4BUIA

Crystal structure of human tankyrase 2 in complex with methyl 4-(4- oxo-3,4-dihydroquinazolin-2-yl)benzoate
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buiA00
4TJWA 4L0VA 5ECEA 4R6EA 4HYFA 4BUYA 3MHJA 4ZZYA 4PJTA 4L7LA 3GEYA 5LXPA 3BLJA 5AKUA 2X5YA 4L7PA 5LX6A 2RCWA 4J3LA 3FHBA 4GV2A 4KZLA 4PNMA 4BJBA 4UVPA 4BUXA 2PQFA 4DVIA 5LYHA 4BFPA 4LI7A 4RV6A 4BUWA 5ADRA 3CE0A 4L09A 4GV0A 4PNTA 3KJDA 4OPXC 4TORA 4L32A 4HKIA 5AL2A 4L7OA 4KZUA 1UK0A 4UVNA 5AEHA 4UVUA 4UVYA 3P0QA 4L0BA 4HLFA 4HLGA 3KCZA 3C49A 3SMIA 3U9YA 3UH4A 4BJ9A 3HKVA 4BU6A 4KRSA 4BUVA 4N4TA 4AVUA 4UHGA 4GV7A 4HLMA 4PNQA 4PY4A 4UI8A 5C5RA 3C4HA 4L6ZA 3PAXA 4TVJA 4F1QA 4L33A 4UI5A 4L70A 4OQBC 5ETYA 4TKFA 4L10A 4UVOA 5AL1A 5AL4A 4LI8A 4TJUA 5DCZA 3UDDA 4BU9A 4L0SA 1A26A 4F0EA 4BUEA 4PJVA 4PNNA 4L6SA 3UH2A 4OQAC 4UXBA 4W6EA 4K4EA 3L3MA 4LI6A 4TOSA 3W51A 2RF5A 4KZQA 4ZZZA 3U9HA 4J22A 4L0IA 4HLHA 4BU5A 4PNSA 3KR7A 5FPFA 4BJCA 4L31A 4J1ZA 4OA7A 4UVWA 4GV4A 5EBTA 4HHZA 4I9IA 4BUAA 4BUTA 4MSKA 4PNRA 4R5WA 4UI7A 4HL5A 5AKWA 2PAWA 2PAXA 3GN7A 3P0PA 4TKGA 4UW1A 3SE2A 4L0TA 1WOKA 3SMJA 5FPGA 4UVTA 4UVXA 4XHUA 1EFYA 3KR8A 4TK5A 4UUHA 5C5QA 4BU8A 4PMLA 4DQYC 3GJWA 3MHKA 4BU3A 4PNLA 5AL3A 4M7BA 4TKIA 4BUIA 4UI4A 5C5PA 4TJYA 4BUUA 2RD6A 4L7NA 4L2GA 4UFUA 4UVZA 5A00A 4W5SA 3P0NA 4BUSA 1UK1A 4L2KA 4UFYA 4TK0A 4BUFA 4UVVA 4UNDA 4AVWA 4PAXA 4HKKA 4ZZXA 4IUEA 4UVSA 4K4FA 3GOYA 4L2FA 1PAXA 4MSGA 4L7UA 4HMHA 4N3RA 3UA9A 4HLKA 3L3LA 4X52A 4BS4A 5ADSA 4J3MA 4N4VA 4UI6A 4J21A 4U6AA 4UI3A 4BU7A 4L7RA 4W5IA 1GS0A 5AL5A 5ADTA 4MT9A 4F1LA 4HKNA 4L34A 4UVLA 5ADQA 4UX4A 4HHYA 4BUDA
chains in the Genus database with same CATH superfamily
4TJWA 4L0VA 4R43A 5ECEA 4GMZA 1KHFA 4R6EA 1AQ2A 4HYFA 4BUYA 2PXZX 2RK7A 4WPUA 3MHJA 4ZZYA 4PJTA 4L7LA 4YW9A 4OX2A 4GMWA 1NHXA 3GEYA 5LXPA 3BLJA 5FH3A 5AKUA 2X5YA 4L7PA 5LX6A 2RCWA 4J3LA 3FHBA 4GV2A 4KZLA 4PNMA 4BJBA 4UVPA 4BUXA 2PQFA 4DVIA 5LYHA 4BFPA 4LI7A 4RV6A 4BUWA 5ADRA 3CE0A 4L09A 4GV0A 4PNTA 1YVYA 3KJDA 4OPXC 1YLHA 4L32A 4HKIA 4TORA 5AL2A 4WL8A 5FH1A 4L7OA 4KZUA 1II2A 1UK0A 3MOEA 4UVNA 5AEHA 2GMVA 4UVUA 4UVYA 1KHEA 3P0QA 4L0BA 4HLFA 2QZYA 3KCZA 4HLGA 3C49A 3SMIA 3U9YA 3UH4A 4BJ9A 3HKVA 4GMUA 4BU6A 4KRSA 4BUVA 4N4TA 4AVUA 4UHGA 2QF1A 4GV7A 4HLMA 4PNQA 4PY4A 5I67A 4UI8A 5C5RA 3C4HA 2QF2A 3PAXA 4L6ZA 4TVJA 4F1QA 4L33A 2OLRA 5FH2A 4UI5A 4L70A 4YWDA 4OQBC 2FAHA 4TKFA 4L10A 4UVOA 3DT4A 5AL1A 4LI8A 4TJUA 5DCZA 5AL4A 3UDDA 4L0SA 1A26A 2PY7X 4BU9A 4GNPA 4F0EA 4BUEA 4PJVA 4PNNA 4YWBA 4L6SA 3UH2A 4OQAC 4UXBA 4YW8A 2ZCIA 4K4EA 4W6EA 3L3MA 1OS1A 4LI6A 4TOSA 1KHGA 2RF5A 3W51A 4KZQA 4ZZZA 3U9HA 4J22A 4L0IA 4HLHA 4BU5A 4WPTA 4PNSA 3KR7A 5FPFA 4BJCA 4L31A 3DT2A 4J1ZA 4OA7A 4UVWA 4GV4A 5EBTA 4HHZA 1YTMA 4I9IA 4BUAA 4BUTA 4MSKA 4PNRA 4R5WA 4UI7A 4HL5A 5AKWA 2PAWA 1K3CA 2PAXA 3GN7A 3P0PA 4TKGA 4UW1A 4GMMA 4L0TA 1WOKA 3SE2A 3SMJA 1YGGA 3DTBA 1M51A 5FPGA 4UVTA 2RKEA 5ETYA 4UVXA 4XHUA 1EFYA 3KR8A 4TK5A 4GNQA 4GNLA 4UUHA 4WPVA 5FH0A 5C5QA 4BU8A 4PMLA 1OENA 4DQYC 4WOUA 3GJWA 2OLQA 2PC9A 1XKVA 2RKAA 3MHKA 4BU3A 4PNLA 5AL3A 2RKDA 4M7BA 4TKIA 2QEYA 4UI4A 4BUIA 5C5PA 4TJYA 4BUUA 2RD6A 4L7NA 4L2GA 4GNOA 4UFUA 5FH5A 4UVZA 5A00A 4W5SA 2FAFA 3P0NA 4BUSA 1UK1A 4L2KA 4UFYA 4TK0A 4BUFA 4UVVA 4UNDA 4AVWA 4PAXA 4HKKA 5FH4A 1KHBA 4ZZXA 4IUEA 4UVSA 4RCGA 4K4FA 3GOYA 4L2FA 1PAXA 4MSGA 4L7UA 3MOFA 4HMHA 4N3RA 3UA9A 4HLKA 3L3LA 4X52A 4BS4A 5ADSA 4J3MA 4N4VA 4UI6A 2QEWA 4J21A 3DT7A 4GNMA 4U6AA 4UI3A 4BU7A 1AYLA 4L7RA 4W5IA 4WIEA 1GS0A 5AL5A 5ADTA 4MT9A 1K3DA 4F1LA 3MOHA 2RK8A 4HKNA 4L34A 4UVLA 1J3BA 4UX4A 5ADQA 4WIUA 4HHYA 4BUDA
chains in the Genus database with same CATH topology
4TJWA 4L0VA 4R43A 5ECEA 4GMZA 1KHFA 4R6EA 1AQ2A 4HYFA 4BUYA 2PXZX 2RK7A 4WPUA 3MHJA 4ZZYA 4PJTA 4L7LA 4YW9A 4OX2A 4GMWA 1NHXA 3GEYA 5LXPA 3BLJA 5FH3A 5AKUA 2X5YA 4L7PA 5LX6A 2RCWA 4J3LA 3FHBA 4GV2A 4KZLA 4PNMA 4BJBA 4UVPA 4BUXA 2PQFA 4DVIA 5LYHA 4BFPA 4LI7A 4RV6A 4BUWA 5ADRA 3CE0A 4L09A 4GV0A 4PNTA 1YVYA 3KJDA 4OPXC 1YLHA 4L32A 4HKIA 4TORA 5AL2A 4WL8A 5FH1A 4L7OA 4KZUA 1II2A 1UK0A 3MOEA 4UVNA 5AEHA 2GMVA 4UVUA 4UVYA 1KHEA 3P0QA 4L0BA 4HLFA 2QZYA 3KCZA 4HLGA 3C49A 3SMIA 3U9YA 3UH4A 4BJ9A 3HKVA 4GMUA 4BU6A 4KRSA 4BUVA 4N4TA 4AVUA 4UHGA 2QF1A 4GV7A 4HLMA 4PNQA 4PY4A 5I67A 4UI8A 5C5RA 3C4HA 2QF2A 3PAXA 4L6ZA 4TVJA 4F1QA 4L33A 2OLRA 5FH2A 4UI5A 4L70A 4YWDA 4OQBC 2FAHA 4TKFA 4L10A 4UVOA 3DT4A 5AL1A 4LI8A 4TJUA 5DCZA 5AL4A 3UDDA 4L0SA 1A26A 2PY7X 4BU9A 4GNPA 4F0EA 4BUEA 4PJVA 4PNNA 4YWBA 4L6SA 3UH2A 4OQAC 4UXBA 4YW8A 2ZCIA 4K4EA 4W6EA 3L3MA 1OS1A 4LI6A 4TOSA 1KHGA 2RF5A 3W51A 4KZQA 4ZZZA 3U9HA 4J22A 4L0IA 4HLHA 4BU5A 4WPTA 4PNSA 3KR7A 5FPFA 4BJCA 4L31A 3DT2A 4J1ZA 4OA7A 4UVWA 4GV4A 5EBTA 4HHZA 1YTMA 4I9IA 4BUAA 4BUTA 4MSKA 4PNRA 4R5WA 4UI7A 4HL5A 5AKWA 2PAWA 1K3CA 2PAXA 3GN7A 3P0PA 4TKGA 4UW1A 4GMMA 4L0TA 1WOKA 3SE2A 3SMJA 1YGGA 3DTBA 1M51A 5FPGA 4UVTA 2RKEA 5ETYA 4UVXA 4XHUA 1EFYA 3KR8A 4TK5A 4GNQA 4GNLA 4UUHA 4WPVA 5FH0A 5C5QA 4BU8A 4PMLA 1OENA 4DQYC 4WOUA 3GJWA 2OLQA 2PC9A 1XKVA 2RKAA 3MHKA 4BU3A 4PNLA 5AL3A 2RKDA 4M7BA 4TKIA 2QEYA 4UI4A 4BUIA 5C5PA 4TJYA 4BUUA 2RD6A 4L7NA 4L2GA 4GNOA 4UFUA 5FH5A 4UVZA 5A00A 4W5SA 2FAFA 3P0NA 4BUSA 1UK1A 4L2KA 4UFYA 4TK0A 4BUFA 4UVVA 4UNDA 4AVWA 4PAXA 4HKKA 5FH4A 1KHBA 4ZZXA 4IUEA 4UVSA 4RCGA 4K4FA 3GOYA 4L2FA 1PAXA 4MSGA 4L7UA 3MOFA 4HMHA 4N3RA 3UA9A 4HLKA 3L3LA 4X52A 4BS4A 5ADSA 4J3MA 4N4VA 4UI6A 2QEWA 4J21A 3DT7A 4GNMA 4U6AA 4UI3A 4BU7A 1AYLA 4L7RA 4W5IA 4WIEA 1GS0A 5AL5A 5ADTA 4MT9A 1K3DA 4F1LA 3MOHA 2RK8A 4HKNA 4L34A 4UVLA 1J3BA 4UX4A 5ADQA 4WIUA 4HHYA 4BUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TJW A;  4L0V A;  5ECE A;  4R6E A;  4HYF A;  4BUY A;  3MHJ A;  4ZZY A;  4PJT A;  4L7L A;  3GEY A;  5LXP A;  3BLJ A;  5AKU A;  2X5Y A;  4L7P A;  5LX6 A;  2RCW A;  4J3L A;  3FHB A;  4GV2 A;  4KZL A;  4PNM A;  4BJB A;  4UVP A;  4BUX A;  2PQF A;  4DVI A;  5LYH A;  4BFP A;  4LI7 A;  4RV6 A;  4BUW A;  5ADR A;  3CE0 A;  4L09 A;  4GV0 A;  4PNT A;  3KJD A;  4OPX C;  4TOR A;  4L32 A;  4HKI A;  5AL2 A;  4L7O A;  4KZU A;  1UK0 A;  4UVN A;  5AEH A;  4UVU A;  4UVY A;  3P0Q A;  4L0B A;  4HLF A;  4HLG A;  3KCZ A;  3C49 A;  3SMI A;  3U9Y A;  3UH4 A;  4BJ9 A;  3HKV A;  4BU6 A;  4KRS A;  4BUV A;  4N4T A;  4AVU A;  4UHG A;  4GV7 A;  4HLM A;  4PNQ A;  4PY4 A;  4UI8 A;  5C5R A;  3C4H A;  4L6Z A;  3PAX A;  4TVJ A;  4F1Q A;  4L33 A;  4UI5 A;  4L70 A;  4OQB C;  5ETY A;  4TKF A;  4L10 A;  4UVO A;  5AL1 A;  5AL4 A;  4LI8 A;  4TJU A;  5DCZ A;  3UDD A;  4BU9 A;  4L0S A;  1A26 A;  4F0E A;  4BUE A;  4PJV A;  4PNN A;  4L6S A;  3UH2 A;  4OQA C;  4UXB A;  4W6E A;  4K4E A;  3L3M A;  4LI6 A;  4TOS A;  3W51 A;  2RF5 A;  4KZQ A;  4ZZZ A;  3U9H A;  4J22 A;  4L0I A;  4HLH A;  4BU5 A;  4PNS A;  3KR7 A;  5FPF A;  4BJC A;  4L31 A;  4J1Z A;  4OA7 A;  4UVW A;  4GV4 A;  5EBT A;  4HHZ A;  4I9I A;  4BUA A;  4BUT A;  4MSK A;  4PNR A;  4R5W A;  4UI7 A;  4HL5 A;  5AKW A;  2PAW A;  2PAX A;  3GN7 A;  3P0P A;  4TKG A;  4UW1 A;  3SE2 A;  4L0T A;  1WOK A;  3SMJ A;  5FPG A;  4UVT A;  4UVX A;  4XHU A;  1EFY A;  3KR8 A;  4TK5 A;  4UUH A;  5C5Q A;  4BU8 A;  4PML A;  4DQY C;  3GJW A;  3MHK A;  4BU3 A;  4PNL A;  5AL3 A;  4M7B A;  4TKI A;  4BUI A;  4UI4 A;  5C5P A;  4TJY A;  4BUU A;  2RD6 A;  4L7N A;  4L2G A;  4UFU A;  4UVZ A;  5A00 A;  4W5S A;  3P0N A;  4BUS A;  1UK1 A;  4L2K A;  4UFY A;  4TK0 A;  4BUF A;  4UVV A;  4UND A;  4AVW A;  4PAX A;  4HKK A;  4ZZX A;  4IUE A;  4UVS A;  4K4F A;  3GOY A;  4L2F A;  1PAX A;  4MSG A;  4L7U A;  4HMH A;  4N3R A;  3UA9 A;  4HLK A;  3L3L A;  4X52 A;  4BS4 A;  5ADS A;  4J3M A;  4N4V A;  4UI6 A;  4J21 A;  4U6A A;  4UI3 A;  4BU7 A;  4L7R A;  4W5I A;  1GS0 A;  5AL5 A;  5ADT A;  4MT9 A;  4F1L A;  4HKN A;  4L34 A;  4UVL A;  5ADQ A;  4UX4 A;  4HHY A;  4BUD A; 
#chains in the Genus database with same CATH topology
 4TJW A;  4L0V A;  4R43 A;  5ECE A;  4GMZ A;  1KHF A;  4R6E A;  1AQ2 A;  4HYF A;  4BUY A;  2PXZ X;  2RK7 A;  4WPU A;  3MHJ A;  4ZZY A;  4PJT A;  4L7L A;  4YW9 A;  4OX2 A;  4GMW A;  1NHX A;  3GEY A;  5LXP A;  3BLJ A;  5FH3 A;  5AKU A;  2X5Y A;  4L7P A;  5LX6 A;  2RCW A;  4J3L A;  3FHB A;  4GV2 A;  4KZL A;  4PNM A;  4BJB A;  4UVP A;  4BUX A;  2PQF A;  4DVI A;  5LYH A;  4BFP A;  4LI7 A;  4RV6 A;  4BUW A;  5ADR A;  3CE0 A;  4L09 A;  4GV0 A;  4PNT A;  1YVY A;  3KJD A;  4OPX C;  1YLH A;  4L32 A;  4HKI A;  4TOR A;  5AL2 A;  4WL8 A;  5FH1 A;  4L7O A;  4KZU A;  1II2 A;  1UK0 A;  3MOE A;  4UVN A;  5AEH A;  2GMV A;  4UVU A;  4UVY A;  1KHE A;  3P0Q A;  4L0B A;  4HLF A;  2QZY A;  3KCZ A;  4HLG A;  3C49 A;  3SMI A;  3U9Y A;  3UH4 A;  4BJ9 A;  3HKV A;  4GMU A;  4BU6 A;  4KRS A;  4BUV A;  4N4T A;  4AVU A;  4UHG A;  2QF1 A;  4GV7 A;  4HLM A;  4PNQ A;  4PY4 A;  5I67 A;  4UI8 A;  5C5R A;  3C4H A;  2QF2 A;  3PAX A;  4L6Z A;  4TVJ A;  4F1Q A;  4L33 A;  2OLR A;  5FH2 A;  4UI5 A;  4L70 A;  4YWD A;  4OQB C;  2FAH A;  4TKF A;  4L10 A;  4UVO A;  3DT4 A;  5AL1 A;  4LI8 A;  4TJU A;  5DCZ A;  5AL4 A;  3UDD A;  4L0S A;  1A26 A;  2PY7 X;  4BU9 A;  4GNP A;  4F0E A;  4BUE A;  4PJV A;  4PNN A;  4YWB A;  4L6S A;  3UH2 A;  4OQA C;  4UXB A;  4YW8 A;  2ZCI A;  4K4E A;  4W6E A;  3L3M A;  1OS1 A;  4LI6 A;  4TOS A;  1KHG A;  2RF5 A;  3W51 A;  4KZQ A;  4ZZZ A;  3U9H A;  4J22 A;  4L0I A;  4HLH A;  4BU5 A;  4WPT A;  4PNS A;  3KR7 A;  5FPF A;  4BJC A;  4L31 A;  3DT2 A;  4J1Z A;  4OA7 A;  4UVW A;  4GV4 A;  5EBT A;  4HHZ A;  1YTM A;  4I9I A;  4BUA A;  4BUT A;  4MSK A;  4PNR A;  4R5W A;  4UI7 A;  4HL5 A;  5AKW A;  2PAW A;  1K3C A;  2PAX A;  3GN7 A;  3P0P A;  4TKG A;  4UW1 A;  4GMM A;  4L0T A;  1WOK A;  3SE2 A;  3SMJ A;  1YGG A;  3DTB A;  1M51 A;  5FPG A;  4UVT A;  2RKE A;  5ETY A;  4UVX A;  4XHU A;  1EFY A;  3KR8 A;  4TK5 A;  4GNQ A;  4GNL A;  4UUH A;  4WPV A;  5FH0 A;  5C5Q A;  4BU8 A;  4PML A;  1OEN A;  4DQY C;  4WOU A;  3GJW A;  2OLQ A;  2PC9 A;  1XKV A;  2RKA A;  3MHK A;  4BU3 A;  4PNL A;  5AL3 A;  2RKD A;  4M7B A;  4TKI A;  2QEY A;  4UI4 A;  4BUI A;  5C5P A;  4TJY A;  4BUU A;  2RD6 A;  4L7N A;  4L2G A;  4GNO A;  4UFU A;  5FH5 A;  4UVZ A;  5A00 A;  4W5S A;  2FAF A;  3P0N A;  4BUS A;  1UK1 A;  4L2K A;  4UFY A;  4TK0 A;  4BUF A;  4UVV A;  4UND A;  4AVW A;  4PAX A;  4HKK A;  5FH4 A;  1KHB A;  4ZZX A;  4IUE A;  4UVS A;  4RCG A;  4K4F A;  3GOY A;  4L2F A;  1PAX A;  4MSG A;  4L7U A;  3MOF A;  4HMH A;  4N3R A;  3UA9 A;  4HLK A;  3L3L A;  4X52 A;  4BS4 A;  5ADS A;  4J3M A;  4N4V A;  4UI6 A;  2QEW A;  4J21 A;  3DT7 A;  4GNM A;  4U6A A;  4UI3 A;  4BU7 A;  1AYL A;  4L7R A;  4W5I A;  4WIE A;  1GS0 A;  5AL5 A;  5ADT A;  4MT9 A;  1K3D A;  4F1L A;  3MOH A;  2RK8 A;  4HKN A;  4L34 A;  4UVL A;  1J3B A;  4UX4 A;  5ADQ A;  4WIU A;  4HHY A;  4BUD A; 
#chains in the Genus database with same CATH homology
 4TJW A;  4L0V A;  4R43 A;  5ECE A;  4GMZ A;  1KHF A;  4R6E A;  1AQ2 A;  4HYF A;  4BUY A;  2PXZ X;  2RK7 A;  4WPU A;  3MHJ A;  4ZZY A;  4PJT A;  4L7L A;  4YW9 A;  4OX2 A;  4GMW A;  1NHX A;  3GEY A;  5LXP A;  3BLJ A;  5FH3 A;  5AKU A;  2X5Y A;  4L7P A;  5LX6 A;  2RCW A;  4J3L A;  3FHB A;  4GV2 A;  4KZL A;  4PNM A;  4BJB A;  4UVP A;  4BUX A;  2PQF A;  4DVI A;  5LYH A;  4BFP A;  4LI7 A;  4RV6 A;  4BUW A;  5ADR A;  3CE0 A;  4L09 A;  4GV0 A;  4PNT A;  1YVY A;  3KJD A;  4OPX C;  1YLH A;  4L32 A;  4HKI A;  4TOR A;  5AL2 A;  4WL8 A;  5FH1 A;  4L7O A;  4KZU A;  1II2 A;  1UK0 A;  3MOE A;  4UVN A;  5AEH A;  2GMV A;  4UVU A;  4UVY A;  1KHE A;  3P0Q A;  4L0B A;  4HLF A;  2QZY A;  3KCZ A;  4HLG A;  3C49 A;  3SMI A;  3U9Y A;  3UH4 A;  4BJ9 A;  3HKV A;  4GMU A;  4BU6 A;  4KRS A;  4BUV A;  4N4T A;  4AVU A;  4UHG A;  2QF1 A;  4GV7 A;  4HLM A;  4PNQ A;  4PY4 A;  5I67 A;  4UI8 A;  5C5R A;  3C4H A;  2QF2 A;  3PAX A;  4L6Z A;  4TVJ A;  4F1Q A;  4L33 A;  2OLR A;  5FH2 A;  4UI5 A;  4L70 A;  4YWD A;  4OQB C;  2FAH A;  4TKF A;  4L10 A;  4UVO A;  3DT4 A;  5AL1 A;  4LI8 A;  4TJU A;  5DCZ A;  5AL4 A;  3UDD A;  4L0S A;  1A26 A;  2PY7 X;  4BU9 A;  4GNP A;  4F0E A;  4BUE A;  4PJV A;  4PNN A;  4YWB A;  4L6S A;  3UH2 A;  4OQA C;  4UXB A;  4YW8 A;  2ZCI A;  4K4E A;  4W6E A;  3L3M A;  1OS1 A;  4LI6 A;  4TOS A;  1KHG A;  2RF5 A;  3W51 A;  4KZQ A;  4ZZZ A;  3U9H A;  4J22 A;  4L0I A;  4HLH A;  4BU5 A;  4WPT A;  4PNS A;  3KR7 A;  5FPF A;  4BJC A;  4L31 A;  3DT2 A;  4J1Z A;  4OA7 A;  4UVW A;  4GV4 A;  5EBT A;  4HHZ A;  1YTM A;  4I9I A;  4BUA A;  4BUT A;  4MSK A;  4PNR A;  4R5W A;  4UI7 A;  4HL5 A;  5AKW A;  2PAW A;  1K3C A;  2PAX A;  3GN7 A;  3P0P A;  4TKG A;  4UW1 A;  4GMM A;  4L0T A;  1WOK A;  3SE2 A;  3SMJ A;  1YGG A;  3DTB A;  1M51 A;  5FPG A;  4UVT A;  2RKE A;  5ETY A;  4UVX A;  4XHU A;  1EFY A;  3KR8 A;  4TK5 A;  4GNQ A;  4GNL A;  4UUH A;  4WPV A;  5FH0 A;  5C5Q A;  4BU8 A;  4PML A;  1OEN A;  4DQY C;  4WOU A;  3GJW A;  2OLQ A;  2PC9 A;  1XKV A;  2RKA A;  3MHK A;  4BU3 A;  4PNL A;  5AL3 A;  2RKD A;  4M7B A;  4TKI A;  2QEY A;  4UI4 A;  4BUI A;  5C5P A;  4TJY A;  4BUU A;  2RD6 A;  4L7N A;  4L2G A;  4GNO A;  4UFU A;  5FH5 A;  4UVZ A;  5A00 A;  4W5S A;  2FAF A;  3P0N A;  4BUS A;  1UK1 A;  4L2K A;  4UFY A;  4TK0 A;  4BUF A;  4UVV A;  4UND A;  4AVW A;  4PAX A;  4HKK A;  5FH4 A;  1KHB A;  4ZZX A;  4IUE A;  4UVS A;  4RCG A;  4K4F A;  3GOY A;  4L2F A;  1PAX A;  4MSG A;  4L7U A;  3MOF A;  4HMH A;  4N3R A;  3UA9 A;  4HLK A;  3L3L A;  4X52 A;  4BS4 A;  5ADS A;  4J3M A;  4N4V A;  4UI6 A;  2QEW A;  4J21 A;  3DT7 A;  4GNM A;  4U6A A;  4UI3 A;  4BU7 A;  1AYL A;  4L7R A;  4W5I A;  4WIE A;  1GS0 A;  5AL5 A;  5ADT A;  4MT9 A;  1K3D A;  4F1L A;  3MOH A;  2RK8 A;  4HKN A;  4L34 A;  4UVL A;  1J3B A;  4UX4 A;  5ADQ A;  4WIU A;  4HHY A;  4BUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...