4BUSA

Crystal structure of human tankyrase 2 in complex with 2-(4-(4-oxo-3, 4-dihydroquinazolin-2-yl)phenoxy)acetic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4busA00
4TORA 4UVTA 4L33A 5C5PA 4BUSA 4OPXC 4N4TA 1GS0A 5ETYA 4BUDA 3KR7A 4R5WA 4BUXA 4UFYA 4L0SA 4L32A 4L6ZA 4UUHA 4J1ZA 4MT9A 4F0EA 4TKFA 3P0PA 4PNRA 3C4HA 4PNTA 4BU7A 4PNLA 4RV6A 3KR8A 2PQFA 2PAWA 4L34A 4XHUA 4BU3A 5AL1A 5AKUA 4GV0A 3GOYA 4HMHA 4TJWA 4W5SA 4BJ9A 4U6AA 4HLGA 4HL5A 4L7NA 4N3RA 4W5IA 4PY4A 4LI8A 3P0NA 4GV2A 4N4VA 4ZZXA 4UI8A 5AKWA 5ADRA 3UDDA 4UVYA 4J3MA 3UH2A 4BUIA 4PAXA 4L0VA 5LX6A 4HHZA 4KRSA 3CE0A 4L2FA 4PMLA 4L7RA 4BUYA 5ADTA 3PAXA 4TJUA 4BUVA 4F1LA 2RD6A 4UHGA 4PNSA 4UW1A 4ZZYA 4GV7A 4TK0A 5LYHA 5ADSA 4UVLA 4L7OA 4M7BA 4BUUA 3L3LA 4TOSA 4UVVA 4PNQA 4UVOA 5FPGA 4TKIA 4L0IA 4UI4A 4UVSA 4X52A 1UK1A 4KZLA 3MHKA 4TK5A 4BUFA 4L2GA 4BJCA 4PNNA 4BJBA 3GEYA 5FPFA 4BUEA 4UVUA 4BUWA 4HLFA 4ZZZA 4HKIA 4HHYA 4AVUA 3UA9A 1UK0A 4MSGA 4BU6A 4OQBC 3MHJA 4HLMA 4UI3A 4UX4A 3UH4A 4L2KA 4HYFA 4BU8A 4L0TA 3GN7A 3P0QA 1WOKA 2PAXA 5AL4A 4HLHA 4BU9A 4BUTA 4K4FA 4PJVA 4UVXA 5C5RA 1A26A 4HKKA 5LXPA 4UVNA 4L10A 5ADQA 4L09A 3SMIA 5AL2A 5AEHA 4J3LA 4L31A 4UXBA 3FHBA 4UNDA 4F1QA 4L0BA 4TKGA 4UVWA 4AVWA 4KZQA 4LI6A 2X5YA 3L3MA 3U9YA 4OA7A 4PJTA 3SMJA 3KCZA 4L7UA 5C5QA 4BUAA 4PNMA 1PAXA 4DVIA 3GJWA 2RF5A 4I9IA 5AL5A 5DCZA 4UI5A 4UVZA 4HKNA 3KJDA 3W51A 4J21A 4IUEA 1EFYA 4BU5A 3SE2A 5EBTA 4OQAC 4UVPA 4DQYC 4L70A 3HKVA 4BS4A 4UI7A 4R6EA 4HLKA 4TJYA 4LI7A 5A00A 4MSKA 4W6EA 5AL3A 4UI6A 4TVJA 3U9HA 4GV4A 4K4EA 2RCWA 5ECEA 4L7PA 3C49A 4L7LA 4BFPA 4L6SA 4J22A 3BLJA 4KZUA 4UFUA
chains in the Genus database with same CATH superfamily
4TORA 4UVTA 4L33A 4WIUA 2OLQA 5C5PA 4BUSA 4OPXC 4N4TA 1GS0A 2QF1A 5ETYA 4BUDA 3KR7A 4R5WA 4BUXA 4UFYA 5FH4A 5FH2A 4L0SA 4L32A 4L6ZA 4UUHA 4J1ZA 4MT9A 4F0EA 4TKFA 1K3DA 3P0PA 3MOFA 2QZYA 3C4HA 4PNRA 4PNTA 4BU7A 4PNLA 1KHFA 4RV6A 3KR8A 2PQFA 2PAWA 4L34A 4WPTA 4XHUA 5AL1A 5AKUA 4BU3A 4GV0A 3GOYA 4HMHA 4TJWA 4W5SA 4BJ9A 1AQ2A 4U6AA 4HLGA 4HL5A 4L7NA 4N3RA 2ZCIA 4W5IA 4PY4A 4LI8A 3P0NA 4GV2A 4N4VA 4YWDA 4ZZXA 2OLRA 4UI8A 5AKWA 5ADRA 1K3CA 3UDDA 4UVYA 1II2A 4J3MA 3UH2A 2RKAA 4BUIA 4PAXA 4L0VA 5LX6A 4HHZA 4KRSA 3CE0A 4L2FA 1AYLA 4L7RA 4PMLA 4BUYA 5ADTA 3PAXA 4TJUA 4BUVA 4F1LA 2RD6A 4UHGA 4GMUA 4PNSA 4GNOA 4UW1A 1KHBA 3DT2A 2FAHA 4GV7A 4TK0A 4ZZYA 5ADSA 5LYHA 4UVLA 4L7OA 4M7BA 4BUUA 4YWBA 3L3LA 3MOEA 4TOSA 4UVVA 4PNQA 4UVOA 5FPGA 4TKIA 1OENA 4L0IA 1XKVA 4UI4A 4UVSA 4YW9A 4X52A 1UK1A 4KZLA 3MHKA 4TK5A 4BUFA 4L2GA 4BJCA 2PC9A 2RK8A 4PNNA 5FH3A 4BJBA 3GEYA 5FPFA 1YLHA 4UVUA 4WOUA 4BUEA 1YTMA 5FH5A 4BUWA 4HLFA 4ZZZA 4GNMA 4HKIA 4HHYA 4AVUA 3UA9A 1UK0A 4MSGA 4BU6A 4OQBC 3MHJA 4HLMA 4UI3A 4UX4A 2FAFA 3UH4A 4L2KA 4HYFA 4BU8A 4L0TA 3GN7A 3DT7A 3P0QA 4GMZA 1WOKA 2PAXA 5AL4A 4HLHA 4BU9A 4BUTA 4K4FA 4PJVA 4R43A 4UVXA 5C5RA 1A26A 3MOHA 4HKKA 4GNLA 5LXPA 4UVNA 4L10A 4WIEA 4L09A 5ADQA 1M51A 3SMIA 5AL2A 5FH0A 2RK7A 5AEHA 4J3LA 5I67A 4L31A 4UXBA 4WL8A 3FHBA 4GMWA 4UNDA 4F1QA 4L0BA 4WPUA 4TKGA 4UVWA 4AVWA 4KZQA 4LI6A 2PXZX 4WPVA 2X5YA 3L3MA 3U9YA 4OA7A 4PJTA 3SMJA 3KCZA 2GMVA 2QEYA 4OX2A 2RKEA 3DT4A 4L7UA 5C5QA 1YGGA 4PNMA 4BUAA 1PAXA 1KHGA 3GJWA 4DVIA 2QF2A 2RF5A 4I9IA 5AL5A 5DCZA 4RCGA 4UI5A 4UVZA 5FH1A 1NHXA 4HKNA 3KJDA 3W51A 4J21A 4IUEA 1EFYA 2RKDA 4BU5A 3SE2A 5EBTA 4YW8A 4OQAC 4GNQA 4UVPA 4DQYC 4L70A 3HKVA 4BS4A 4UI7A 4R6EA 4HLKA 3DTBA 2QEWA 4GMMA 4TJYA 4LI7A 5A00A 4MSKA 4W6EA 1YVYA 1J3BA 5AL3A 4UI6A 4TVJA 1KHEA 4GV4A 4K4EA 2PY7X 3U9HA 2RCWA 4GNPA 4L7PA 3C49A 4L7LA 5ECEA 4BFPA 4L6SA 4J22A 3BLJA 1OS1A 4KZUA 4UFUA
chains in the Genus database with same CATH topology
4TORA 4UVTA 4L33A 4WIUA 2OLQA 5C5PA 4BUSA 4OPXC 4N4TA 1GS0A 2QF1A 5ETYA 4BUDA 3KR7A 4R5WA 4BUXA 4UFYA 5FH4A 5FH2A 4L0SA 4L32A 4L6ZA 4UUHA 4J1ZA 4MT9A 4F0EA 4TKFA 1K3DA 3P0PA 3MOFA 2QZYA 3C4HA 4PNRA 4PNTA 4BU7A 4PNLA 1KHFA 4RV6A 3KR8A 2PQFA 2PAWA 4L34A 4WPTA 4XHUA 5AL1A 5AKUA 4BU3A 4GV0A 3GOYA 4HMHA 4TJWA 4W5SA 4BJ9A 1AQ2A 4U6AA 4HLGA 4HL5A 4L7NA 4N3RA 2ZCIA 4W5IA 4PY4A 4LI8A 3P0NA 4GV2A 4N4VA 4YWDA 4ZZXA 2OLRA 4UI8A 5AKWA 5ADRA 1K3CA 3UDDA 4UVYA 1II2A 4J3MA 3UH2A 2RKAA 4BUIA 4PAXA 4L0VA 5LX6A 4HHZA 4KRSA 3CE0A 4L2FA 1AYLA 4L7RA 4PMLA 4BUYA 5ADTA 3PAXA 4TJUA 4BUVA 4F1LA 2RD6A 4UHGA 4GMUA 4PNSA 4GNOA 4UW1A 1KHBA 3DT2A 2FAHA 4GV7A 4TK0A 4ZZYA 5ADSA 5LYHA 4UVLA 4L7OA 4M7BA 4BUUA 4YWBA 3L3LA 3MOEA 4TOSA 4UVVA 4PNQA 4UVOA 5FPGA 4TKIA 1OENA 4L0IA 1XKVA 4UI4A 4UVSA 4YW9A 4X52A 1UK1A 4KZLA 3MHKA 4TK5A 4BUFA 4L2GA 4BJCA 2PC9A 2RK8A 4PNNA 5FH3A 4BJBA 3GEYA 5FPFA 1YLHA 4UVUA 4WOUA 4BUEA 1YTMA 5FH5A 4BUWA 4HLFA 4ZZZA 4GNMA 4HKIA 4HHYA 4AVUA 3UA9A 1UK0A 4MSGA 4BU6A 4OQBC 3MHJA 4HLMA 4UI3A 4UX4A 2FAFA 3UH4A 4L2KA 4HYFA 4BU8A 4L0TA 3GN7A 3DT7A 3P0QA 4GMZA 1WOKA 2PAXA 5AL4A 4HLHA 4BU9A 4BUTA 4K4FA 4PJVA 4R43A 4UVXA 5C5RA 1A26A 3MOHA 4HKKA 4GNLA 5LXPA 4UVNA 4L10A 4WIEA 4L09A 5ADQA 1M51A 3SMIA 5AL2A 5FH0A 2RK7A 5AEHA 4J3LA 5I67A 4L31A 4UXBA 4WL8A 3FHBA 4GMWA 4UNDA 4F1QA 4L0BA 4WPUA 4TKGA 4UVWA 4AVWA 4KZQA 4LI6A 2PXZX 4WPVA 2X5YA 3L3MA 3U9YA 4OA7A 4PJTA 3SMJA 3KCZA 2GMVA 2QEYA 4OX2A 2RKEA 3DT4A 4L7UA 5C5QA 1YGGA 4PNMA 4BUAA 1PAXA 1KHGA 3GJWA 4DVIA 2QF2A 2RF5A 4I9IA 5AL5A 5DCZA 4RCGA 4UI5A 4UVZA 5FH1A 1NHXA 4HKNA 3KJDA 3W51A 4J21A 4IUEA 1EFYA 2RKDA 4BU5A 3SE2A 5EBTA 4YW8A 4OQAC 4GNQA 4UVPA 4DQYC 4L70A 3HKVA 4BS4A 4UI7A 4R6EA 4HLKA 3DTBA 2QEWA 4GMMA 4TJYA 4LI7A 5A00A 4MSKA 4W6EA 1YVYA 1J3BA 5AL3A 4UI6A 4TVJA 1KHEA 4GV4A 4K4EA 2PY7X 3U9HA 2RCWA 4GNPA 4L7PA 3C49A 4L7LA 5ECEA 4BFPA 4L6SA 4J22A 3BLJA 1OS1A 4KZUA 4UFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TOR A;  4UVT A;  4L33 A;  5C5P A;  4BUS A;  4OPX C;  4N4T A;  1GS0 A;  5ETY A;  4BUD A;  3KR7 A;  4R5W A;  4BUX A;  4UFY A;  4L0S A;  4L32 A;  4L6Z A;  4UUH A;  4J1Z A;  4MT9 A;  4F0E A;  4TKF A;  3P0P A;  4PNR A;  3C4H A;  4PNT A;  4BU7 A;  4PNL A;  4RV6 A;  3KR8 A;  2PQF A;  2PAW A;  4L34 A;  4XHU A;  4BU3 A;  5AL1 A;  5AKU A;  4GV0 A;  3GOY A;  4HMH A;  4TJW A;  4W5S A;  4BJ9 A;  4U6A A;  4HLG A;  4HL5 A;  4L7N A;  4N3R A;  4W5I A;  4PY4 A;  4LI8 A;  3P0N A;  4GV2 A;  4N4V A;  4ZZX A;  4UI8 A;  5AKW A;  5ADR A;  3UDD A;  4UVY A;  4J3M A;  3UH2 A;  4BUI A;  4PAX A;  4L0V A;  5LX6 A;  4HHZ A;  4KRS A;  3CE0 A;  4L2F A;  4PML A;  4L7R A;  4BUY A;  5ADT A;  3PAX A;  4TJU A;  4BUV A;  4F1L A;  2RD6 A;  4UHG A;  4PNS A;  4UW1 A;  4ZZY A;  4GV7 A;  4TK0 A;  5LYH A;  5ADS A;  4UVL A;  4L7O A;  4M7B A;  4BUU A;  3L3L A;  4TOS A;  4UVV A;  4PNQ A;  4UVO A;  5FPG A;  4TKI A;  4L0I A;  4UI4 A;  4UVS A;  4X52 A;  1UK1 A;  4KZL A;  3MHK A;  4TK5 A;  4BUF A;  4L2G A;  4BJC A;  4PNN A;  4BJB A;  3GEY A;  5FPF A;  4BUE A;  4UVU A;  4BUW A;  4HLF A;  4ZZZ A;  4HKI A;  4HHY A;  4AVU A;  3UA9 A;  1UK0 A;  4MSG A;  4BU6 A;  4OQB C;  3MHJ A;  4HLM A;  4UI3 A;  4UX4 A;  3UH4 A;  4L2K A;  4HYF A;  4BU8 A;  4L0T A;  3GN7 A;  3P0Q A;  1WOK A;  2PAX A;  5AL4 A;  4HLH A;  4BU9 A;  4BUT A;  4K4F A;  4PJV A;  4UVX A;  5C5R A;  1A26 A;  4HKK A;  5LXP A;  4UVN A;  4L10 A;  5ADQ A;  4L09 A;  3SMI A;  5AL2 A;  5AEH A;  4J3L A;  4L31 A;  4UXB A;  3FHB A;  4UND A;  4F1Q A;  4L0B A;  4TKG A;  4UVW A;  4AVW A;  4KZQ A;  4LI6 A;  2X5Y A;  3L3M A;  3U9Y A;  4OA7 A;  4PJT A;  3SMJ A;  3KCZ A;  4L7U A;  5C5Q A;  4BUA A;  4PNM A;  1PAX A;  4DVI A;  3GJW A;  2RF5 A;  4I9I A;  5AL5 A;  5DCZ A;  4UI5 A;  4UVZ A;  4HKN A;  3KJD A;  3W51 A;  4J21 A;  4IUE A;  1EFY A;  4BU5 A;  3SE2 A;  5EBT A;  4OQA C;  4UVP A;  4DQY C;  4L70 A;  3HKV A;  4BS4 A;  4UI7 A;  4R6E A;  4HLK A;  4TJY A;  4LI7 A;  5A00 A;  4MSK A;  4W6E A;  5AL3 A;  4UI6 A;  4TVJ A;  3U9H A;  4GV4 A;  4K4E A;  2RCW A;  5ECE A;  4L7P A;  3C49 A;  4L7L A;  4BFP A;  4L6S A;  4J22 A;  3BLJ A;  4KZU A;  4UFU A; 
#chains in the Genus database with same CATH topology
 4TOR A;  4UVT A;  4L33 A;  4WIU A;  2OLQ A;  5C5P A;  4BUS A;  4OPX C;  4N4T A;  1GS0 A;  2QF1 A;  5ETY A;  4BUD A;  3KR7 A;  4R5W A;  4BUX A;  4UFY A;  5FH4 A;  5FH2 A;  4L0S A;  4L32 A;  4L6Z A;  4UUH A;  4J1Z A;  4MT9 A;  4F0E A;  4TKF A;  1K3D A;  3P0P A;  3MOF A;  2QZY A;  3C4H A;  4PNR A;  4PNT A;  4BU7 A;  4PNL A;  1KHF A;  4RV6 A;  3KR8 A;  2PQF A;  2PAW A;  4L34 A;  4WPT A;  4XHU A;  5AL1 A;  5AKU A;  4BU3 A;  4GV0 A;  3GOY A;  4HMH A;  4TJW A;  4W5S A;  4BJ9 A;  1AQ2 A;  4U6A A;  4HLG A;  4HL5 A;  4L7N A;  4N3R A;  2ZCI A;  4W5I A;  4PY4 A;  4LI8 A;  3P0N A;  4GV2 A;  4N4V A;  4YWD A;  4ZZX A;  2OLR A;  4UI8 A;  5AKW A;  5ADR A;  1K3C A;  3UDD A;  4UVY A;  1II2 A;  4J3M A;  3UH2 A;  2RKA A;  4BUI A;  4PAX A;  4L0V A;  5LX6 A;  4HHZ A;  4KRS A;  3CE0 A;  4L2F A;  1AYL A;  4L7R A;  4PML A;  4BUY A;  5ADT A;  3PAX A;  4TJU A;  4BUV A;  4F1L A;  2RD6 A;  4UHG A;  4GMU A;  4PNS A;  4GNO A;  4UW1 A;  1KHB A;  3DT2 A;  2FAH A;  4GV7 A;  4TK0 A;  4ZZY A;  5ADS A;  5LYH A;  4UVL A;  4L7O A;  4M7B A;  4BUU A;  4YWB A;  3L3L A;  3MOE A;  4TOS A;  4UVV A;  4PNQ A;  4UVO A;  5FPG A;  4TKI A;  1OEN A;  4L0I A;  1XKV A;  4UI4 A;  4UVS A;  4YW9 A;  4X52 A;  1UK1 A;  4KZL A;  3MHK A;  4TK5 A;  4BUF A;  4L2G A;  4BJC A;  2PC9 A;  2RK8 A;  4PNN A;  5FH3 A;  4BJB A;  3GEY A;  5FPF A;  1YLH A;  4UVU A;  4WOU A;  4BUE A;  1YTM A;  5FH5 A;  4BUW A;  4HLF A;  4ZZZ A;  4GNM A;  4HKI A;  4HHY A;  4AVU A;  3UA9 A;  1UK0 A;  4MSG A;  4BU6 A;  4OQB C;  3MHJ A;  4HLM A;  4UI3 A;  4UX4 A;  2FAF A;  3UH4 A;  4L2K A;  4HYF A;  4BU8 A;  4L0T A;  3GN7 A;  3DT7 A;  3P0Q A;  4GMZ A;  1WOK A;  2PAX A;  5AL4 A;  4HLH A;  4BU9 A;  4BUT A;  4K4F A;  4PJV A;  4R43 A;  4UVX A;  5C5R A;  1A26 A;  3MOH A;  4HKK A;  4GNL A;  5LXP A;  4UVN A;  4L10 A;  4WIE A;  4L09 A;  5ADQ A;  1M51 A;  3SMI A;  5AL2 A;  5FH0 A;  2RK7 A;  5AEH A;  4J3L A;  5I67 A;  4L31 A;  4UXB A;  4WL8 A;  3FHB A;  4GMW A;  4UND A;  4F1Q A;  4L0B A;  4WPU A;  4TKG A;  4UVW A;  4AVW A;  4KZQ A;  4LI6 A;  2PXZ X;  4WPV A;  2X5Y A;  3L3M A;  3U9Y A;  4OA7 A;  4PJT A;  3SMJ A;  3KCZ A;  2GMV A;  2QEY A;  4OX2 A;  2RKE A;  3DT4 A;  4L7U A;  5C5Q A;  1YGG A;  4PNM A;  4BUA A;  1PAX A;  1KHG A;  3GJW A;  4DVI A;  2QF2 A;  2RF5 A;  4I9I A;  5AL5 A;  5DCZ A;  4RCG A;  4UI5 A;  4UVZ A;  5FH1 A;  1NHX A;  4HKN A;  3KJD A;  3W51 A;  4J21 A;  4IUE A;  1EFY A;  2RKD A;  4BU5 A;  3SE2 A;  5EBT A;  4YW8 A;  4OQA C;  4GNQ A;  4UVP A;  4DQY C;  4L70 A;  3HKV A;  4BS4 A;  4UI7 A;  4R6E A;  4HLK A;  3DTB A;  2QEW A;  4GMM A;  4TJY A;  4LI7 A;  5A00 A;  4MSK A;  4W6E A;  1YVY A;  1J3B A;  5AL3 A;  4UI6 A;  4TVJ A;  1KHE A;  4GV4 A;  4K4E A;  2PY7 X;  3U9H A;  2RCW A;  4GNP A;  4L7P A;  3C49 A;  4L7L A;  5ECE A;  4BFP A;  4L6S A;  4J22 A;  3BLJ A;  1OS1 A;  4KZU A;  4UFU A; 
#chains in the Genus database with same CATH homology
 4TOR A;  4UVT A;  4L33 A;  4WIU A;  2OLQ A;  5C5P A;  4BUS A;  4OPX C;  4N4T A;  1GS0 A;  2QF1 A;  5ETY A;  4BUD A;  3KR7 A;  4R5W A;  4BUX A;  4UFY A;  5FH4 A;  5FH2 A;  4L0S A;  4L32 A;  4L6Z A;  4UUH A;  4J1Z A;  4MT9 A;  4F0E A;  4TKF A;  1K3D A;  3P0P A;  3MOF A;  2QZY A;  3C4H A;  4PNR A;  4PNT A;  4BU7 A;  4PNL A;  1KHF A;  4RV6 A;  3KR8 A;  2PQF A;  2PAW A;  4L34 A;  4WPT A;  4XHU A;  5AL1 A;  5AKU A;  4BU3 A;  4GV0 A;  3GOY A;  4HMH A;  4TJW A;  4W5S A;  4BJ9 A;  1AQ2 A;  4U6A A;  4HLG A;  4HL5 A;  4L7N A;  4N3R A;  2ZCI A;  4W5I A;  4PY4 A;  4LI8 A;  3P0N A;  4GV2 A;  4N4V A;  4YWD A;  4ZZX A;  2OLR A;  4UI8 A;  5AKW A;  5ADR A;  1K3C A;  3UDD A;  4UVY A;  1II2 A;  4J3M A;  3UH2 A;  2RKA A;  4BUI A;  4PAX A;  4L0V A;  5LX6 A;  4HHZ A;  4KRS A;  3CE0 A;  4L2F A;  1AYL A;  4L7R A;  4PML A;  4BUY A;  5ADT A;  3PAX A;  4TJU A;  4BUV A;  4F1L A;  2RD6 A;  4UHG A;  4GMU A;  4PNS A;  4GNO A;  4UW1 A;  1KHB A;  3DT2 A;  2FAH A;  4GV7 A;  4TK0 A;  4ZZY A;  5ADS A;  5LYH A;  4UVL A;  4L7O A;  4M7B A;  4BUU A;  4YWB A;  3L3L A;  3MOE A;  4TOS A;  4UVV A;  4PNQ A;  4UVO A;  5FPG A;  4TKI A;  1OEN A;  4L0I A;  1XKV A;  4UI4 A;  4UVS A;  4YW9 A;  4X52 A;  1UK1 A;  4KZL A;  3MHK A;  4TK5 A;  4BUF A;  4L2G A;  4BJC A;  2PC9 A;  2RK8 A;  4PNN A;  5FH3 A;  4BJB A;  3GEY A;  5FPF A;  1YLH A;  4UVU A;  4WOU A;  4BUE A;  1YTM A;  5FH5 A;  4BUW A;  4HLF A;  4ZZZ A;  4GNM A;  4HKI A;  4HHY A;  4AVU A;  3UA9 A;  1UK0 A;  4MSG A;  4BU6 A;  4OQB C;  3MHJ A;  4HLM A;  4UI3 A;  4UX4 A;  2FAF A;  3UH4 A;  4L2K A;  4HYF A;  4BU8 A;  4L0T A;  3GN7 A;  3DT7 A;  3P0Q A;  4GMZ A;  1WOK A;  2PAX A;  5AL4 A;  4HLH A;  4BU9 A;  4BUT A;  4K4F A;  4PJV A;  4R43 A;  4UVX A;  5C5R A;  1A26 A;  3MOH A;  4HKK A;  4GNL A;  5LXP A;  4UVN A;  4L10 A;  4WIE A;  4L09 A;  5ADQ A;  1M51 A;  3SMI A;  5AL2 A;  5FH0 A;  2RK7 A;  5AEH A;  4J3L A;  5I67 A;  4L31 A;  4UXB A;  4WL8 A;  3FHB A;  4GMW A;  4UND A;  4F1Q A;  4L0B A;  4WPU A;  4TKG A;  4UVW A;  4AVW A;  4KZQ A;  4LI6 A;  2PXZ X;  4WPV A;  2X5Y A;  3L3M A;  3U9Y A;  4OA7 A;  4PJT A;  3SMJ A;  3KCZ A;  2GMV A;  2QEY A;  4OX2 A;  2RKE A;  3DT4 A;  4L7U A;  5C5Q A;  1YGG A;  4PNM A;  4BUA A;  1PAX A;  1KHG A;  3GJW A;  4DVI A;  2QF2 A;  2RF5 A;  4I9I A;  5AL5 A;  5DCZ A;  4RCG A;  4UI5 A;  4UVZ A;  5FH1 A;  1NHX A;  4HKN A;  3KJD A;  3W51 A;  4J21 A;  4IUE A;  1EFY A;  2RKD A;  4BU5 A;  3SE2 A;  5EBT A;  4YW8 A;  4OQA C;  4GNQ A;  4UVP A;  4DQY C;  4L70 A;  3HKV A;  4BS4 A;  4UI7 A;  4R6E A;  4HLK A;  3DTB A;  2QEW A;  4GMM A;  4TJY A;  4LI7 A;  5A00 A;  4MSK A;  4W6E A;  1YVY A;  1J3B A;  5AL3 A;  4UI6 A;  4TVJ A;  1KHE A;  4GV4 A;  4K4E A;  2PY7 X;  3U9H A;  2RCW A;  4GNP A;  4L7P A;  3C49 A;  4L7L A;  5ECE A;  4BFP A;  4L6S A;  4J22 A;  3BLJ A;  1OS1 A;  4KZU A;  4UFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...