;  4N3R A;  4TK0 A;  4W5S A;  4GV2 A;  4L0V A;  5ADS A;  3GN7 A;  4GV4 A;  4HYF A;  4W5I A;  2RD6 A;  4BU9 A;  4L7U A;  5AL3 A;  4PNN A;  5AEH A;  4MSG A;  4UI7 A;  3SE2 A;  3P0P A;  4BUI A;  3BLJ A;  2RCW A;  3P0Q A; 
#chains in the Genus database with same CATH topology
 3U9H A;  4HLK A;  1II2 A;  3DT2 A;  4HKK A;  4TKI A;  3MOE A;  3SMI A;  4BS4 A;  4BUT A;  2RK7 A;  4PJT A;  4UVO A;  1PAX A;  1WOK A;  5AL4 A;  4GNO A;  4GNQ A;  1A26 A;  4L0S A;  4BU5 A;  2RF5 A;  3DT7 A;  4WPV A;  4UVV A;  3SMJ A;  4TKG A;  4AVU A;  4RV6 A;  2RKA A;  3GJW A;  4HLG A;  4PNS A;  4GMU A;  4TVJ A;  5AL5 A;  4KZQ A;  4BUF A;  1XKV A;  1KHG A;  3PAX A;  4TOR A;  4L31 A;  4WIE A;  4BUY A;  4HLH A;  4RCG A;  5EBT A;  5ECE A;  4HHZ A;  5AKU A;  1AQ2 A;  4UI6 A;  4DQY C;  4PY4 A;  1OS1 A;  5FH4 A;  4L6S A;  4UI4 A;  3UA9 A;  3GEY A;  4BU7 A;  4BUU A;  4J3L A;  4PNL A;  4ZZZ A;  3FHB A;  3UDD A;  4UVT A;  3KJD A;  3UH2 A;  4ZZX A;  3P0N A;  3C49 A;  4J1Z A;  3MHJ A;  4IUE A;  4LI8 A;  5FH1 A;  4BUW A;  4WIU A;  4BUS A;  1K3D A;  4L32 A;  4F1Q A;  4L2K A;  4N4T A;  4HKI A;  4UVX A;  2ZCI A;  1EFY A;  4OA7 A;  4OQA C;  4R6E A;  4BFP A;  4BUD A;  4UVP A;  4PAX A;  3DTB A;  4BUX A;  4L6Z A;  1UK1 A;  2QEY A;  4MT9 A;  3L3L A;  5C5P A;  4WPT A;  5ADQ A;  3C4H A;  4DVI A;  3CE0 A;  4OX2 A;  4K4F A;  3U9Y A;  3KCZ A;  4HHY A;  3DT4 A;  4J3M A;  5DCZ A;  5C5Q A;  5AL2 A;  4L7P A;  2X5Y A;  5FH5 A;  4YWB A;  4HKN A;  4UVU A;  4LI7 A;  2QEW A;  5AKW A;  4L7R A;  4TOS A;  2PXZ X;  4GMZ A;  4KZU A;  4TJY A;  4UI3 A;  4HL5 A;  4J22 A;  4PNR A;  5FPG A;  4UHG A;  4UVN A;  4N4V A;  2PC9 A;  4L10 A;  4UFU A;  5A00 A;  3MHK A;  1OEN A;  3L3M A;  2QF1 A;  2RCW A;  3KR8 A;  1YVY A;  4HLM A;  4L70 A;  4PML A;  3UH4 A;  5LYH A;  5AL1 A;  1J3B A;  1YGG A;  4R43 A;  4L2G A;  5FH0 A;  5LXP A;  3GOY A;  4U6A A;  4UX4 A;  4BJC A;  4UI5 A;  4UVZ A;  2PAW A;  4X52 A;  4BU3 A;  4PNQ A;  5FH3 A;  4WOU A;  2QZY A;  4W6E A;  4GNM A;  5LX6 A;  4KZL A;  4PNT A;  4OQB C;  2PY7 X;  4HMH A;  4M7B A;  4TK5 A;  4WL8 A;  4KRS A;  4BJ9 A;  1NHX A;  4LI6 A;  4L7L A;  2FAH A;  4UXB A;  2PAX A;  5I67 A;  3HKV A;  4GV0 A;  4L0T A;  4BJB A;  4R5W A;  4L0B A;  4BUE A;  4YW8 A;  2FAF A;  4UVW A;  1YLH A;  3KR7 A;  4GV7 A;  4L33 A;  2QF2 A;  4I9I A;  1KHF A;  4L7O A;  4K4E A;  4L7N A;  4TJW A;  4UFY A;  4GNP A;  4HLF A;  4PJV A;  4F1L A;  5FPF A;  4BU6 A;  4L2F A;  4GNL A;  4XHU A;  4BU8 A;  1KHE A;  2RKE A;  5C5R A;  4OPX C;  1M51 A;  4GMW A;  4UVS A;  4UW1 A;  2OLR A;  4UUH A;  4WPU A;  2RKD A;  3W51 A;  5ETY A;  4TJU A;  5ADT A;  4UND A;  2RK8 A;  1GS0 A;  4L09 A;  1AYL A;  4PNM A;  4BUA A;  4YWD A;  2GMV A;  4ZZY A;  3MOF A;  4L0I A;  4TKF A;  2PQF A;  4J21 A;  1UK0 A;  5FH2 A;  1K3C A;  5ADR A;  4F0E A;  1YTM A;  4AVW A;  4MSK A;  4BUV A;  4L34 A;  4UVY A;  4UVL A;  4UI8 A;  4GMM A;  4N3R A;  4TK0 A;  4W5S A;  3MOH A;  4GV2 A;  4L0V A;  5ADS A;  3GN7 A;  4GV4 A;  4HYF A;  4W5I A;  2RD6 A;  4BU9 A;  4L7U A;  4YW9 A;  5AL3 A;  4PNN A;  5AEH A;  4MSG A;  4UI7 A;  3SE2 A;  3P0P A;  4BUI A;  3BLJ A;  2OLQ A;  3P0Q A;  1KHB A; 
#chains in the Genus database with same CATH homology
 3U9H A;  4HLK A;  1II2 A;  3DT2 A;  4HKK A;  4TKI A;  3MOE A;  3SMI A;  4BS4 A;  4BUT A;  2RK7 A;  4PJT A;  4UVO A;  1PAX A;  1WOK A;  5AL4 A;  4GNO A;  4GNQ A;  1A26 A;  4L0S A;  4BU5 A;  2RF5 A;  3DT7 A;  4WPV A;  4UVV A;  3SMJ A;  4TKG A;  4AVU A;  4RV6 A;  2RKA A;  3GJW A;  4HLG A;  4PNS A;  4GMU A;  4TVJ A;  5AL5 A;  4KZQ A;  4BUF A;  1XKV A;  1KHG A;  3PAX A;  4TOR A;  4L31 A;  4WIE A;  4BUY A;  4HLH A;  4RCG A;  5EBT A;  5ECE A;  4HHZ A;  5AKU A;  1AQ2 A;  4UI6 A;  4DQY C;  4PY4 A;  1OS1 A;  5FH4 A;  4L6S A;  4UI4 A;  3UA9 A;  3GEY A;  4BU7 A;  4BUU A;  4J3L A;  4PNL A;  4ZZZ A;  3FHB A;  3UDD A;  4UVT A;  3KJD A;  3UH2 A;  4ZZX A;  3P0N A;  3C49 A;  4J1Z A;  3MHJ A;  4IUE A;  4LI8 A;  5FH1 A;  4BUW A;  4WIU A;  4BUS A;  1K3D A;  4L32 A;  4F1Q A;  4L2K A;  4N4T A;  4HKI A;  4UVX A;  2ZCI A;  1EFY A;  4OA7 A;  4OQA C;  4R6E A;  4BFP A;  4BUD A;  4UVP A;  4PAX A;  3DTB A;  4BUX A;  4L6Z A;  1UK1 A;  2QEY A;  4MT9 A;  3L3L A;  5C5P A;  4WPT A;  5ADQ A;  3C4H A;  4DVI A;  3CE0 A;  4OX2 A;  4K4F A;  3U9Y A;  3KCZ A;  4HHY A;  3DT4 A;  4J3M A;  5DCZ A;  5C5Q A;  5AL2 A;  4L7P A;  2X5Y A;  5FH5 A;  4YWB A;  4HKN A;  4UVU A;  4LI7 A;  2QEW A;  5AKW A;  4L7R A;  4TOS A;  2PXZ X;  4GMZ A;  4KZU A;  4TJY A;  4UI3 A;  4HL5 A;  4J22 A;  4PNR A;  5FPG A;  4UHG A;  4UVN A;  4N4V A;  2PC9 A;  4L10 A;  4UFU A;  5A00 A;  3MHK A;  1OEN A;  3L3M A;  2QF1 A;  2RCW A;  3KR8 A;  1YVY A;  4HLM A;  4L70 A;  4PML A;  3UH4 A;  5LYH A;  5AL1 A;  1J3B A;  1YGG A;  4R43 A;  4L2G A;  5FH0 A;  5LXP A;  3GOY A;  4U6A A;  4UX4 A;  4BJC A;  4UI5 A;  4UVZ A;  2PAW A;  4X52 A;  4BU3 A;  4PNQ A;  5FH3 A;  4WOU A;  2QZY A;  4W6E A;  4GNM A;  5LX6 A;  4KZL A;  4PNT A;  4OQB C;  2PY7 X;  4HMH A;  4M7B A;  4TK5 A;  4WL8 A;  4KRS A;  4BJ9 A;  1NHX A;  4LI6 A;  4L7L A;  2FAH A;  4UXB A;  2PAX A;  5I67 A;  3HKV A;  4GV0 A;  4L0T A;  4BJB A;  4R5W A;  4L0B A;  4BUE A;  4YW8 A;  2FAF A;  4UVW A;  1YLH A;  3KR7 A;  4GV7 A;  4L33 A;  2QF2 A;  4I9I A;  1KHF A;  4L7O A;  4K4E A;  4L7N A;  4TJW A;  4UFY A;  4GNP A;  4HLF A;  4PJV A;  4F1L A;  5FPF A;  4BU6 A;  4L2F A;  4GNL A;  4XHU A;  4BU8 A;  1KHE A;  2RKE A;  5C5R A;  4OPX C;  1M51 A;  4GMW A;  4UVS A;  4UW1 A;  2OLR A;  4UUH A;  4WPU A;  2RKD A;  3W51 A;  5ETY A;  4TJU A;  5ADT A;  4UND A;  2RK8 A;  1GS0 A;  4L09 A;  1AYL A;  4PNM A;  4BUA A;  4YWD A;  2GMV A;  4ZZY A;  3MOF A;  4L0I A;  4TKF A;  2PQF A;  4J21 A;  1UK0 A;  5FH2 A;  1K3C A;  5ADR A;  4F0E A;  1YTM A;  4AVW A;  4MSK A;  4BUV A;  4L34 A;  4UVY A;  4UVL A;  4UI8 A;  4GMM A;  4N3R A;  4TK0 A;  4W5S A;  3MOH A;  4GV2 A;  4L0V A;  5ADS A;  3GN7 A;  4GV4 A;  4HYF A;  4W5I A;  2RD6 A;  4BU9 A;  4L7U A;  4YW9 A;  5AL3 A;  4PNN A;  5AEH A;  4MSG A;  4UI7 A;  3SE2 A;  3P0P A;  4BUI A;  3BLJ A;  2OLQ A;  3P0Q A;  1KHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...