4BUEA

Crystal structure of human tankyrase 2 in complex with 3-methyl-n-(4-(4-oxo-3,4-dihydroquinazolin-2-yl)phenyl)butanamide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bueA00
4UI8A 4OQBC 4L7RA 2X5YA 2PAWA 4UVNA 4PJVA 4PNNA 4GV0A 4BJ9A 4BUVA 4PNSA 5AEHA 5AKUA 4J3MA 3P0NA 4MT9A 4GV2A 4HLGA 4L70A 4UI3A 4UXBA 4IUEA 4BUEA 1UK1A 4PNTA 5ADQA 3U9HA 4BU5A 3SMIA 3GJWA 4K4FA 4PNRA 4PMLA 4RV6A 4UVVA 4BU9A 3C49A 4TOSA 5A00A 5AL5A 5C5PA 4UNDA 4UVSA 4ZZYA 4L7NA 4UUHA 4BJBA 4L0IA 4GV7A 4ZZXA 4PY4A 4HHYA 4HMHA 5C5RA 4J3LA 4UVUA 4PNMA 4F0EA 4UVOA 4BU8A 4BUSA 2RCWA 1GS0A 3UDDA 5AL3A 3L3LA 4L6ZA 4TORA 4UFUA 4UVWA 4L10A 3SE2A 4HYFA 4BUTA 5AKWA 5ETYA 5ADRA 4PNLA 4BUUA 4AVWA 4UI5A 4ZZZA 4PAXA 1PAXA 4UVTA 3W51A 3MHKA 3KCZA 4BUDA 4HLKA 4R5WA 5AL2A 4F1LA 4UVPA 4L7UA 3GOYA 4L2FA 4L32A 4UX4A 5ADSA 4OPXC 4K4EA 4L31A 5LXPA 4MSGA 4PJTA 4N3RA 3GEYA 4BUYA 3HKVA 3MHJA 4TKGA 4N4VA 4UFYA 4R6EA 4TJUA 4BU7A 5AL1A 4L7OA 3P0PA 5ECEA 5ADTA 4BJCA 2PQFA 4TVJA 3UH4A 4L7PA 4N4TA 4HL5A 4HLMA 4KZUA 4UI6A 4TK0A 1EFYA 4PNQA 4UVLA 1UK0A 3U9YA 4F1QA 4L33A 4BU6A 4I9IA 4KRSA 1A26A 4HKKA 4TJWA 3KR8A 5AL4A 4L34A 4L0BA 4UVXA 4LI6A 3SMJA 4BU3A 4UVZA 2RF5A 3PAXA 4L0SA 4TJYA 4L6SA 4AVUA 5FPGA 4OA7A 4UVYA 4J21A 4BFPA 3CE0A 1WOKA 3C4HA 4W6EA 4L2GA 4J1ZA 3UA9A 3UH2A 4BUWA 3FHBA 3KR7A 4J22A 4LI8A 3P0QA 5FPFA 4KZQA 4L09A 2PAXA 4W5IA 4BUIA 4L0TA 3BLJA 4X52A 4HHZA 4L2KA 4TKIA 4XHUA 4BUFA 4BUAA 4GV4A 5EBTA 5DCZA 4HKNA 4L0VA 4BS4A 4L7LA 4HLHA 4M7BA 4U6AA 4UW1A 4W5SA 3KJDA 4UHGA 3GN7A 4MSKA 4UI7A 5LX6A 2RD6A 4TK5A 5C5QA 4DQYC 4LI7A 4UI4A 4DVIA 4BUXA 4KZLA 4OQAC 5LYHA 3L3MA 4HLFA 4HKIA 4TKFA
chains in the Genus database with same CATH superfamily
4UI8A 4OQBC 4L7RA 2X5YA 2PAWA 4GMUA 4UVNA 2RKAA 4PJVA 4PNNA 3DTBA 4GV0A 4BJ9A 4BUVA 4PNSA 4WIUA 4GMWA 5AEHA 1II2A 5AKUA 4J3MA 3P0NA 4GMZA 4MT9A 2GMVA 4GV2A 4HLGA 4L70A 4UI3A 4IUEA 4UXBA 1UK1A 4PNTA 1KHGA 5ADQA 1OS1A 3U9HA 4BU5A 3SMIA 3GJWA 4K4FA 4PNRA 4PMLA 4RV6A 4UVVA 4BU9A 3C49A 4TOSA 2QF2A 5A00A 5FH2A 5AL5A 5C5PA 4UNDA 4WIEA 4UVSA 4BUEA 4ZZYA 4L7NA 4UUHA 4BJBA 4L0IA 4GV7A 4R43A 4ZZXA 4PY4A 4HHYA 4HMHA 5C5RA 4J3LA 4UVUA 4PNMA 4F0EA 5FH5A 4UVOA 4BU8A 4BUSA 1XKVA 2RCWA 1GS0A 3DT7A 3UDDA 5AL3A 3L3LA 1J3BA 4L6ZA 4TORA 4UFUA 4UVWA 4L10A 3SE2A 1AYLA 4HYFA 4BUTA 5AKWA 5ETYA 5ADRA 4PNLA 5FH0A 4WL8A 4BUUA 4AVWA 4UI5A 4ZZZA 4PAXA 1PAXA 4WPUA 4UVTA 2FAHA 4GNOA 3W51A 3MHKA 3KCZA 4TK0A 4GNLA 4GMMA 4HLKA 4R5WA 4BUDA 5AL2A 4F1LA 4UVPA 4L7UA 2QEYA 3GOYA 4GNMA 4L2FA 4L32A 4UX4A 5ADSA 4OPXC 4K4EA 4YWDA 3DT4A 3MOFA 4L31A 5LXPA 4MSGA 4PJTA 1OENA 4YWBA 4N3RA 2PY7X 3GEYA 4BUYA 3HKVA 3MHJA 4GNQA 4TKGA 4N4VA 4UFYA 4R6EA 4TJUA 4BU7A 5AL1A 4L7OA 3P0PA 1YGGA 5ECEA 2QZYA 4WPVA 5ADTA 4BJCA 2PQFA 1K3DA 4TVJA 3UH4A 4L7PA 2RK8A 4HL5A 2PC9A 4HLMA 4KZUA 4N4TA 1EFYA 4PNQA 4UI6A 1UK0A 3MOHA 4UVLA 3U9YA 4L33A 4F1QA 1YLHA 4BU6A 4I9IA 4WPTA 1NHXA 4KRSA 1A26A 2FAFA 4HKKA 4TJWA 4YW8A 1K3CA 1AQ2A 3KR8A 2OLRA 4L34A 4L0BA 4UVXA 5AL4A 2RKDA 4LI6A 5FH4A 2QF1A 3SMJA 4GNPA 4OX2A 4UVZA 2ZCIA 2RF5A 3PAXA 4L0SA 4TJYA 4BU3A 4L6SA 4AVUA 5FPGA 4OA7A 2RK7A 4J21A 4UVYA 4BFPA 3CE0A 1WOKA 3C4HA 4W6EA 1YTMA 4L2GA 1YVYA 4J1ZA 3UA9A 1KHEA 3UH2A 3MOEA 4BUWA 3FHBA 3KR7A 4J22A 4LI8A 3P0QA 5FPFA 4KZQA 4L09A 2PAXA 4W5IA 4BUIA 4L0TA 4RCGA 3BLJA 4X52A 4HHZA 4L2KA 4TKIA 5FH1A 4XHUA 4BUFA 4BUAA 4GV4A 1M51A 1KHFA 2QEWA 5EBTA 5DCZA 4HKNA 4L0VA 4WOUA 2PXZX 4L7LA 4HLHA 4BS4A 2RKEA 4M7BA 2OLQA 4U6AA 4UW1A 4W5SA 5I67A 3KJDA 4UHGA 3GN7A 4MSKA 4UI7A 5LX6A 2RD6A 4TK5A 5C5QA 4DQYC 4LI7A 4UI4A 4DVIA 4BUXA 4KZLA 4OQAC 5FH3A 3L3MA 4HLFA 3DT2A 5LYHA 1KHBA 4YW9A 4HKIA 4TKFA
chains in the Genus database with same CATH topology
4UI8A 4OQBC 4L7RA 2X5YA 2PAWA 4GMUA 4UVNA 2RKAA 4PJVA 4PNNA 3DTBA 4GV0A 4BJ9A 4BUVA 4PNSA 4WIUA 4GMWA 5AEHA 1II2A 5AKUA 4J3MA 3P0NA 4GMZA 4MT9A 2GMVA 4GV2A 4HLGA 4L70A 4UI3A 4IUEA 4UXBA 1UK1A 4PNTA 1KHGA 5ADQA 1OS1A 3U9HA 4BU5A 3SMIA 3GJWA 4K4FA 4PNRA 4PMLA 4RV6A 4UVVA 4BU9A 3C49A 4TOSA 2QF2A 5A00A 5FH2A 5AL5A 5C5PA 4UNDA 4WIEA 4UVSA 4BUEA 4ZZYA 4L7NA 4UUHA 4BJBA 4L0IA 4GV7A 4R43A 4ZZXA 4PY4A 4HHYA 4HMHA 5C5RA 4J3LA 4UVUA 4PNMA 4F0EA 5FH5A 4UVOA 4BU8A 4BUSA 1XKVA 2RCWA 1GS0A 3DT7A 3UDDA 5AL3A 3L3LA 1J3BA 4L6ZA 4TORA 4UFUA 4UVWA 4L10A 3SE2A 1AYLA 4HYFA 4BUTA 5AKWA 5ETYA 5ADRA 4PNLA 5FH0A 4WL8A 4BUUA 4AVWA 4UI5A 4ZZZA 4PAXA 1PAXA 4WPUA 4UVTA 2FAHA 4GNOA 3W51A 3MHKA 3KCZA 4TK0A 4GNLA 4GMMA 4HLKA 4R5WA 4BUDA 5AL2A 4F1LA 4UVPA 4L7UA 2QEYA 3GOYA 4GNMA 4L2FA 4L32A 4UX4A 5ADSA 4OPXC 4K4EA 4YWDA 3DT4A 3MOFA 4L31A 5LXPA 4MSGA 4PJTA 1OENA 4YWBA 4N3RA 2PY7X 3GEYA 4BUYA 3HKVA 3MHJA 4GNQA 4TKGA 4N4VA 4UFYA 4R6EA 4TJUA 4BU7A 5AL1A 4L7OA 3P0PA 1YGGA 5ECEA 2QZYA 4WPVA 5ADTA 4BJCA 2PQFA 1K3DA 4TVJA 3UH4A 4L7PA 2RK8A 4HL5A 2PC9A 4HLMA 4KZUA 4N4TA 1EFYA 4PNQA 4UI6A 1UK0A 3MOHA 4UVLA 3U9YA 4L33A 4F1QA 1YLHA 4BU6A 4I9IA 4WPTA 1NHXA 4KRSA 1A26A 2FAFA 4HKKA 4TJWA 4YW8A 1K3CA 1AQ2A 3KR8A 2OLRA 4L34A 4L0BA 4UVXA 5AL4A 2RKDA 4LI6A 5FH4A 2QF1A 3SMJA 4GNPA 4OX2A 4UVZA 2ZCIA 2RF5A 3PAXA 4L0SA 4TJYA 4BU3A 4L6SA 4AVUA 5FPGA 4OA7A 2RK7A 4J21A 4UVYA 4BFPA 3CE0A 1WOKA 3C4HA 4W6EA 1YTMA 4L2GA 1YVYA 4J1ZA 3UA9A 1KHEA 3UH2A 3MOEA 4BUWA 3FHBA 3KR7A 4J22A 4LI8A 3P0QA 5FPFA 4KZQA 4L09A 2PAXA 4W5IA 4BUIA 4L0TA 4RCGA 3BLJA 4X52A 4HHZA 4L2KA 4TKIA 5FH1A 4XHUA 4BUFA 4BUAA 4GV4A 1M51A 1KHFA 2QEWA 5EBTA 5DCZA 4HKNA 4L0VA 4WOUA 2PXZX 4L7LA 4HLHA 4BS4A 2RKEA 4M7BA 2OLQA 4U6AA 4UW1A 4W5SA 5I67A 3KJDA 4UHGA 3GN7A 4MSKA 4UI7A 5LX6A 2RD6A 4TK5A 5C5QA 4DQYC 4LI7A 4UI4A 4DVIA 4BUXA 4KZLA 4OQAC 5FH3A 3L3MA 4HLFA 3DT2A 5LYHA 1KHBA 4YW9A 4HKIA 4TKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UI8 A;  4OQB C;  4L7R A;  2X5Y A;  2PAW A;  4UVN A;  4PJV A;  4PNN A;  4GV0 A;  4BJ9 A;  4BUV A;  4PNS A;  5AEH A;  5AKU A;  4J3M A;  3P0N A;  4MT9 A;  4GV2 A;  4HLG A;  4L70 A;  4UI3 A;  4UXB A;  4IUE A;  4BUE A;  1UK1 A;  4PNT A;  5ADQ A;  3U9H A;  4BU5 A;  3SMI A;  3GJW A;  4K4F A;  4PNR A;  4PML A;  4RV6 A;  4UVV A;  4BU9 A;  3C49 A;  4TOS A;  5A00 A;  5AL5 A;  5C5P A;  4UND A;  4UVS A;  4ZZY A;  4L7N A;  4UUH A;  4BJB A;  4L0I A;  4GV7 A;  4ZZX A;  4PY4 A;  4HHY A;  4HMH A;  5C5R A;  4J3L A;  4UVU A;  4PNM A;  4F0E A;  4UVO A;  4BU8 A;  4BUS A;  2RCW A;  1GS0 A;  3UDD A;  5AL3 A;  3L3L A;  4L6Z A;  4TOR A;  4UFU A;  4UVW A;  4L10 A;  3SE2 A;  4HYF A;  4BUT A;  5AKW A;  5ETY A;  5ADR A;  4PNL A;  4BUU A;  4AVW A;  4UI5 A;  4ZZZ A;  4PAX A;  1PAX A;  4UVT A;  3W51 A;  3MHK A;  3KCZ A;  4BUD A;  4HLK A;  4R5W A;  5AL2 A;  4F1L A;  4UVP A;  4L7U A;  3GOY A;  4L2F A;  4L32 A;  4UX4 A;  5ADS A;  4OPX C;  4K4E A;  4L31 A;  5LXP A;  4MSG A;  4PJT A;  4N3R A;  3GEY A;  4BUY A;  3HKV A;  3MHJ A;  4TKG A;  4N4V A;  4UFY A;  4R6E A;  4TJU A;  4BU7 A;  5AL1 A;  4L7O A;  3P0P A;  5ECE A;  5ADT A;  4BJC A;  2PQF A;  4TVJ A;  3UH4 A;  4L7P A;  4N4T A;  4HL5 A;  4HLM A;  4KZU A;  4UI6 A;  4TK0 A;  1EFY A;  4PNQ A;  4UVL A;  1UK0 A;  3U9Y A;  4F1Q A;  4L33 A;  4BU6 A;  4I9I A;  4KRS A;  1A26 A;  4HKK A;  4TJW A;  3KR8 A;  5AL4 A;  4L34 A;  4L0B A;  4UVX A;  4LI6 A;  3SMJ A;  4BU3 A;  4UVZ A;  2RF5 A;  3PAX A;  4L0S A;  4TJY A;  4L6S A;  4AVU A;  5FPG A;  4OA7 A;  4UVY A;  4J21 A;  4BFP A;  3CE0 A;  1WOK A;  3C4H A;  4W6E A;  4L2G A;  4J1Z A;  3UA9 A;  3UH2 A;  4BUW A;  3FHB A;  3KR7 A;  4J22 A;  4LI8 A;  3P0Q A;  5FPF A;  4KZQ A;  4L09 A;  2PAX A;  4W5I A;  4BUI A;  4L0T A;  3BLJ A;  4X52 A;  4HHZ A;  4L2K A;  4TKI A;  4XHU A;  4BUF A;  4BUA A;  4GV4 A;  5EBT A;  5DCZ A;  4HKN A;  4L0V A;  4BS4 A;  4L7L A;  4HLH A;  4M7B A;  4U6A A;  4UW1 A;  4W5S A;  3KJD A;  4UHG A;  3GN7 A;  4MSK A;  4UI7 A;  5LX6 A;  2RD6 A;  4TK5 A;  5C5Q A;  4DQY C;  4LI7 A;  4UI4 A;  4DVI A;  4BUX A;  4KZL A;  4OQA C;  5LYH A;  3L3M A;  4HLF A;  4HKI A;  4TKF A; 
#chains in the Genus database with same CATH topology
 4UI8 A;  4OQB C;  4L7R A;  2X5Y A;  2PAW A;  4GMU A;  4UVN A;  2RKA A;  4PJV A;  4PNN A;  3DTB A;  4GV0 A;  4BJ9 A;  4BUV A;  4PNS A;  4WIU A;  4GMW A;  5AEH A;  1II2 A;  5AKU A;  4J3M A;  3P0N A;  4GMZ A;  4MT9 A;  2GMV A;  4GV2 A;  4HLG A;  4L70 A;  4UI3 A;  4IUE A;  4UXB A;  1UK1 A;  4PNT A;  1KHG A;  5ADQ A;  1OS1 A;  3U9H A;  4BU5 A;  3SMI A;  3GJW A;  4K4F A;  4PNR A;  4PML A;  4RV6 A;  4UVV A;  4BU9 A;  3C49 A;  4TOS A;  2QF2 A;  5A00 A;  5FH2 A;  5AL5 A;  5C5P A;  4UND A;  4WIE A;  4UVS A;  4BUE A;  4ZZY A;  4L7N A;  4UUH A;  4BJB A;  4L0I A;  4GV7 A;  4R43 A;  4ZZX A;  4PY4 A;  4HHY A;  4HMH A;  5C5R A;  4J3L A;  4UVU A;  4PNM A;  4F0E A;  5FH5 A;  4UVO A;  4BU8 A;  4BUS A;  1XKV A;  2RCW A;  1GS0 A;  3DT7 A;  3UDD A;  5AL3 A;  3L3L A;  1J3B A;  4L6Z A;  4TOR A;  4UFU A;  4UVW A;  4L10 A;  3SE2 A;  1AYL A;  4HYF A;  4BUT A;  5AKW A;  5ETY A;  5ADR A;  4PNL A;  5FH0 A;  4WL8 A;  4BUU A;  4AVW A;  4UI5 A;  4ZZZ A;  4PAX A;  1PAX A;  4WPU A;  4UVT A;  2FAH A;  4GNO A;  3W51 A;  3MHK A;  3KCZ A;  4TK0 A;  4GNL A;  4GMM A;  4HLK A;  4R5W A;  4BUD A;  5AL2 A;  4F1L A;  4UVP A;  4L7U A;  2QEY A;  3GOY A;  4GNM A;  4L2F A;  4L32 A;  4UX4 A;  5ADS A;  4OPX C;  4K4E A;  4YWD A;  3DT4 A;  3MOF A;  4L31 A;  5LXP A;  4MSG A;  4PJT A;  1OEN A;  4YWB A;  4N3R A;  2PY7 X;  3GEY A;  4BUY A;  3HKV A;  3MHJ A;  4GNQ A;  4TKG A;  4N4V A;  4UFY A;  4R6E A;  4TJU A;  4BU7 A;  5AL1 A;  4L7O A;  3P0P A;  1YGG A;  5ECE A;  2QZY A;  4WPV A;  5ADT A;  4BJC A;  2PQF A;  1K3D A;  4TVJ A;  3UH4 A;  4L7P A;  2RK8 A;  4HL5 A;  2PC9 A;  4HLM A;  4KZU A;  4N4T A;  1EFY A;  4PNQ A;  4UI6 A;  1UK0 A;  3MOH A;  4UVL A;  3U9Y A;  4L33 A;  4F1Q A;  1YLH A;  4BU6 A;  4I9I A;  4WPT A;  1NHX A;  4KRS A;  1A26 A;  2FAF A;  4HKK A;  4TJW A;  4YW8 A;  1K3C A;  1AQ2 A;  3KR8 A;  2OLR A;  4L34 A;  4L0B A;  4UVX A;  5AL4 A;  2RKD A;  4LI6 A;  5FH4 A;  2QF1 A;  3SMJ A;  4GNP A;  4OX2 A;  4UVZ A;  2ZCI A;  2RF5 A;  3PAX A;  4L0S A;  4TJY A;  4BU3 A;  4L6S A;  4AVU A;  5FPG A;  4OA7 A;  2RK7 A;  4J21 A;  4UVY A;  4BFP A;  3CE0 A;  1WOK A;  3C4H A;  4W6E A;  1YTM A;  4L2G A;  1YVY A;  4J1Z A;  3UA9 A;  1KHE A;  3UH2 A;  3MOE A;  4BUW A;  3FHB A;  3KR7 A;  4J22 A;  4LI8 A;  3P0Q A;  5FPF A;  4KZQ A;  4L09 A;  2PAX A;  4W5I A;  4BUI A;  4L0T A;  4RCG A;  3BLJ A;  4X52 A;  4HHZ A;  4L2K A;  4TKI A;  5FH1 A;  4XHU A;  4BUF A;  4BUA A;  4GV4 A;  1M51 A;  1KHF A;  2QEW A;  5EBT A;  5DCZ A;  4HKN A;  4L0V A;  4WOU A;  2PXZ X;  4L7L A;  4HLH A;  4BS4 A;  2RKE A;  4M7B A;  2OLQ A;  4U6A A;  4UW1 A;  4W5S A;  5I67 A;  3KJD A;  4UHG A;  3GN7 A;  4MSK A;  4UI7 A;  5LX6 A;  2RD6 A;  4TK5 A;  5C5Q A;  4DQY C;  4LI7 A;  4UI4 A;  4DVI A;  4BUX A;  4KZL A;  4OQA C;  5FH3 A;  3L3M A;  4HLF A;  3DT2 A;  5LYH A;  1KHB A;  4YW9 A;  4HKI A;  4TKF A; 
#chains in the Genus database with same CATH homology
 4UI8 A;  4OQB C;  4L7R A;  2X5Y A;  2PAW A;  4GMU A;  4UVN A;  2RKA A;  4PJV A;  4PNN A;  3DTB A;  4GV0 A;  4BJ9 A;  4BUV A;  4PNS A;  4WIU A;  4GMW A;  5AEH A;  1II2 A;  5AKU A;  4J3M A;  3P0N A;  4GMZ A;  4MT9 A;  2GMV A;  4GV2 A;  4HLG A;  4L70 A;  4UI3 A;  4IUE A;  4UXB A;  1UK1 A;  4PNT A;  1KHG A;  5ADQ A;  1OS1 A;  3U9H A;  4BU5 A;  3SMI A;  3GJW A;  4K4F A;  4PNR A;  4PML A;  4RV6 A;  4UVV A;  4BU9 A;  3C49 A;  4TOS A;  2QF2 A;  5A00 A;  5FH2 A;  5AL5 A;  5C5P A;  4UND A;  4WIE A;  4UVS A;  4BUE A;  4ZZY A;  4L7N A;  4UUH A;  4BJB A;  4L0I A;  4GV7 A;  4R43 A;  4ZZX A;  4PY4 A;  4HHY A;  4HMH A;  5C5R A;  4J3L A;  4UVU A;  4PNM A;  4F0E A;  5FH5 A;  4UVO A;  4BU8 A;  4BUS A;  1XKV A;  2RCW A;  1GS0 A;  3DT7 A;  3UDD A;  5AL3 A;  3L3L A;  1J3B A;  4L6Z A;  4TOR A;  4UFU A;  4UVW A;  4L10 A;  3SE2 A;  1AYL A;  4HYF A;  4BUT A;  5AKW A;  5ETY A;  5ADR A;  4PNL A;  5FH0 A;  4WL8 A;  4BUU A;  4AVW A;  4UI5 A;  4ZZZ A;  4PAX A;  1PAX A;  4WPU A;  4UVT A;  2FAH A;  4GNO A;  3W51 A;  3MHK A;  3KCZ A;  4TK0 A;  4GNL A;  4GMM A;  4HLK A;  4R5W A;  4BUD A;  5AL2 A;  4F1L A;  4UVP A;  4L7U A;  2QEY A;  3GOY A;  4GNM A;  4L2F A;  4L32 A;  4UX4 A;  5ADS A;  4OPX C;  4K4E A;  4YWD A;  3DT4 A;  3MOF A;  4L31 A;  5LXP A;  4MSG A;  4PJT A;  1OEN A;  4YWB A;  4N3R A;  2PY7 X;  3GEY A;  4BUY A;  3HKV A;  3MHJ A;  4GNQ A;  4TKG A;  4N4V A;  4UFY A;  4R6E A;  4TJU A;  4BU7 A;  5AL1 A;  4L7O A;  3P0P A;  1YGG A;  5ECE A;  2QZY A;  4WPV A;  5ADT A;  4BJC A;  2PQF A;  1K3D A;  4TVJ A;  3UH4 A;  4L7P A;  2RK8 A;  4HL5 A;  2PC9 A;  4HLM A;  4KZU A;  4N4T A;  1EFY A;  4PNQ A;  4UI6 A;  1UK0 A;  3MOH A;  4UVL A;  3U9Y A;  4L33 A;  4F1Q A;  1YLH A;  4BU6 A;  4I9I A;  4WPT A;  1NHX A;  4KRS A;  1A26 A;  2FAF A;  4HKK A;  4TJW A;  4YW8 A;  1K3C A;  1AQ2 A;  3KR8 A;  2OLR A;  4L34 A;  4L0B A;  4UVX A;  5AL4 A;  2RKD A;  4LI6 A;  5FH4 A;  2QF1 A;  3SMJ A;  4GNP A;  4OX2 A;  4UVZ A;  2ZCI A;  2RF5 A;  3PAX A;  4L0S A;  4TJY A;  4BU3 A;  4L6S A;  4AVU A;  5FPG A;  4OA7 A;  2RK7 A;  4J21 A;  4UVY A;  4BFP A;  3CE0 A;  1WOK A;  3C4H A;  4W6E A;  1YTM A;  4L2G A;  1YVY A;  4J1Z A;  3UA9 A;  1KHE A;  3UH2 A;  3MOE A;  4BUW A;  3FHB A;  3KR7 A;  4J22 A;  4LI8 A;  3P0Q A;  5FPF A;  4KZQ A;  4L09 A;  2PAX A;  4W5I A;  4BUI A;  4L0T A;  4RCG A;  3BLJ A;  4X52 A;  4HHZ A;  4L2K A;  4TKI A;  5FH1 A;  4XHU A;  4BUF A;  4BUA A;  4GV4 A;  1M51 A;  1KHF A;  2QEW A;  5EBT A;  5DCZ A;  4HKN A;  4L0V A;  4WOU A;  2PXZ X;  4L7L A;  4HLH A;  4BS4 A;  2RKE A;  4M7B A;  2OLQ A;  4U6A A;  4UW1 A;  4W5S A;  5I67 A;  3KJD A;  4UHG A;  3GN7 A;  4MSK A;  4UI7 A;  5LX6 A;  2RD6 A;  4TK5 A;  5C5Q A;  4DQY C;  4LI7 A;  4UI4 A;  4DVI A;  4BUX A;  4KZL A;  4OQA C;  5FH3 A;  3L3M A;  4HLF A;  3DT2 A;  5LYH A;  1KHB A;  4YW9 A;  4HKI A;  4TKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...