4BUDA

Crystal structure of human tankyrase 2 in complex with 2-(4-tert- butylphenyl)-1,4-dihydroquinazolin-4-one
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4budA00
4TOSA 4UVNA 1EFYA 4BFPA 4IUEA 4PNTA 4N4VA 4TJUA 3BLJA 4PJVA 5ADSA 3W51A 4N3RA 4BUEA 4TORA 4HLHA 4OA7A 2PAWA 4BU9A 3CE0A 4F0EA 4L33A 3MHKA 4UFYA 3U9YA 4LI7A 3KCZA 4HLMA 3GJWA 3UA9A 4HLFA 4BU6A 3L3MA 4L31A 4BUAA 4GV2A 4MT9A 4L7OA 4J3MA 4UVWA 4OPXC 4TJWA 4BJCA 5AL2A 4KZUA 5ADTA 4DVIA 5C5PA 4UUHA 1PAXA 4UI6A 4HMHA 2PAXA 4LI6A 4PJTA 4L6ZA 4L0VA 4BUTA 4L09A 4BUXA 4L2KA 3KR7A 4HLGA 4UI5A 4UVUA 5AL4A 4J21A 4L7NA 4L0SA 4M7BA 4TVJA 4UI7A 1WOKA 4BS4A 4HHYA 4L70A 4PNQA 4UI3A 5FPGA 4I9IA 4BU8A 5ADQA 2RCWA 4J22A 4X52A 4K4EA 5EBTA 4UVTA 4BU7A 5LYHA 4PY4A 5FPFA 4UX4A 4J1ZA 4GV4A 4OQBC 4L34A 4L0BA 3UH2A 4PAXA 5AKUA 4R5WA 3MHJA 4TKGA 4UVZA 4F1QA 3SE2A 3KR8A 4HKNA 4AVWA 1GS0A 4HYFA 4UI8A 5AL3A 3UH4A 4L7UA 4ZZYA 4F1LA 5AL5A 4TK0A 3HKVA 4HLKA 4PNRA 4TJYA 4TKFA 1UK0A 4UVXA 4BUVA 4LI8A 3U9HA 4BUWA 4TKIA 4GV0A 2PQFA 3C4HA 4BUDA 3GEYA 4L2FA 4XHUA 5AL1A 5ADRA 4UNDA 4UVOA 3SMJA 3SMIA 4MSKA 2RD6A 2RF5A 4PNSA 3GOYA 4L0TA 4L2GA 5LXPA 4K4FA 4BUIA 5A00A 4ZZXA 3C49A 4W5IA 4W6EA 4BJ9A 4UVLA 5AKWA 4HKKA 2X5YA 4UVYA 4UFUA 4BUYA 4UVVA 3P0QA 4W5SA 3GN7A 4BJBA 4L7LA 4BUSA 4R6EA 4PNMA 4UHGA 4PNLA 4TK5A 5C5RA 4UW1A 4L32A 4PMLA 4UI4A 4BUFA 4OQAC 4MSGA 4ZZZA 5LX6A 4L0IA 4BU5A 4L7PA 4PNNA 4RV6A 4DQYC 4HKIA 4L10A 5AEHA 4U6AA 4HHZA 4BU3A 4HL5A 4N4TA 3PAXA 3KJDA 4J3LA 4KRSA 5DCZA 3P0PA 5C5QA 3FHBA 5ECEA 4L6SA 4KZLA 3P0NA 4GV7A 4UVSA 4UXBA 3UDDA 5ETYA 4AVUA 4BUUA 1A26A 1UK1A 3L3LA 4KZQA 4UVPA 4L7RA
chains in the Genus database with same CATH superfamily
4TOSA 4UVNA 1J3BA 1EFYA 2ZCIA 4BFPA 1II2A 4IUEA 4N4VA 4PNTA 4TJUA 2RK7A 3BLJA 4PJVA 5ADSA 3W51A 4N3RA 4BUEA 4TORA 4HLHA 4OA7A 5AL4A 2PAWA 5FH3A 4BU9A 3CE0A 4YWBA 4F0EA 4L33A 4GNMA 3MHKA 4UFYA 3U9YA 4LI7A 3KCZA 2PC9A 2QEWA 3DT2A 3GJWA 4HLMA 3UA9A 2OLRA 4HLFA 4BU6A 3L3MA 2QF2A 4L31A 3DTBA 4GV2A 4MT9A 4BUAA 4L7OA 4J3MA 4UVWA 2QEYA 1NHXA 4WIEA 4OPXC 4TJWA 4BJCA 5AL2A 3DT4A 4KZUA 5ADTA 4DVIA 5C5PA 4YW8A 1AQ2A 4UUHA 1PAXA 4UI6A 4HMHA 2PAXA 4LI6A 4PJTA 4L6ZA 2RKDA 4L0VA 4R43A 4BUTA 4L09A 4BUXA 2OLQA 4L2KA 3KR7A 4WL8A 4HLGA 4UI5A 4UVUA 4WPUA 1K3DA 3MOEA 4J21A 4L7NA 4L0SA 4M7BA 4TVJA 4UI7A 1WOKA 4BS4A 4HHYA 5I67A 2PY7X 4L70A 4PNQA 4UI3A 5FPGA 4I9IA 4BU8A 5ADQA 2RCWA 4J22A 4X52A 4WOUA 4K4EA 5EBTA 4UVTA 4BU7A 5LYHA 4GNQA 4PY4A 5FPFA 2FAFA 4J1ZA 4GV4A 4UX4A 4OQBC 4L34A 4L0BA 1KHGA 4OX2A 4GMMA 4PAXA 3UH2A 5AKUA 4R5WA 2GMVA 3MHJA 4TKGA 4UVZA 4F1QA 3SE2A 3KR8A 4HKNA 2RKEA 4AVWA 2RK8A 1GS0A 4HYFA 4WPVA 4UI8A 1K3CA 5AL3A 3UH4A 1M51A 4L7UA 4ZZYA 4F1LA 1KHBA 5AL5A 4TK0A 3HKVA 4HLKA 4PNRA 4TJYA 4TKFA 1UK0A 4UVXA 4BUVA 5FH5A 4LI8A 3U9HA 4BUWA 4TKIA 4GV0A 1YVYA 2PQFA 3C4HA 4BUDA 3GEYA 4L2FA 4WPTA 4XHUA 5AL1A 2RKAA 2PXZX 5ADRA 4UNDA 4UVOA 1AYLA 3SMJA 1YTMA 3SMIA 4MSKA 2RD6A 2RF5A 4PNSA 3GOYA 2FAHA 4L0TA 4L2GA 5LXPA 4K4FA 5FH1A 4BUIA 5A00A 4ZZXA 3C49A 3MOFA 4W5IA 4W6EA 4BJ9A 4UVLA 5AKWA 4HKKA 2X5YA 4UVYA 4UFUA 2QF1A 4GNPA 1YGGA 5FH0A 4UVVA 4BUYA 3P0QA 4GNOA 4W5SA 3GN7A 4BJBA 4L7LA 1XKVA 5FH2A 4BUSA 4R6EA 4PNMA 4UHGA 4PNLA 4TK5A 1OENA 1YLHA 5C5RA 4UW1A 4L32A 4GMWA 4PMLA 4UI4A 4YW9A 4BUFA 4OQAC 4MSGA 1KHEA 4ZZZA 5LX6A 4GMUA 4L0IA 4L7PA 4PNNA 4RV6A 4BU5A 4DQYC 4HKIA 3DT7A 4L10A 5AEHA 4U6AA 4HHZA 4RCGA 5FH4A 4BU3A 4HL5A 4GNLA 4N4TA 3PAXA 4YWDA 2QZYA 3KJDA 4J3LA 4KRSA 5DCZA 1OS1A 3P0PA 3MOHA 4WIUA 5C5QA 4GMZA 3FHBA 5ECEA 4L6SA 4KZLA 3P0NA 4GV7A 4UVSA 1KHFA 4UXBA 3UDDA 5ETYA 4AVUA 4BUUA 1A26A 1UK1A 3L3LA 4KZQA 4UVPA 4L7RA
chains in the Genus database with same CATH topology
4TOSA 4UVNA 1J3BA 1EFYA 2ZCIA 4BFPA 1II2A 4IUEA 4N4VA 4PNTA 4TJUA 2RK7A 3BLJA 4PJVA 5ADSA 3W51A 4N3RA 4BUEA 4TORA 4HLHA 4OA7A 5AL4A 2PAWA 5FH3A 4BU9A 3CE0A 4YWBA 4F0EA 4L33A 4GNMA 3MHKA 4UFYA 3U9YA 4LI7A 3KCZA 2PC9A 2QEWA 3DT2A 3GJWA 4HLMA 3UA9A 2OLRA 4HLFA 4BU6A 3L3MA 2QF2A 4L31A 3DTBA 4GV2A 4MT9A 4BUAA 4L7OA 4J3MA 4UVWA 2QEYA 1NHXA 4WIEA 4OPXC 4TJWA 4BJCA 5AL2A 3DT4A 4KZUA 5ADTA 4DVIA 5C5PA 4YW8A 1AQ2A 4UUHA 1PAXA 4UI6A 4HMHA 2PAXA 4LI6A 4PJTA 4L6ZA 2RKDA 4L0VA 4R43A 4BUTA 4L09A 4BUXA 2OLQA 4L2KA 3KR7A 4WL8A 4HLGA 4UI5A 4UVUA 4WPUA 1K3DA 3MOEA 4J21A 4L7NA 4L0SA 4M7BA 4TVJA 4UI7A 1WOKA 4BS4A 4HHYA 5I67A 2PY7X 4L70A 4PNQA 4UI3A 5FPGA 4I9IA 4BU8A 5ADQA 2RCWA 4J22A 4X52A 4WOUA 4K4EA 5EBTA 4UVTA 4BU7A 5LYHA 4GNQA 4PY4A 5FPFA 2FAFA 4J1ZA 4GV4A 4UX4A 4OQBC 4L34A 4L0BA 1KHGA 4OX2A 4GMMA 4PAXA 3UH2A 5AKUA 4R5WA 2GMVA 3MHJA 4TKGA 4UVZA 4F1QA 3SE2A 3KR8A 4HKNA 2RKEA 4AVWA 2RK8A 1GS0A 4HYFA 4WPVA 4UI8A 1K3CA 5AL3A 3UH4A 1M51A 4L7UA 4ZZYA 4F1LA 1KHBA 5AL5A 4TK0A 3HKVA 4HLKA 4PNRA 4TJYA 4TKFA 1UK0A 4UVXA 4BUVA 5FH5A 4LI8A 3U9HA 4BUWA 4TKIA 4GV0A 1YVYA 2PQFA 3C4HA 4BUDA 3GEYA 4L2FA 4WPTA 4XHUA 5AL1A 2RKAA 2PXZX 5ADRA 4UNDA 4UVOA 1AYLA 3SMJA 1YTMA 3SMIA 4MSKA 2RD6A 2RF5A 4PNSA 3GOYA 2FAHA 4L0TA 4L2GA 5LXPA 4K4FA 5FH1A 4BUIA 5A00A 4ZZXA 3C49A 3MOFA 4W5IA 4W6EA 4BJ9A 4UVLA 5AKWA 4HKKA 2X5YA 4UVYA 4UFUA 2QF1A 4GNPA 1YGGA 5FH0A 4UVVA 4BUYA 3P0QA 4GNOA 4W5SA 3GN7A 4BJBA 4L7LA 1XKVA 5FH2A 4BUSA 4R6EA 4PNMA 4UHGA 4PNLA 4TK5A 1OENA 1YLHA 5C5RA 4UW1A 4L32A 4GMWA 4PMLA 4UI4A 4YW9A 4BUFA 4OQAC 4MSGA 1KHEA 4ZZZA 5LX6A 4GMUA 4L0IA 4L7PA 4PNNA 4RV6A 4BU5A 4DQYC 4HKIA 3DT7A 4L10A 5AEHA 4U6AA 4HHZA 4RCGA 5FH4A 4BU3A 4HL5A 4GNLA 4N4TA 3PAXA 4YWDA 2QZYA 3KJDA 4J3LA 4KRSA 5DCZA 1OS1A 3P0PA 3MOHA 4WIUA 5C5QA 4GMZA 3FHBA 5ECEA 4L6SA 4KZLA 3P0NA 4GV7A 4UVSA 1KHFA 4UXBA 3UDDA 5ETYA 4AVUA 4BUUA 1A26A 1UK1A 3L3LA 4KZQA 4UVPA 4L7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TOS A;  4UVN A;  1EFY A;  4BFP A;  4IUE A;  4PNT A;  4N4V A;  4TJU A;  3BLJ A;  4PJV A;  5ADS A;  3W51 A;  4N3R A;  4BUE A;  4TOR A;  4HLH A;  4OA7 A;  2PAW A;  4BU9 A;  3CE0 A;  4F0E A;  4L33 A;  3MHK A;  4UFY A;  3U9Y A;  4LI7 A;  3KCZ A;  4HLM A;  3GJW A;  3UA9 A;  4HLF A;  4BU6 A;  3L3M A;  4L31 A;  4BUA A;  4GV2 A;  4MT9 A;  4L7O A;  4J3M A;  4UVW A;  4OPX C;  4TJW A;  4BJC A;  5AL2 A;  4KZU A;  5ADT A;  4DVI A;  5C5P A;  4UUH A;  1PAX A;  4UI6 A;  4HMH A;  2PAX A;  4LI6 A;  4PJT A;  4L6Z A;  4L0V A;  4BUT A;  4L09 A;  4BUX A;  4L2K A;  3KR7 A;  4HLG A;  4UI5 A;  4UVU A;  5AL4 A;  4J21 A;  4L7N A;  4L0S A;  4M7B A;  4TVJ A;  4UI7 A;  1WOK A;  4BS4 A;  4HHY A;  4L70 A;  4PNQ A;  4UI3 A;  5FPG A;  4I9I A;  4BU8 A;  5ADQ A;  2RCW A;  4J22 A;  4X52 A;  4K4E A;  5EBT A;  4UVT A;  4BU7 A;  5LYH A;  4PY4 A;  5FPF A;  4UX4 A;  4J1Z A;  4GV4 A;  4OQB C;  4L34 A;  4L0B A;  3UH2 A;  4PAX A;  5AKU A;  4R5W A;  3MHJ A;  4TKG A;  4UVZ A;  4F1Q A;  3SE2 A;  3KR8 A;  4HKN A;  4AVW A;  1GS0 A;  4HYF A;  4UI8 A;  5AL3 A;  3UH4 A;  4L7U A;  4ZZY A;  4F1L A;  5AL5 A;  4TK0 A;  3HKV A;  4HLK A;  4PNR A;  4TJY A;  4TKF A;  1UK0 A;  4UVX A;  4BUV A;  4LI8 A;  3U9H A;  4BUW A;  4TKI A;  4GV0 A;  2PQF A;  3C4H A;  4BUD A;  3GEY A;  4L2F A;  4XHU A;  5AL1 A;  5ADR A;  4UND A;  4UVO A;  3SMJ A;  3SMI A;  4MSK A;  2RD6 A;  2RF5 A;  4PNS A;  3GOY A;  4L0T A;  4L2G A;  5LXP A;  4K4F A;  4BUI A;  5A00 A;  4ZZX A;  3C49 A;  4W5I A;  4W6E A;  4BJ9 A;  4UVL A;  5AKW A;  4HKK A;  2X5Y A;  4UVY A;  4UFU A;  4BUY A;  4UVV A;  3P0Q A;  4W5S A;  3GN7 A;  4BJB A;  4L7L A;  4BUS A;  4R6E A;  4PNM A;  4UHG A;  4PNL A;  4TK5 A;  5C5R A;  4UW1 A;  4L32 A;  4PML A;  4UI4 A;  4BUF A;  4OQA C;  4MSG A;  4ZZZ A;  5LX6 A;  4L0I A;  4BU5 A;  4L7P A;  4PNN A;  4RV6 A;  4DQY C;  4HKI A;  4L10 A;  5AEH A;  4U6A A;  4HHZ A;  4BU3 A;  4HL5 A;  4N4T A;  3PAX A;  3KJD A;  4J3L A;  4KRS A;  5DCZ A;  3P0P A;  5C5Q A;  3FHB A;  5ECE A;  4L6S A;  4KZL A;  3P0N A;  4GV7 A;  4UVS A;  4UXB A;  3UDD A;  5ETY A;  4AVU A;  4BUU A;  1A26 A;  1UK1 A;  3L3L A;  4KZQ A;  4UVP A;  4L7R A; 
#chains in the Genus database with same CATH topology
 4TOS A;  4UVN A;  1J3B A;  1EFY A;  2ZCI A;  4BFP A;  1II2 A;  4IUE A;  4N4V A;  4PNT A;  4TJU A;  2RK7 A;  3BLJ A;  4PJV A;  5ADS A;  3W51 A;  4N3R A;  4BUE A;  4TOR A;  4HLH A;  4OA7 A;  5AL4 A;  2PAW A;  5FH3 A;  4BU9 A;  3CE0 A;  4YWB A;  4F0E A;  4L33 A;  4GNM A;  3MHK A;  4UFY A;  3U9Y A;  4LI7 A;  3KCZ A;  2PC9 A;  2QEW A;  3DT2 A;  3GJW A;  4HLM A;  3UA9 A;  2OLR A;  4HLF A;  4BU6 A;  3L3M A;  2QF2 A;  4L31 A;  3DTB A;  4GV2 A;  4MT9 A;  4BUA A;  4L7O A;  4J3M A;  4UVW A;  2QEY A;  1NHX A;  4WIE A;  4OPX C;  4TJW A;  4BJC A;  5AL2 A;  3DT4 A;  4KZU A;  5ADT A;  4DVI A;  5C5P A;  4YW8 A;  1AQ2 A;  4UUH A;  1PAX A;  4UI6 A;  4HMH A;  2PAX A;  4LI6 A;  4PJT A;  4L6Z A;  2RKD A;  4L0V A;  4R43 A;  4BUT A;  4L09 A;  4BUX A;  2OLQ A;  4L2K A;  3KR7 A;  4WL8 A;  4HLG A;  4UI5 A;  4UVU A;  4WPU A;  1K3D A;  3MOE A;  4J21 A;  4L7N A;  4L0S A;  4M7B A;  4TVJ A;  4UI7 A;  1WOK A;  4BS4 A;  4HHY A;  5I67 A;  2PY7 X;  4L70 A;  4PNQ A;  4UI3 A;  5FPG A;  4I9I A;  4BU8 A;  5ADQ A;  2RCW A;  4J22 A;  4X52 A;  4WOU A;  4K4E A;  5EBT A;  4UVT A;  4BU7 A;  5LYH A;  4GNQ A;  4PY4 A;  5FPF A;  2FAF A;  4J1Z A;  4GV4 A;  4UX4 A;  4OQB C;  4L34 A;  4L0B A;  1KHG A;  4OX2 A;  4GMM A;  4PAX A;  3UH2 A;  5AKU A;  4R5W A;  2GMV A;  3MHJ A;  4TKG A;  4UVZ A;  4F1Q A;  3SE2 A;  3KR8 A;  4HKN A;  2RKE A;  4AVW A;  2RK8 A;  1GS0 A;  4HYF A;  4WPV A;  4UI8 A;  1K3C A;  5AL3 A;  3UH4 A;  1M51 A;  4L7U A;  4ZZY A;  4F1L A;  1KHB A;  5AL5 A;  4TK0 A;  3HKV A;  4HLK A;  4PNR A;  4TJY A;  4TKF A;  1UK0 A;  4UVX A;  4BUV A;  5FH5 A;  4LI8 A;  3U9H A;  4BUW A;  4TKI A;  4GV0 A;  1YVY A;  2PQF A;  3C4H A;  4BUD A;  3GEY A;  4L2F A;  4WPT A;  4XHU A;  5AL1 A;  2RKA A;  2PXZ X;  5ADR A;  4UND A;  4UVO A;  1AYL A;  3SMJ A;  1YTM A;  3SMI A;  4MSK A;  2RD6 A;  2RF5 A;  4PNS A;  3GOY A;  2FAH A;  4L0T A;  4L2G A;  5LXP A;  4K4F A;  5FH1 A;  4BUI A;  5A00 A;  4ZZX A;  3C49 A;  3MOF A;  4W5I A;  4W6E A;  4BJ9 A;  4UVL A;  5AKW A;  4HKK A;  2X5Y A;  4UVY A;  4UFU A;  2QF1 A;  4GNP A;  1YGG A;  5FH0 A;  4UVV A;  4BUY A;  3P0Q A;  4GNO A;  4W5S A;  3GN7 A;  4BJB A;  4L7L A;  1XKV A;  5FH2 A;  4BUS A;  4R6E A;  4PNM A;  4UHG A;  4PNL A;  4TK5 A;  1OEN A;  1YLH A;  5C5R A;  4UW1 A;  4L32 A;  4GMW A;  4PML A;  4UI4 A;  4YW9 A;  4BUF A;  4OQA C;  4MSG A;  1KHE A;  4ZZZ A;  5LX6 A;  4GMU A;  4L0I A;  4L7P A;  4PNN A;  4RV6 A;  4BU5 A;  4DQY C;  4HKI A;  3DT7 A;  4L10 A;  5AEH A;  4U6A A;  4HHZ A;  4RCG A;  5FH4 A;  4BU3 A;  4HL5 A;  4GNL A;  4N4T A;  3PAX A;  4YWD A;  2QZY A;  3KJD A;  4J3L A;  4KRS A;  5DCZ A;  1OS1 A;  3P0P A;  3MOH A;  4WIU A;  5C5Q A;  4GMZ A;  3FHB A;  5ECE A;  4L6S A;  4KZL A;  3P0N A;  4GV7 A;  4UVS A;  1KHF A;  4UXB A;  3UDD A;  5ETY A;  4AVU A;  4BUU A;  1A26 A;  1UK1 A;  3L3L A;  4KZQ A;  4UVP A;  4L7R A; 
#chains in the Genus database with same CATH homology
 4TOS A;  4UVN A;  1J3B A;  1EFY A;  2ZCI A;  4BFP A;  1II2 A;  4IUE A;  4N4V A;  4PNT A;  4TJU A;  2RK7 A;  3BLJ A;  4PJV A;  5ADS A;  3W51 A;  4N3R A;  4BUE A;  4TOR A;  4HLH A;  4OA7 A;  5AL4 A;  2PAW A;  5FH3 A;  4BU9 A;  3CE0 A;  4YWB A;  4F0E A;  4L33 A;  4GNM A;  3MHK A;  4UFY A;  3U9Y A;  4LI7 A;  3KCZ A;  2PC9 A;  2QEW A;  3DT2 A;  3GJW A;  4HLM A;  3UA9 A;  2OLR A;  4HLF A;  4BU6 A;  3L3M A;  2QF2 A;  4L31 A;  3DTB A;  4GV2 A;  4MT9 A;  4BUA A;  4L7O A;  4J3M A;  4UVW A;  2QEY A;  1NHX A;  4WIE A;  4OPX C;  4TJW A;  4BJC A;  5AL2 A;  3DT4 A;  4KZU A;  5ADT A;  4DVI A;  5C5P A;  4YW8 A;  1AQ2 A;  4UUH A;  1PAX A;  4UI6 A;  4HMH A;  2PAX A;  4LI6 A;  4PJT A;  4L6Z A;  2RKD A;  4L0V A;  4R43 A;  4BUT A;  4L09 A;  4BUX A;  2OLQ A;  4L2K A;  3KR7 A;  4WL8 A;  4HLG A;  4UI5 A;  4UVU A;  4WPU A;  1K3D A;  3MOE A;  4J21 A;  4L7N A;  4L0S A;  4M7B A;  4TVJ A;  4UI7 A;  1WOK A;  4BS4 A;  4HHY A;  5I67 A;  2PY7 X;  4L70 A;  4PNQ A;  4UI3 A;  5FPG A;  4I9I A;  4BU8 A;  5ADQ A;  2RCW A;  4J22 A;  4X52 A;  4WOU A;  4K4E A;  5EBT A;  4UVT A;  4BU7 A;  5LYH A;  4GNQ A;  4PY4 A;  5FPF A;  2FAF A;  4J1Z A;  4GV4 A;  4UX4 A;  4OQB C;  4L34 A;  4L0B A;  1KHG A;  4OX2 A;  4GMM A;  4PAX A;  3UH2 A;  5AKU A;  4R5W A;  2GMV A;  3MHJ A;  4TKG A;  4UVZ A;  4F1Q A;  3SE2 A;  3KR8 A;  4HKN A;  2RKE A;  4AVW A;  2RK8 A;  1GS0 A;  4HYF A;  4WPV A;  4UI8 A;  1K3C A;  5AL3 A;  3UH4 A;  1M51 A;  4L7U A;  4ZZY A;  4F1L A;  1KHB A;  5AL5 A;  4TK0 A;  3HKV A;  4HLK A;  4PNR A;  4TJY A;  4TKF A;  1UK0 A;  4UVX A;  4BUV A;  5FH5 A;  4LI8 A;  3U9H A;  4BUW A;  4TKI A;  4GV0 A;  1YVY A;  2PQF A;  3C4H A;  4BUD A;  3GEY A;  4L2F A;  4WPT A;  4XHU A;  5AL1 A;  2RKA A;  2PXZ X;  5ADR A;  4UND A;  4UVO A;  1AYL A;  3SMJ A;  1YTM A;  3SMI A;  4MSK A;  2RD6 A;  2RF5 A;  4PNS A;  3GOY A;  2FAH A;  4L0T A;  4L2G A;  5LXP A;  4K4F A;  5FH1 A;  4BUI A;  5A00 A;  4ZZX A;  3C49 A;  3MOF A;  4W5I A;  4W6E A;  4BJ9 A;  4UVL A;  5AKW A;  4HKK A;  2X5Y A;  4UVY A;  4UFU A;  2QF1 A;  4GNP A;  1YGG A;  5FH0 A;  4UVV A;  4BUY A;  3P0Q A;  4GNO A;  4W5S A;  3GN7 A;  4BJB A;  4L7L A;  1XKV A;  5FH2 A;  4BUS A;  4R6E A;  4PNM A;  4UHG A;  4PNL A;  4TK5 A;  1OEN A;  1YLH A;  5C5R A;  4UW1 A;  4L32 A;  4GMW A;  4PML A;  4UI4 A;  4YW9 A;  4BUF A;  4OQA C;  4MSG A;  1KHE A;  4ZZZ A;  5LX6 A;  4GMU A;  4L0I A;  4L7P A;  4PNN A;  4RV6 A;  4BU5 A;  4DQY C;  4HKI A;  3DT7 A;  4L10 A;  5AEH A;  4U6A A;  4HHZ A;  4RCG A;  5FH4 A;  4BU3 A;  4HL5 A;  4GNL A;  4N4T A;  3PAX A;  4YWD A;  2QZY A;  3KJD A;  4J3L A;  4KRS A;  5DCZ A;  1OS1 A;  3P0P A;  3MOH A;  4WIU A;  5C5Q A;  4GMZ A;  3FHB A;  5ECE A;  4L6S A;  4KZL A;  3P0N A;  4GV7 A;  4UVS A;  1KHF A;  4UXB A;  3UDD A;  5ETY A;  4AVU A;  4BUU A;  1A26 A;  1UK1 A;  3L3L A;  4KZQ A;  4UVP A;  4L7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...