4BUFA

Crystal structure of human tankyrase 2 in complex with 2-(4- acetylphenyl)-3,4-dihydroquinazolin-4-one
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4bufA00
4HHZA 4HLHA 4UVYA 3U9HA 4UXBA 3UH2A 4L33A 5AKWA 5AL4A 5AL3A 3P0NA 4J1ZA 4L0TA 4KZUA 4HKNA 4LI7A 4BUSA 5LX6A 4BUXA 4N4TA 4TKIA 4L2FA 2RF5A 3GJWA 4BUTA 4BUAA 3KR7A 5ECEA 5ADSA 4KRSA 3P0QA 4L6SA 4L7LA 4IUEA 4PNQA 4BUFA 4BJCA 1GS0A 4ZZYA 4UVLA 2X5YA 3UH4A 4UVSA 4GV0A 4L7OA 4UVXA 4GV4A 4TOSA 4J22A 4I9IA 4L0BA 2PAWA 4PNMA 5AL2A 4PNRA 4TJYA 4OQBC 4W5SA 4J3LA 4L6ZA 3GEYA 2RCWA 5ADRA 4UVTA 3L3LA 5C5QA 4HMHA 4U6AA 4L2GA 4UI8A 1UK0A 4UX4A 3CE0A 4RV6A 4HLMA 3C49A 4PNSA 5AEHA 5FPGA 4BUVA 4F1LA 4BUIA 3SMIA 4HL5A 3KR8A 4N3RA 4BUEA 1PAXA 4F1QA 4TVJA 4AVUA 4PJVA 5LYHA 3UA9A 4XHUA 4BU5A 5ADQA 3BLJA 4TJWA 4N4VA 4PY4A 4UW1A 4ZZZA 4HHYA 4L70A 4HLFA 4UI3A 4UVUA 4BS4A 5AKUA 5ADTA 4L10A 4MT9A 4PNTA 4M7BA 4OA7A 4L0SA 4BU3A 4BU9A 4PAXA 4L32A 3PAXA 4L0VA 3GOYA 4PMLA 3L3MA 4HLKA 2PQFA 4BUYA 4BUWA 1EFYA 4R5WA 4OPXC 3FHBA 4HKKA 4L2KA 4L31A 5C5RA 3SMJA 4J3MA 4LI8A 4ZZXA 1A26A 3GN7A 4KZLA 4L7UA 4UHGA 4UFYA 4OQAC 4UVVA 4W5IA 5DCZA 4HLGA 4L7NA 4BUUA 4L34A 3MHJA 4BU6A 4UVZA 4LI6A 4PNLA 4TJUA 4UFUA 4UI4A 4X52A 3HKVA 4F0EA 3SE2A 4L7RA 4HYFA 4UI7A 4DVIA 4TK0A 5LXPA 4PNNA 4UVOA 5EBTA 4UVPA 4J21A 3MHKA 4AVWA 4BU7A 4PJTA 4UI6A 4MSKA 4UUHA 4MSGA 2RD6A 3UDDA 4L09A 4GV2A 3W51A 2PAXA 5ETYA 4DQYC 4BJ9A 5FPFA 3U9YA 4K4EA 4K4FA 3P0PA 4HKIA 4TKGA 4BJBA 4L0IA 3KJDA 5AL5A 4UVWA 4GV7A 5A00A 4KZQA 4BU8A 1UK1A 4UNDA 4BFPA 4TORA 1WOKA 4TK5A 3C4HA 4UVNA 5AL1A 4L7PA 3KCZA 4W6EA 5C5PA 4R6EA 4BUDA 4TKFA 4UI5A
chains in the Genus database with same CATH superfamily
4HHZA 1OENA 4HLHA 4UVYA 3U9HA 4UXBA 3UH2A 4L33A 5AKWA 5AL4A 5AL3A 4TK0A 3P0NA 4GNPA 4GNQA 4J1ZA 4L0TA 4KZUA 4HKNA 4LI7A 4BUSA 5LX6A 5FH1A 2PY7X 4GMZA 4WOUA 4N4TA 4BUXA 4TKIA 2RKEA 4L2FA 2RF5A 3GJWA 4BUTA 4BUAA 3KR7A 5ECEA 5ADSA 4KRSA 5FH2A 3P0QA 1M51A 4L6SA 4L7LA 4IUEA 4PNQA 1KHFA 4BUFA 3DTBA 1GS0A 4BJCA 4GMMA 4ZZYA 4UVLA 2X5YA 3UH4A 4UVSA 4GV0A 4L7OA 4UVXA 4GV4A 4TOSA 4GNLA 4J22A 4I9IA 4L0BA 2PAWA 4PNMA 5AL2A 4PNRA 4WIEA 4TJYA 3MOHA 4YW8A 4OQBC 4W5SA 4J3LA 4L6ZA 4F0EA 1J3BA 3GEYA 2RCWA 5FH0A 4UVTA 5ADRA 3L3LA 1AYLA 4HMHA 4U6AA 5C5QA 5FH5A 4L2GA 4UI8A 1UK0A 4UX4A 1YGGA 3CE0A 4RV6A 4HLMA 5FH4A 3C49A 4PNSA 5AEHA 4R43A 5FPGA 2QF1A 4WL8A 4BUVA 4F1LA 4RCGA 4BUIA 3SMIA 2OLQA 4HL5A 2QF2A 4WPVA 3KR8A 4N3RA 4BUEA 1PAXA 4F1QA 3DT2A 4TVJA 4GMUA 4PJVA 4AVUA 5LYHA 3UA9A 4XHUA 4GNOA 4BU5A 5ADQA 3BLJA 4TJWA 3DT4A 3DT7A 4N4VA 4PY4A 1K3CA 4UW1A 4ZZZA 5I67A 4HHYA 4L70A 4HLFA 4UI3A 5FH3A 4UVUA 2QEWA 4BS4A 1YVYA 5AKUA 5ADTA 2PC9A 4L10A 4MT9A 4PNTA 2OLRA 4M7BA 4OA7A 2RK7A 1II2A 4L0SA 4BU3A 4YWDA 4BU9A 4PAXA 4L32A 3PAXA 4L0VA 3GOYA 4PMLA 2RKAA 3L3MA 2GMVA 4HLKA 4OX2A 2PQFA 4BUYA 4BUWA 1EFYA 4R5WA 4OPXC 3FHBA 4HKKA 4L2KA 4L31A 5C5RA 3SMJA 4YW9A 4J3MA 4GNMA 4LI8A 4ZZXA 1A26A 3GN7A 4KZLA 4L7UA 4UHGA 4UFYA 4OQAC 1KHEA 4UVVA 1NHXA 4W5IA 4HLGA 5DCZA 4L7NA 4BUUA 4L34A 3MHJA 4BU6A 4UVZA 2FAHA 4LI6A 4PNLA 4TJUA 4UFUA 2ZCIA 3MOFA 3HKVA 4UI4A 4WPUA 4L7RA 4HYFA 4UI7A 4WIUA 4WPTA 3SE2A 4PNNA 4UVOA 5EBTA 4DVIA 5LXPA 4UVPA 4J21A 3MHKA 4AVWA 4BU7A 1K3DA 4PJTA 4UI6A 4MSKA 4UUHA 4MSGA 2RD6A 2PXZX 2RKDA 3MOEA 3UDDA 4L09A 1AQ2A 4GV2A 3W51A 2PAXA 4X52A 5ETYA 4BJ9A 5FPFA 1YTMA 1KHBA 4DQYC 3U9YA 4YWBA 4K4EA 4K4FA 2QEYA 2QZYA 3P0PA 4HKIA 4TKGA 1YLHA 2RK8A 4BJBA 4GMWA 3KJDA 4L0IA 5AL5A 4UVWA 4GV7A 2FAFA 5A00A 4KZQA 4BU8A 1UK1A 4UNDA 1XKVA 4BFPA 1KHGA 1WOKA 4TK5A 4TORA 3C4HA 4UVNA 5AL1A 4L7PA 3KCZA 4W6EA 5C5PA 4R6EA 4BUDA 4TKFA 1OS1A 4UI5A
chains in the Genus database with same CATH topology
4HHZA 1OENA 4HLHA 4UVYA 3U9HA 4UXBA 3UH2A 4L33A 5AKWA 5AL4A 5AL3A 4TK0A 3P0NA 4GNPA 4GNQA 4J1ZA 4L0TA 4KZUA 4HKNA 4LI7A 4BUSA 5LX6A 5FH1A 2PY7X 4GMZA 4WOUA 4N4TA 4BUXA 4TKIA 2RKEA 4L2FA 2RF5A 3GJWA 4BUTA 4BUAA 3KR7A 5ECEA 5ADSA 4KRSA 5FH2A 3P0QA 1M51A 4L6SA 4L7LA 4IUEA 4PNQA 1KHFA 4BUFA 3DTBA 1GS0A 4BJCA 4GMMA 4ZZYA 4UVLA 2X5YA 3UH4A 4UVSA 4GV0A 4L7OA 4UVXA 4GV4A 4TOSA 4GNLA 4J22A 4I9IA 4L0BA 2PAWA 4PNMA 5AL2A 4PNRA 4WIEA 4TJYA 3MOHA 4YW8A 4OQBC 4W5SA 4J3LA 4L6ZA 4F0EA 1J3BA 3GEYA 2RCWA 5FH0A 4UVTA 5ADRA 3L3LA 1AYLA 4HMHA 4U6AA 5C5QA 5FH5A 4L2GA 4UI8A 1UK0A 4UX4A 1YGGA 3CE0A 4RV6A 4HLMA 5FH4A 3C49A 4PNSA 5AEHA 4R43A 5FPGA 2QF1A 4WL8A 4BUVA 4F1LA 4RCGA 4BUIA 3SMIA 2OLQA 4HL5A 2QF2A 4WPVA 3KR8A 4N3RA 4BUEA 1PAXA 4F1QA 3DT2A 4TVJA 4GMUA 4PJVA 4AVUA 5LYHA 3UA9A 4XHUA 4GNOA 4BU5A 5ADQA 3BLJA 4TJWA 3DT4A 3DT7A 4N4VA 4PY4A 1K3CA 4UW1A 4ZZZA 5I67A 4HHYA 4L70A 4HLFA 4UI3A 5FH3A 4UVUA 2QEWA 4BS4A 1YVYA 5AKUA 5ADTA 2PC9A 4L10A 4MT9A 4PNTA 2OLRA 4M7BA 4OA7A 2RK7A 1II2A 4L0SA 4BU3A 4YWDA 4BU9A 4PAXA 4L32A 3PAXA 4L0VA 3GOYA 4PMLA 2RKAA 3L3MA 2GMVA 4HLKA 4OX2A 2PQFA 4BUYA 4BUWA 1EFYA 4R5WA 4OPXC 3FHBA 4HKKA 4L2KA 4L31A 5C5RA 3SMJA 4YW9A 4J3MA 4GNMA 4LI8A 4ZZXA 1A26A 3GN7A 4KZLA 4L7UA 4UHGA 4UFYA 4OQAC 1KHEA 4UVVA 1NHXA 4W5IA 4HLGA 5DCZA 4L7NA 4BUUA 4L34A 3MHJA 4BU6A 4UVZA 2FAHA 4LI6A 4PNLA 4TJUA 4UFUA 2ZCIA 3MOFA 3HKVA 4UI4A 4WPUA 4L7RA 4HYFA 4UI7A 4WIUA 4WPTA 3SE2A 4PNNA 4UVOA 5EBTA 4DVIA 5LXPA 4UVPA 4J21A 3MHKA 4AVWA 4BU7A 1K3DA 4PJTA 4UI6A 4MSKA 4UUHA 4MSGA 2RD6A 2PXZX 2RKDA 3MOEA 3UDDA 4L09A 1AQ2A 4GV2A 3W51A 2PAXA 4X52A 5ETYA 4BJ9A 5FPFA 1YTMA 1KHBA 4DQYC 3U9YA 4YWBA 4K4EA 4K4FA 2QEYA 2QZYA 3P0PA 4HKIA 4TKGA 1YLHA 2RK8A 4BJBA 4GMWA 3KJDA 4L0IA 5AL5A 4UVWA 4GV7A 2FAFA 5A00A 4KZQA 4BU8A 1UK1A 4UNDA 1XKVA 4BFPA 1KHGA 1WOKA 4TK5A 4TORA 3C4HA 4UVNA 5AL1A 4L7PA 3KCZA 4W6EA 5C5PA 4R6EA 4BUDA 4TKFA 1OS1A 4UI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HHZ A;  4HLH A;  4UVY A;  3U9H A;  4UXB A;  3UH2 A;  4L33 A;  5AKW A;  5AL4 A;  5AL3 A;  3P0N A;  4J1Z A;  4L0T A;  4KZU A;  4HKN A;  4LI7 A;  4BUS A;  5LX6 A;  4BUX A;  4N4T A;  4TKI A;  4L2F A;  2RF5 A;  3GJW A;  4BUT A;  4BUA A;  3KR7 A;  5ECE A;  5ADS A;  4KRS A;  3P0Q A;  4L6S A;  4L7L A;  4IUE A;  4PNQ A;  4BUF A;  4BJC A;  1GS0 A;  4ZZY A;  4UVL A;  2X5Y A;  3UH4 A;  4UVS A;  4GV0 A;  4L7O A;  4UVX A;  4GV4 A;  4TOS A;  4J22 A;  4I9I A;  4L0B A;  2PAW A;  4PNM A;  5AL2 A;  4PNR A;  4TJY A;  4OQB C;  4W5S A;  4J3L A;  4L6Z A;  3GEY A;  2RCW A;  5ADR A;  4UVT A;  3L3L A;  5C5Q A;  4HMH A;  4U6A A;  4L2G A;  4UI8 A;  1UK0 A;  4UX4 A;  3CE0 A;  4RV6 A;  4HLM A;  3C49 A;  4PNS A;  5AEH A;  5FPG A;  4BUV A;  4F1L A;  4BUI A;  3SMI A;  4HL5 A;  3KR8 A;  4N3R A;  4BUE A;  1PAX A;  4F1Q A;  4TVJ A;  4AVU A;  4PJV A;  5LYH A;  3UA9 A;  4XHU A;  4BU5 A;  5ADQ A;  3BLJ A;  4TJW A;  4N4V A;  4PY4 A;  4UW1 A;  4ZZZ A;  4HHY A;  4L70 A;  4HLF A;  4UI3 A;  4UVU A;  4BS4 A;  5AKU A;  5ADT A;  4L10 A;  4MT9 A;  4PNT A;  4M7B A;  4OA7 A;  4L0S A;  4BU3 A;  4BU9 A;  4PAX A;  4L32 A;  3PAX A;  4L0V A;  3GOY A;  4PML A;  3L3M A;  4HLK A;  2PQF A;  4BUY A;  4BUW A;  1EFY A;  4R5W A;  4OPX C;  3FHB A;  4HKK A;  4L2K A;  4L31 A;  5C5R A;  3SMJ A;  4J3M A;  4LI8 A;  4ZZX A;  1A26 A;  3GN7 A;  4KZL A;  4L7U A;  4UHG A;  4UFY A;  4OQA C;  4UVV A;  4W5I A;  5DCZ A;  4HLG A;  4L7N A;  4BUU A;  4L34 A;  3MHJ A;  4BU6 A;  4UVZ A;  4LI6 A;  4PNL A;  4TJU A;  4UFU A;  4UI4 A;  4X52 A;  3HKV A;  4F0E A;  3SE2 A;  4L7R A;  4HYF A;  4UI7 A;  4DVI A;  4TK0 A;  5LXP A;  4PNN A;  4UVO A;  5EBT A;  4UVP A;  4J21 A;  3MHK A;  4AVW A;  4BU7 A;  4PJT A;  4UI6 A;  4MSK A;  4UUH A;  4MSG A;  2RD6 A;  3UDD A;  4L09 A;  4GV2 A;  3W51 A;  2PAX A;  5ETY A;  4DQY C;  4BJ9 A;  5FPF A;  3U9Y A;  4K4E A;  4K4F A;  3P0P A;  4HKI A;  4TKG A;  4BJB A;  4L0I A;  3KJD A;  5AL5 A;  4UVW A;  4GV7 A;  5A00 A;  4KZQ A;  4BU8 A;  1UK1 A;  4UND A;  4BFP A;  4TOR A;  1WOK A;  4TK5 A;  3C4H A;  4UVN A;  5AL1 A;  4L7P A;  3KCZ A;  4W6E A;  5C5P A;  4R6E A;  4BUD A;  4TKF A;  4UI5 A; 
#chains in the Genus database with same CATH topology
 4HHZ A;  1OEN A;  4HLH A;  4UVY A;  3U9H A;  4UXB A;  3UH2 A;  4L33 A;  5AKW A;  5AL4 A;  5AL3 A;  4TK0 A;  3P0N A;  4GNP A;  4GNQ A;  4J1Z A;  4L0T A;  4KZU A;  4HKN A;  4LI7 A;  4BUS A;  5LX6 A;  5FH1 A;  2PY7 X;  4GMZ A;  4WOU A;  4N4T A;  4BUX A;  4TKI A;  2RKE A;  4L2F A;  2RF5 A;  3GJW A;  4BUT A;  4BUA A;  3KR7 A;  5ECE A;  5ADS A;  4KRS A;  5FH2 A;  3P0Q A;  1M51 A;  4L6S A;  4L7L A;  4IUE A;  4PNQ A;  1KHF A;  4BUF A;  3DTB A;  1GS0 A;  4BJC A;  4GMM A;  4ZZY A;  4UVL A;  2X5Y A;  3UH4 A;  4UVS A;  4GV0 A;  4L7O A;  4UVX A;  4GV4 A;  4TOS A;  4GNL A;  4J22 A;  4I9I A;  4L0B A;  2PAW A;  4PNM A;  5AL2 A;  4PNR A;  4WIE A;  4TJY A;  3MOH A;  4YW8 A;  4OQB C;  4W5S A;  4J3L A;  4L6Z A;  4F0E A;  1J3B A;  3GEY A;  2RCW A;  5FH0 A;  4UVT A;  5ADR A;  3L3L A;  1AYL A;  4HMH A;  4U6A A;  5C5Q A;  5FH5 A;  4L2G A;  4UI8 A;  1UK0 A;  4UX4 A;  1YGG A;  3CE0 A;  4RV6 A;  4HLM A;  5FH4 A;  3C49 A;  4PNS A;  5AEH A;  4R43 A;  5FPG A;  2QF1 A;  4WL8 A;  4BUV A;  4F1L A;  4RCG A;  4BUI A;  3SMI A;  2OLQ A;  4HL5 A;  2QF2 A;  4WPV A;  3KR8 A;  4N3R A;  4BUE A;  1PAX A;  4F1Q A;  3DT2 A;  4TVJ A;  4GMU A;  4PJV A;  4AVU A;  5LYH A;  3UA9 A;  4XHU A;  4GNO A;  4BU5 A;  5ADQ A;  3BLJ A;  4TJW A;  3DT4 A;  3DT7 A;  4N4V A;  4PY4 A;  1K3C A;  4UW1 A;  4ZZZ A;  5I67 A;  4HHY A;  4L70 A;  4HLF A;  4UI3 A;  5FH3 A;  4UVU A;  2QEW A;  4BS4 A;  1YVY A;  5AKU A;  5ADT A;  2PC9 A;  4L10 A;  4MT9 A;  4PNT A;  2OLR A;  4M7B A;  4OA7 A;  2RK7 A;  1II2 A;  4L0S A;  4BU3 A;  4YWD A;  4BU9 A;  4PAX A;  4L32 A;  3PAX A;  4L0V A;  3GOY A;  4PML A;  2RKA A;  3L3M A;  2GMV A;  4HLK A;  4OX2 A;  2PQF A;  4BUY A;  4BUW A;  1EFY A;  4R5W A;  4OPX C;  3FHB A;  4HKK A;  4L2K A;  4L31 A;  5C5R A;  3SMJ A;  4YW9 A;  4J3M A;  4GNM A;  4LI8 A;  4ZZX A;  1A26 A;  3GN7 A;  4KZL A;  4L7U A;  4UHG A;  4UFY A;  4OQA C;  1KHE A;  4UVV A;  1NHX A;  4W5I A;  4HLG A;  5DCZ A;  4L7N A;  4BUU A;  4L34 A;  3MHJ A;  4BU6 A;  4UVZ A;  2FAH A;  4LI6 A;  4PNL A;  4TJU A;  4UFU A;  2ZCI A;  3MOF A;  3HKV A;  4UI4 A;  4WPU A;  4L7R A;  4HYF A;  4UI7 A;  4WIU A;  4WPT A;  3SE2 A;  4PNN A;  4UVO A;  5EBT A;  4DVI A;  5LXP A;  4UVP A;  4J21 A;  3MHK A;  4AVW A;  4BU7 A;  1K3D A;  4PJT A;  4UI6 A;  4MSK A;  4UUH A;  4MSG A;  2RD6 A;  2PXZ X;  2RKD A;  3MOE A;  3UDD A;  4L09 A;  1AQ2 A;  4GV2 A;  3W51 A;  2PAX A;  4X52 A;  5ETY A;  4BJ9 A;  5FPF A;  1YTM A;  1KHB A;  4DQY C;  3U9Y A;  4YWB A;  4K4E A;  4K4F A;  2QEY A;  2QZY A;  3P0P A;  4HKI A;  4TKG A;  1YLH A;  2RK8 A;  4BJB A;  4GMW A;  3KJD A;  4L0I A;  5AL5 A;  4UVW A;  4GV7 A;  2FAF A;  5A00 A;  4KZQ A;  4BU8 A;  1UK1 A;  4UND A;  1XKV A;  4BFP A;  1KHG A;  1WOK A;  4TK5 A;  4TOR A;  3C4H A;  4UVN A;  5AL1 A;  4L7P A;  3KCZ A;  4W6E A;  5C5P A;  4R6E A;  4BUD A;  4TKF A;  1OS1 A;  4UI5 A; 
#chains in the Genus database with same CATH homology
 4HHZ A;  1OEN A;  4HLH A;  4UVY A;  3U9H A;  4UXB A;  3UH2 A;  4L33 A;  5AKW A;  5AL4 A;  5AL3 A;  4TK0 A;  3P0N A;  4GNP A;  4GNQ A;  4J1Z A;  4L0T A;  4KZU A;  4HKN A;  4LI7 A;  4BUS A;  5LX6 A;  5FH1 A;  2PY7 X;  4GMZ A;  4WOU A;  4N4T A;  4BUX A;  4TKI A;  2RKE A;  4L2F A;  2RF5 A;  3GJW A;  4BUT A;  4BUA A;  3KR7 A;  5ECE A;  5ADS A;  4KRS A;  5FH2 A;  3P0Q A;  1M51 A;  4L6S A;  4L7L A;  4IUE A;  4PNQ A;  1KHF A;  4BUF A;  3DTB A;  1GS0 A;  4BJC A;  4GMM A;  4ZZY A;  4UVL A;  2X5Y A;  3UH4 A;  4UVS A;  4GV0 A;  4L7O A;  4UVX A;  4GV4 A;  4TOS A;  4GNL A;  4J22 A;  4I9I A;  4L0B A;  2PAW A;  4PNM A;  5AL2 A;  4PNR A;  4WIE A;  4TJY A;  3MOH A;  4YW8 A;  4OQB C;  4W5S A;  4J3L A;  4L6Z A;  4F0E A;  1J3B A;  3GEY A;  2RCW A;  5FH0 A;  4UVT A;  5ADR A;  3L3L A;  1AYL A;  4HMH A;  4U6A A;  5C5Q A;  5FH5 A;  4L2G A;  4UI8 A;  1UK0 A;  4UX4 A;  1YGG A;  3CE0 A;  4RV6 A;  4HLM A;  5FH4 A;  3C49 A;  4PNS A;  5AEH A;  4R43 A;  5FPG A;  2QF1 A;  4WL8 A;  4BUV A;  4F1L A;  4RCG A;  4BUI A;  3SMI A;  2OLQ A;  4HL5 A;  2QF2 A;  4WPV A;  3KR8 A;  4N3R A;  4BUE A;  1PAX A;  4F1Q A;  3DT2 A;  4TVJ A;  4GMU A;  4PJV A;  4AVU A;  5LYH A;  3UA9 A;  4XHU A;  4GNO A;  4BU5 A;  5ADQ A;  3BLJ A;  4TJW A;  3DT4 A;  3DT7 A;  4N4V A;  4PY4 A;  1K3C A;  4UW1 A;  4ZZZ A;  5I67 A;  4HHY A;  4L70 A;  4HLF A;  4UI3 A;  5FH3 A;  4UVU A;  2QEW A;  4BS4 A;  1YVY A;  5AKU A;  5ADT A;  2PC9 A;  4L10 A;  4MT9 A;  4PNT A;  2OLR A;  4M7B A;  4OA7 A;  2RK7 A;  1II2 A;  4L0S A;  4BU3 A;  4YWD A;  4BU9 A;  4PAX A;  4L32 A;  3PAX A;  4L0V A;  3GOY A;  4PML A;  2RKA A;  3L3M A;  2GMV A;  4HLK A;  4OX2 A;  2PQF A;  4BUY A;  4BUW A;  1EFY A;  4R5W A;  4OPX C;  3FHB A;  4HKK A;  4L2K A;  4L31 A;  5C5R A;  3SMJ A;  4YW9 A;  4J3M A;  4GNM A;  4LI8 A;  4ZZX A;  1A26 A;  3GN7 A;  4KZL A;  4L7U A;  4UHG A;  4UFY A;  4OQA C;  1KHE A;  4UVV A;  1NHX A;  4W5I A;  4HLG A;  5DCZ A;  4L7N A;  4BUU A;  4L34 A;  3MHJ A;  4BU6 A;  4UVZ A;  2FAH A;  4LI6 A;  4PNL A;  4TJU A;  4UFU A;  2ZCI A;  3MOF A;  3HKV A;  4UI4 A;  4WPU A;  4L7R A;  4HYF A;  4UI7 A;  4WIU A;  4WPT A;  3SE2 A;  4PNN A;  4UVO A;  5EBT A;  4DVI A;  5LXP A;  4UVP A;  4J21 A;  3MHK A;  4AVW A;  4BU7 A;  1K3D A;  4PJT A;  4UI6 A;  4MSK A;  4UUH A;  4MSG A;  2RD6 A;  2PXZ X;  2RKD A;  3MOE A;  3UDD A;  4L09 A;  1AQ2 A;  4GV2 A;  3W51 A;  2PAX A;  4X52 A;  5ETY A;  4BJ9 A;  5FPF A;  1YTM A;  1KHB A;  4DQY C;  3U9Y A;  4YWB A;  4K4E A;  4K4F A;  2QEY A;  2QZY A;  3P0P A;  4HKI A;  4TKG A;  1YLH A;  2RK8 A;  4BJB A;  4GMW A;  3KJD A;  4L0I A;  5AL5 A;  4UVW A;  4GV7 A;  2FAF A;  5A00 A;  4KZQ A;  4BU8 A;  1UK1 A;  4UND A;  1XKV A;  4BFP A;  1KHG A;  1WOK A;  4TK5 A;  4TOR A;  3C4H A;  4UVN A;  5AL1 A;  4L7P A;  3KCZ A;  4W6E A;  5C5P A;  4R6E A;  4BUD A;  4TKF A;  1OS1 A;  4UI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...