4BUFA

Crystal structure of human tankyrase 2 in complex with 2-(4- acetylphenyl)-3,4-dihydroquinazolin-4-one
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bufA00
4N3RA 4KZLA 4UVUA 3P0PA 4BU9A 3MHJA 4BJ9A 4PNSA 4F1QA 4UVXA 4UUHA 2PAWA 4UVZA 5LYHA 4OA7A 4HHYA 4BUXA 4J21A 4PNMA 4TK0A 4GV7A 4GV0A 4UVVA 4PNRA 3UDDA 4PMLA 4UVPA 5C5QA 3U9HA 3KR7A 4L0SA 4PJTA 3SE2A 4UVLA 5AL3A 5AL4A 4RV6A 4BUFA 4HL5A 3PAXA 4PAXA 4UI6A 4X52A 4W5IA 4BU5A 3UH2A 4TVJA 4L0TA 4BU6A 4L6ZA 4BUSA 2X5YA 2RD6A 4L6SA 4F1LA 4BUEA 4LI7A 4TORA 5C5PA 4BUTA 4GV4A 4J3LA 4UX4A 4BU7A 1PAXA 3FHBA 4MSKA 5ECEA 4GV2A 4J22A 4HHZA 4MT9A 3GJWA 4DVIA 4KZQA 4PY4A 5ETYA 4BS4A 5LXPA 3L3MA 3W51A 1UK0A 5AKUA 4K4EA 4HMHA 5ADSA 4UW1A 1EFYA 3GN7A 2RCWA 3UH4A 3L3LA 4L70A 5EBTA 4TJUA 4IUEA 4UI4A 4L34A 3SMJA 4PNTA 4TOSA 4ZZYA 4BUAA 4U6AA 4L0IA 4N4VA 4L7PA 4R6EA 4L7NA 3U9YA 5AL1A 4UVYA 4BJCA 4L0BA 5AEHA 4PNNA 2PQFA 4L7UA 4BUUA 4OPXC 4BUIA 4I9IA 4UVWA 4PNLA 5A00A 4F0EA 4KRSA 4HKKA 3P0NA 4HKNA 1GS0A 5FPFA 4L2KA 4TKGA 5AL5A 3GEYA 4KZUA 4HLMA 4TK5A 3P0QA 4UVSA 4L7RA 4UVTA 4TJWA 4R5WA 4J1ZA 4L10A 4BJBA 1A26A 4UVOA 1WOKA 4BUDA 4UHGA 4OQBC 4MSGA 4PNQA 4HLGA 4HYFA 3C49A 2PAXA 3SMIA 4AVWA 4J3MA 4UFUA 4XHUA 4UNDA 3BLJA 3MHKA 4L7OA 4UXBA 5C5RA 4L2GA 5ADRA 5FPGA 4BU3A 3CE0A 4BFPA 5ADQA 4BUYA 4N4TA 4TKFA 4UVNA 4OQAC 3KJDA 4L33A 4PJVA 4M7BA 4L31A 4LI8A 4W6EA 4ZZZA 3KR8A 4HLFA 4HKIA 4UI3A 4ZZXA 4UI8A 3KCZA 4UFYA 4UI5A 4BUVA 4L32A 4HLHA 4BUWA 4HLKA 4DQYC 5DCZA 2RF5A 3HKVA 4L0VA 3GOYA 4TJYA 3UA9A 4TKIA 4UI7A 4L09A 4BU8A 5LX6A 4L7LA 4LI6A 5AL2A 3C4HA 4W5SA 5AKWA 4AVUA 5ADTA 1UK1A 4L2FA 4K4FA
chains in the Genus database with same CATH superfamily
4N3RA 4KZLA 4UVUA 3P0PA 4GMUA 4BU9A 3MHJA 4BJ9A 4PNSA 4WPTA 4F1QA 4UVXA 4OX2A 4UUHA 2PAWA 4GNPA 4UVZA 4OA7A 4HHYA 4BUXA 5LYHA 1YTMA 4J21A 4PNMA 4AVWA 4GV7A 4GV0A 4UVVA 4PNRA 3UDDA 4PMLA 4UVPA 5C5QA 2QF1A 2FAHA 3U9HA 3KR7A 4L0SA 4PJTA 3SE2A 3DT2A 4UVLA 5AL3A 5AL4A 2PC9A 4RV6A 4HL5A 3PAXA 4PAXA 4UI6A 4BUFA 2QZYA 4X52A 1AQ2A 4W5IA 4BU5A 1OENA 4WPVA 4TVJA 1KHFA 4L0TA 3UH2A 4WL8A 2QEWA 4BU6A 4L6ZA 4BUSA 2RK7A 2X5YA 2RD6A 3DT4A 4WIEA 1NHXA 4L6SA 4WOUA 4F1LA 4BUEA 4LI7A 4TORA 5C5PA 4BUTA 4GNMA 4TK0A 1K3CA 4GV4A 4J3LA 4UX4A 4BU7A 1PAXA 3FHBA 4MSKA 1YGGA 5ECEA 4GV2A 4J22A 4HHZA 4MT9A 4RCGA 3GJWA 4DVIA 4KZQA 4PY4A 5ETYA 4BS4A 1XKVA 5LXPA 3L3MA 4GMMA 3W51A 5AKUA 4K4EA 3MOEA 4HMHA 5ADSA 1M51A 4UW1A 1EFYA 3GN7A 2RCWA 3UH4A 2QF2A 3L3LA 4L70A 5EBTA 2OLQA 4IUEA 4TJUA 4L34A 4UI4A 3SMJA 4PNTA 2RKDA 4TOSA 4ZZYA 4BUAA 4U6AA 1YLHA 4L0IA 4N4VA 5FH3A 4L7PA 4R6EA 4L7NA 3U9YA 4GMZA 5AL1A 4UVYA 4YWBA 1KHBA 4GNQA 2GMVA 4BJCA 4YW9A 4L0BA 5AEHA 5FH2A 4PNNA 2PQFA 4L7UA 1OS1A 4BUUA 4BUIA 4OPXC 4I9IA 4R43A 4UVWA 4PNLA 5A00A 4F0EA 4KRSA 2FAFA 4HKKA 2RKAA 4GMWA 3P0NA 4GNLA 4HKNA 3MOFA 1GS0A 5ADRA 5FPFA 4L2KA 1II2A 4TKGA 5AL5A 3GEYA 4KZUA 4HLMA 4TK5A 3P0QA 4UVSA 4L7RA 4UVTA 4TJWA 4R5WA 4J1ZA 5FH5A 4L10A 4WIUA 4BJBA 1A26A 4UVOA 1WOKA 5FH1A 4BUDA 4UHGA 5I67A 4OQBC 4MSGA 1AYLA 1K3DA 4PNQA 1J3BA 4HLGA 4HYFA 3C49A 1KHGA 2PAXA 5FH0A 4J3MA 4UFUA 3SMIA 4XHUA 4K4FA 3BLJA 3MHKA 4L7OA 2ZCIA 4UNDA 4L2GA 4UXBA 2RKEA 4YW8A 5C5RA 5FPGA 4BU3A 3CE0A 4BFPA 5ADQA 4BUYA 1KHEA 4N4TA 2PXZX 4TKFA 2OLRA 4UVNA 4GNOA 3KJDA 4OQAC 4L2FA 4L33A 4WPUA 4PJVA 4M7BA 4L31A 4LI8A 4W6EA 5FH4A 4YWDA 4ZZZA 1YVYA 2QEYA 3KR8A 4HLFA 2RK8A 4HKIA 4UI3A 4ZZXA 4UI8A 3KCZA 4UFYA 4UI5A 4BUVA 4L32A 4HLHA 2PY7X 4BUWA 4HLKA 4DQYC 5DCZA 2RF5A 3HKVA 4L0VA 3DTBA 3GOYA 4TJYA 3UA9A 4TKIA 4UI7A 4L09A 4BU8A 5LX6A 4L7LA 4LI6A 5AL2A 3C4HA 3MOHA 4W5SA 5AKWA 4AVUA 5ADTA 1UK1A 1UK0A 3DT7A
chains in the Genus database with same CATH topology
4N3RA 4KZLA 4UVUA 3P0PA 4GMUA 4BU9A 3MHJA 4BJ9A 4PNSA 4WPTA 4F1QA 4UVXA 4OX2A 4UUHA 2PAWA 4GNPA 4UVZA 4OA7A 4HHYA 4BUXA 5LYHA 1YTMA 4J21A 4PNMA 4AVWA 4GV7A 4GV0A 4UVVA 4PNRA 3UDDA 4PMLA 4UVPA 5C5QA 2QF1A 2FAHA 3U9HA 3KR7A 4L0SA 4PJTA 3SE2A 3DT2A 4UVLA 5AL3A 5AL4A 2PC9A 4RV6A 4HL5A 3PAXA 4PAXA 4UI6A 4BUFA 2QZYA 4X52A 1AQ2A 4W5IA 4BU5A 1OENA 4WPVA 4TVJA 1KHFA 4L0TA 3UH2A 4WL8A 2QEWA 4BU6A 4L6ZA 4BUSA 2RK7A 2X5YA 2RD6A 3DT4A 4WIEA 1NHXA 4L6SA 4WOUA 4F1LA 4BUEA 4LI7A 4TORA 5C5PA 4BUTA 4GNMA 4TK0A 1K3CA 4GV4A 4J3LA 4UX4A 4BU7A 1PAXA 3FHBA 4MSKA 1YGGA 5ECEA 4GV2A 4J22A 4HHZA 4MT9A 4RCGA 3GJWA 4DVIA 4KZQA 4PY4A 5ETYA 4BS4A 1XKVA 5LXPA 3L3MA 4GMMA 3W51A 5AKUA 4K4EA 3MOEA 4HMHA 5ADSA 1M51A 4UW1A 1EFYA 3GN7A 2RCWA 3UH4A 2QF2A 3L3LA 4L70A 5EBTA 2OLQA 4IUEA 4TJUA 4L34A 4UI4A 3SMJA 4PNTA 2RKDA 4TOSA 4ZZYA 4BUAA 4U6AA 1YLHA 4L0IA 4N4VA 5FH3A 4L7PA 4R6EA 4L7NA 3U9YA 4GMZA 5AL1A 4UVYA 4YWBA 1KHBA 4GNQA 2GMVA 4BJCA 4YW9A 4L0BA 5AEHA 5FH2A 4PNNA 2PQFA 4L7UA 1OS1A 4BUUA 4BUIA 4OPXC 4I9IA 4R43A 4UVWA 4PNLA 5A00A 4F0EA 4KRSA 2FAFA 4HKKA 2RKAA 4GMWA 3P0NA 4GNLA 4HKNA 3MOFA 1GS0A 5ADRA 5FPFA 4L2KA 1II2A 4TKGA 5AL5A 3GEYA 4KZUA 4HLMA 4TK5A 3P0QA 4UVSA 4L7RA 4UVTA 4TJWA 4R5WA 4J1ZA 5FH5A 4L10A 4WIUA 4BJBA 1A26A 4UVOA 1WOKA 5FH1A 4BUDA 4UHGA 5I67A 4OQBC 4MSGA 1AYLA 1K3DA 4PNQA 1J3BA 4HLGA 4HYFA 3C49A 1KHGA 2PAXA 5FH0A 4J3MA 4UFUA 3SMIA 4XHUA 4K4FA 3BLJA 3MHKA 4L7OA 2ZCIA 4UNDA 4L2GA 4UXBA 2RKEA 4YW8A 5C5RA 5FPGA 4BU3A 3CE0A 4BFPA 5ADQA 4BUYA 1KHEA 4N4TA 2PXZX 4TKFA 2OLRA 4UVNA 4GNOA 3KJDA 4OQAC 4L2FA 4L33A 4WPUA 4PJVA 4M7BA 4L31A 4LI8A 4W6EA 5FH4A 4YWDA 4ZZZA 1YVYA 2QEYA 3KR8A 4HLFA 2RK8A 4HKIA 4UI3A 4ZZXA 4UI8A 3KCZA 4UFYA 4UI5A 4BUVA 4L32A 4HLHA 2PY7X 4BUWA 4HLKA 4DQYC 5DCZA 2RF5A 3HKVA 4L0VA 3DTBA 3GOYA 4TJYA 3UA9A 4TKIA 4UI7A 4L09A 4BU8A 5LX6A 4L7LA 4LI6A 5AL2A 3C4HA 3MOHA 4W5SA 5AKWA 4AVUA 5ADTA 1UK1A 1UK0A 3DT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3R A;  4KZL A;  4UVU A;  3P0P A;  4BU9 A;  3MHJ A;  4BJ9 A;  4PNS A;  4F1Q A;  4UVX A;  4UUH A;  2PAW A;  4UVZ A;  5LYH A;  4OA7 A;  4HHY A;  4BUX A;  4J21 A;  4PNM A;  4TK0 A;  4GV7 A;  4GV0 A;  4UVV A;  4PNR A;  3UDD A;  4PML A;  4UVP A;  5C5Q A;  3U9H A;  3KR7 A;  4L0S A;  4PJT A;  3SE2 A;  4UVL A;  5AL3 A;  5AL4 A;  4RV6 A;  4BUF A;  4HL5 A;  3PAX A;  4PAX A;  4UI6 A;  4X52 A;  4W5I A;  4BU5 A;  3UH2 A;  4TVJ A;  4L0T A;  4BU6 A;  4L6Z A;  4BUS A;  2X5Y A;  2RD6 A;  4L6S A;  4F1L A;  4BUE A;  4LI7 A;  4TOR A;  5C5P A;  4BUT A;  4GV4 A;  4J3L A;  4UX4 A;  4BU7 A;  1PAX A;  3FHB A;  4MSK A;  5ECE A;  4GV2 A;  4J22 A;  4HHZ A;  4MT9 A;  3GJW A;  4DVI A;  4KZQ A;  4PY4 A;  5ETY A;  4BS4 A;  5LXP A;  3L3M A;  3W51 A;  1UK0 A;  5AKU A;  4K4E A;  4HMH A;  5ADS A;  4UW1 A;  1EFY A;  3GN7 A;  2RCW A;  3UH4 A;  3L3L A;  4L70 A;  5EBT A;  4TJU A;  4IUE A;  4UI4 A;  4L34 A;  3SMJ A;  4PNT A;  4TOS A;  4ZZY A;  4BUA A;  4U6A A;  4L0I A;  4N4V A;  4L7P A;  4R6E A;  4L7N A;  3U9Y A;  5AL1 A;  4UVY A;  4BJC A;  4L0B A;  5AEH A;  4PNN A;  2PQF A;  4L7U A;  4BUU A;  4OPX C;  4BUI A;  4I9I A;  4UVW A;  4PNL A;  5A00 A;  4F0E A;  4KRS A;  4HKK A;  3P0N A;  4HKN A;  1GS0 A;  5FPF A;  4L2K A;  4TKG A;  5AL5 A;  3GEY A;  4KZU A;  4HLM A;  4TK5 A;  3P0Q A;  4UVS A;  4L7R A;  4UVT A;  4TJW A;  4R5W A;  4J1Z A;  4L10 A;  4BJB A;  1A26 A;  4UVO A;  1WOK A;  4BUD A;  4UHG A;  4OQB C;  4MSG A;  4PNQ A;  4HLG A;  4HYF A;  3C49 A;  2PAX A;  3SMI A;  4AVW A;  4J3M A;  4UFU A;  4XHU A;  4UND A;  3BLJ A;  3MHK A;  4L7O A;  4UXB A;  5C5R A;  4L2G A;  5ADR A;  5FPG A;  4BU3 A;  3CE0 A;  4BFP A;  5ADQ A;  4BUY A;  4N4T A;  4TKF A;  4UVN A;  4OQA C;  3KJD A;  4L33 A;  4PJV A;  4M7B A;  4L31 A;  4LI8 A;  4W6E A;  4ZZZ A;  3KR8 A;  4HLF A;  4HKI A;  4UI3 A;  4ZZX A;  4UI8 A;  3KCZ A;  4UFY A;  4UI5 A;  4BUV A;  4L32 A;  4HLH A;  4BUW A;  4HLK A;  4DQY C;  5DCZ A;  2RF5 A;  3HKV A;  4L0V A;  3GOY A;  4TJY A;  3UA9 A;  4TKI A;  4UI7 A;  4L09 A;  4BU8 A;  5LX6 A;  4L7L A;  4LI6 A;  5AL2 A;  3C4H A;  4W5S A;  5AKW A;  4AVU A;  5ADT A;  1UK1 A;  4L2F A;  4K4F A; 
#chains in the Genus database with same CATH topology
 4N3R A;  4KZL A;  4UVU A;  3P0P A;  4GMU A;  4BU9 A;  3MHJ A;  4BJ9 A;  4PNS A;  4WPT A;  4F1Q A;  4UVX A;  4OX2 A;  4UUH A;  2PAW A;  4GNP A;  4UVZ A;  4OA7 A;  4HHY A;  4BUX A;  5LYH A;  1YTM A;  4J21 A;  4PNM A;  4AVW A;  4GV7 A;  4GV0 A;  4UVV A;  4PNR A;  3UDD A;  4PML A;  4UVP A;  5C5Q A;  2QF1 A;  2FAH A;  3U9H A;  3KR7 A;  4L0S A;  4PJT A;  3SE2 A;  3DT2 A;  4UVL A;  5AL3 A;  5AL4 A;  2PC9 A;  4RV6 A;  4HL5 A;  3PAX A;  4PAX A;  4UI6 A;  4BUF A;  2QZY A;  4X52 A;  1AQ2 A;  4W5I A;  4BU5 A;  1OEN A;  4WPV A;  4TVJ A;  1KHF A;  4L0T A;  3UH2 A;  4WL8 A;  2QEW A;  4BU6 A;  4L6Z A;  4BUS A;  2RK7 A;  2X5Y A;  2RD6 A;  3DT4 A;  4WIE A;  1NHX A;  4L6S A;  4WOU A;  4F1L A;  4BUE A;  4LI7 A;  4TOR A;  5C5P A;  4BUT A;  4GNM A;  4TK0 A;  1K3C A;  4GV4 A;  4J3L A;  4UX4 A;  4BU7 A;  1PAX A;  3FHB A;  4MSK A;  1YGG A;  5ECE A;  4GV2 A;  4J22 A;  4HHZ A;  4MT9 A;  4RCG A;  3GJW A;  4DVI A;  4KZQ A;  4PY4 A;  5ETY A;  4BS4 A;  1XKV A;  5LXP A;  3L3M A;  4GMM A;  3W51 A;  5AKU A;  4K4E A;  3MOE A;  4HMH A;  5ADS A;  1M51 A;  4UW1 A;  1EFY A;  3GN7 A;  2RCW A;  3UH4 A;  2QF2 A;  3L3L A;  4L70 A;  5EBT A;  2OLQ A;  4IUE A;  4TJU A;  4L34 A;  4UI4 A;  3SMJ A;  4PNT A;  2RKD A;  4TOS A;  4ZZY A;  4BUA A;  4U6A A;  1YLH A;  4L0I A;  4N4V A;  5FH3 A;  4L7P A;  4R6E A;  4L7N A;  3U9Y A;  4GMZ A;  5AL1 A;  4UVY A;  4YWB A;  1KHB A;  4GNQ A;  2GMV A;  4BJC A;  4YW9 A;  4L0B A;  5AEH A;  5FH2 A;  4PNN A;  2PQF A;  4L7U A;  1OS1 A;  4BUU A;  4BUI A;  4OPX C;  4I9I A;  4R43 A;  4UVW A;  4PNL A;  5A00 A;  4F0E A;  4KRS A;  2FAF A;  4HKK A;  2RKA A;  4GMW A;  3P0N A;  4GNL A;  4HKN A;  3MOF A;  1GS0 A;  5ADR A;  5FPF A;  4L2K A;  1II2 A;  4TKG A;  5AL5 A;  3GEY A;  4KZU A;  4HLM A;  4TK5 A;  3P0Q A;  4UVS A;  4L7R A;  4UVT A;  4TJW A;  4R5W A;  4J1Z A;  5FH5 A;  4L10 A;  4WIU A;  4BJB A;  1A26 A;  4UVO A;  1WOK A;  5FH1 A;  4BUD A;  4UHG A;  5I67 A;  4OQB C;  4MSG A;  1AYL A;  1K3D A;  4PNQ A;  1J3B A;  4HLG A;  4HYF A;  3C49 A;  1KHG A;  2PAX A;  5FH0 A;  4J3M A;  4UFU A;  3SMI A;  4XHU A;  4K4F A;  3BLJ A;  3MHK A;  4L7O A;  2ZCI A;  4UND A;  4L2G A;  4UXB A;  2RKE A;  4YW8 A;  5C5R A;  5FPG A;  4BU3 A;  3CE0 A;  4BFP A;  5ADQ A;  4BUY A;  1KHE A;  4N4T A;  2PXZ X;  4TKF A;  2OLR A;  4UVN A;  4GNO A;  3KJD A;  4OQA C;  4L2F A;  4L33 A;  4WPU A;  4PJV A;  4M7B A;  4L31 A;  4LI8 A;  4W6E A;  5FH4 A;  4YWD A;  4ZZZ A;  1YVY A;  2QEY A;  3KR8 A;  4HLF A;  2RK8 A;  4HKI A;  4UI3 A;  4ZZX A;  4UI8 A;  3KCZ A;  4UFY A;  4UI5 A;  4BUV A;  4L32 A;  4HLH A;  2PY7 X;  4BUW A;  4HLK A;  4DQY C;  5DCZ A;  2RF5 A;  3HKV A;  4L0V A;  3DTB A;  3GOY A;  4TJY A;  3UA9 A;  4TKI A;  4UI7 A;  4L09 A;  4BU8 A;  5LX6 A;  4L7L A;  4LI6 A;  5AL2 A;  3C4H A;  3MOH A;  4W5S A;  5AKW A;  4AVU A;  5ADT A;  1UK1 A;  1UK0 A;  3DT7 A; 
#chains in the Genus database with same CATH homology
 4N3R A;  4KZL A;  4UVU A;  3P0P A;  4GMU A;  4BU9 A;  3MHJ A;  4BJ9 A;  4PNS A;  4WPT A;  4F1Q A;  4UVX A;  4OX2 A;  4UUH A;  2PAW A;  4GNP A;  4UVZ A;  4OA7 A;  4HHY A;  4BUX A;  5LYH A;  1YTM A;  4J21 A;  4PNM A;  4AVW A;  4GV7 A;  4GV0 A;  4UVV A;  4PNR A;  3UDD A;  4PML A;  4UVP A;  5C5Q A;  2QF1 A;  2FAH A;  3U9H A;  3KR7 A;  4L0S A;  4PJT A;  3SE2 A;  3DT2 A;  4UVL A;  5AL3 A;  5AL4 A;  2PC9 A;  4RV6 A;  4HL5 A;  3PAX A;  4PAX A;  4UI6 A;  4BUF A;  2QZY A;  4X52 A;  1AQ2 A;  4W5I A;  4BU5 A;  1OEN A;  4WPV A;  4TVJ A;  1KHF A;  4L0T A;  3UH2 A;  4WL8 A;  2QEW A;  4BU6 A;  4L6Z A;  4BUS A;  2RK7 A;  2X5Y A;  2RD6 A;  3DT4 A;  4WIE A;  1NHX A;  4L6S A;  4WOU A;  4F1L A;  4BUE A;  4LI7 A;  4TOR A;  5C5P A;  4BUT A;  4GNM A;  4TK0 A;  1K3C A;  4GV4 A;  4J3L A;  4UX4 A;  4BU7 A;  1PAX A;  3FHB A;  4MSK A;  1YGG A;  5ECE A;  4GV2 A;  4J22 A;  4HHZ A;  4MT9 A;  4RCG A;  3GJW A;  4DVI A;  4KZQ A;  4PY4 A;  5ETY A;  4BS4 A;  1XKV A;  5LXP A;  3L3M A;  4GMM A;  3W51 A;  5AKU A;  4K4E A;  3MOE A;  4HMH A;  5ADS A;  1M51 A;  4UW1 A;  1EFY A;  3GN7 A;  2RCW A;  3UH4 A;  2QF2 A;  3L3L A;  4L70 A;  5EBT A;  2OLQ A;  4IUE A;  4TJU A;  4L34 A;  4UI4 A;  3SMJ A;  4PNT A;  2RKD A;  4TOS A;  4ZZY A;  4BUA A;  4U6A A;  1YLH A;  4L0I A;  4N4V A;  5FH3 A;  4L7P A;  4R6E A;  4L7N A;  3U9Y A;  4GMZ A;  5AL1 A;  4UVY A;  4YWB A;  1KHB A;  4GNQ A;  2GMV A;  4BJC A;  4YW9 A;  4L0B A;  5AEH A;  5FH2 A;  4PNN A;  2PQF A;  4L7U A;  1OS1 A;  4BUU A;  4BUI A;  4OPX C;  4I9I A;  4R43 A;  4UVW A;  4PNL A;  5A00 A;  4F0E A;  4KRS A;  2FAF A;  4HKK A;  2RKA A;  4GMW A;  3P0N A;  4GNL A;  4HKN A;  3MOF A;  1GS0 A;  5ADR A;  5FPF A;  4L2K A;  1II2 A;  4TKG A;  5AL5 A;  3GEY A;  4KZU A;  4HLM A;  4TK5 A;  3P0Q A;  4UVS A;  4L7R A;  4UVT A;  4TJW A;  4R5W A;  4J1Z A;  5FH5 A;  4L10 A;  4WIU A;  4BJB A;  1A26 A;  4UVO A;  1WOK A;  5FH1 A;  4BUD A;  4UHG A;  5I67 A;  4OQB C;  4MSG A;  1AYL A;  1K3D A;  4PNQ A;  1J3B A;  4HLG A;  4HYF A;  3C49 A;  1KHG A;  2PAX A;  5FH0 A;  4J3M A;  4UFU A;  3SMI A;  4XHU A;  4K4F A;  3BLJ A;  3MHK A;  4L7O A;  2ZCI A;  4UND A;  4L2G A;  4UXB A;  2RKE A;  4YW8 A;  5C5R A;  5FPG A;  4BU3 A;  3CE0 A;  4BFP A;  5ADQ A;  4BUY A;  1KHE A;  4N4T A;  2PXZ X;  4TKF A;  2OLR A;  4UVN A;  4GNO A;  3KJD A;  4OQA C;  4L2F A;  4L33 A;  4WPU A;  4PJV A;  4M7B A;  4L31 A;  4LI8 A;  4W6E A;  5FH4 A;  4YWD A;  4ZZZ A;  1YVY A;  2QEY A;  3KR8 A;  4HLF A;  2RK8 A;  4HKI A;  4UI3 A;  4ZZX A;  4UI8 A;  3KCZ A;  4UFY A;  4UI5 A;  4BUV A;  4L32 A;  4HLH A;  2PY7 X;  4BUW A;  4HLK A;  4DQY C;  5DCZ A;  2RF5 A;  3HKV A;  4L0V A;  3DTB A;  3GOY A;  4TJY A;  3UA9 A;  4TKI A;  4UI7 A;  4L09 A;  4BU8 A;  5LX6 A;  4L7L A;  4LI6 A;  5AL2 A;  3C4H A;  3MOH A;  4W5S A;  5AKW A;  4AVU A;  5ADT A;  1UK1 A;  1UK0 A;  3DT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...