4BUTA

Crystal structure of human tankyrase 2 in complex with 4-(4-oxo-3,4- dihydroquinazolin-2-yl)benzene-1-sulfonamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4butA00
4L6ZA 5LX6A 3GEYA 3UH4A 1GS0A 4J3LA 4UNDA 4BUIA 4L0SA 4DVIA 4F1QA 3U9YA 4KZUA 3BLJA 4PNTA 4GV2A 4HYFA 4UXBA 4TK0A 4M7BA 4W6EA 4PNLA 4L7RA 4BUSA 3UH2A 4UI3A 4BUEA 3SMJA 3GOYA 4HKNA 3KR8A 5AEHA 4BU9A 4OPXC 4BUVA 4HLFA 4HMHA 4BU5A 5FPGA 4K4EA 4HLGA 4UVUA 5C5PA 4K4FA 4L7OA 4HHZA 4UUHA 4GV0A 3CE0A 4U6AA 5ETYA 4L0TA 4HHYA 4IUEA 4L70A 3C49A 4L32A 4PJTA 4PNRA 4UVOA 4BUFA 4J22A 3U9HA 4L09A 4BJBA 2PAXA 4L2KA 4OA7A 4PJVA 4MSGA 4L7PA 3PAXA 4L7NA 4PNSA 3HKVA 5ADSA 4LI8A 4TKFA 4R5WA 4TKGA 4BJ9A 4KZQA 4UVYA 4KZLA 4UI4A 4BUXA 4UI7A 4XHUA 4AVWA 5DCZA 2RF5A 3W51A 4KRSA 5FPFA 5AL1A 3SE2A 4UI6A 4N4TA 4UVVA 4UI5A 5LXPA 3GJWA 4UVXA 5C5RA 4I9IA 3L3LA 4L2GA 4N4VA 2X5YA 1EFYA 2RD6A 2PQFA 3GN7A 4TJWA 4DQYC 4L0IA 4UVSA 3C4HA 2RCWA 4R6EA 4HLMA 4UVNA 4L7UA 3UDDA 3UA9A 4BFPA 4L0VA 3FHBA 1A26A 5LYHA 2PAWA 4MT9A 4W5IA 4UVTA 4TJUA 4HL5A 1UK0A 4UVWA 4RV6A 5C5QA 4BS4A 5ADTA 1WOKA 4TOSA 4J1ZA 4GV7A 4LI6A 4MSKA 4PNQA 4UFUA 4TKIA 4PAXA 4UVPA 4OQBC 4PY4A 4BJCA 4ZZZA 3MHJA 5ADRA 4HLHA 4L6SA 3SMIA 5AKWA 4UFYA 4BUWA 4TK5A 4BU6A 4F1LA 5ECEA 4UX4A 1UK1A 4GV4A 4BUUA 3KCZA 4ZZXA 4BUDA 4HKKA 4UVZA 4BU8A 4UHGA 4UW1A 5AKUA 4AVUA 4PNNA 4BUTA 5ADQA 3P0PA 4TVJA 4UI8A 4UVLA 4BUAA 4X52A 4L10A 5A00A 3KR7A 4BU7A 5AL4A 5AL2A 4F0EA 4J21A 5EBTA 4L0BA 3P0NA 4HLKA 4HKIA 4PMLA 5AL3A 3KJDA 3L3MA 3MHKA 5AL5A 4PNMA 4L34A 4N3RA 1PAXA 4L31A 4TJYA 4J3MA 4W5SA 4L33A 4LI7A 4ZZYA 3P0QA 4L7LA 4TORA 4BU3A 4OQAC 4BUYA 4L2FA
chains in the Genus database with same CATH superfamily
4L6ZA 1XKVA 1NHXA 5LX6A 3GEYA 2FAHA 3UH4A 1GS0A 4J3LA 4UNDA 4BUIA 4L0SA 4DVIA 4F1QA 3U9YA 4KZUA 1II2A 3BLJA 4PNTA 4GV2A 5FH3A 5I67A 4HYFA 4UXBA 4TK0A 4M7BA 4W6EA 4PNLA 4YWBA 4L7RA 4GNQA 4YWDA 3UH2A 4UI3A 4BUEA 4BUSA 4WOUA 3SMJA 3GOYA 4HKNA 3KR8A 5AEHA 2RKEA 1AQ2A 4BU9A 4OPXC 2RK7A 4BUVA 4HLFA 4HMHA 4BU5A 1YTMA 4K4EA 5FPGA 4HLGA 4UVUA 5C5PA 3MOEA 4YW8A 5FH1A 1KHEA 4K4FA 4GNLA 4GNPA 4L7OA 4HHZA 4UUHA 2RKDA 4GV0A 2PY7X 3CE0A 4U6AA 4WIEA 5ETYA 4HHYA 4L0TA 4IUEA 3DTBA 1YLHA 4L70A 2PC9A 4R43A 3C49A 4L32A 4GNMA 4PJTA 4PNRA 1YVYA 4UVOA 4BUFA 4J22A 3U9HA 4L09A 4BJBA 2FAFA 3UDDA 2PAXA 4L2KA 4OA7A 4PJVA 4MSGA 2PXZX 4L7PA 3PAXA 4L7NA 4PNSA 3HKVA 5ADSA 4LI8A 4TKFA 5FH2A 4R5WA 4TKGA 4BJ9A 4KZQA 4UVYA 4KZLA 4OX2A 4UI4A 4GNOA 4UI7A 4BUXA 4XHUA 4GMUA 1AYLA 4AVWA 5DCZA 2RF5A 3W51A 4KRSA 5FPFA 5AL1A 3SE2A 2QEWA 4UI6A 4N4TA 2ZCIA 4UI5A 4UVVA 5FH0A 5LXPA 3GJWA 4UVXA 5C5RA 4GMWA 3L3LA 4I9IA 4L2GA 4N4VA 1EFYA 2X5YA 2GMVA 2RD6A 2PQFA 3GN7A 4TJWA 1OENA 2QEYA 4GMZA 4DQYC 4L0IA 4UVSA 1J3BA 1KHFA 2QZYA 2RCWA 3C4HA 4HLMA 4L7UA 4R6EA 4UVNA 4L0VA 4WL8A 4YW9A 4BFPA 3FHBA 1A26A 5LYHA 2PAWA 4MT9A 4W5IA 4UVTA 4TJUA 4HL5A 1UK0A 4UVWA 5FH4A 4RV6A 5C5QA 4BS4A 5ADTA 1WOKA 4TOSA 3DT2A 4J1ZA 4GV7A 4LI6A 4MSKA 4PNQA 4UFUA 4TKIA 4PAXA 4UVPA 4OQBC 4PY4A 4BJCA 4ZZZA 3MHJA 5ADRA 2QF1A 1K3DA 3MOHA 4HLHA 4L6SA 5AKWA 4UFYA 3SMIA 4BUWA 4TK5A 4BU6A 4F1LA 3UA9A 5ECEA 4UX4A 1UK1A 4GV4A 4BUUA 3KCZA 4ZZXA 2OLQA 4BUDA 2RK8A 4HKKA 4UVZA 4BU8A 4UHGA 4UW1A 5AKUA 4AVUA 4PNNA 4BUTA 5ADQA 2QF2A 3P0PA 4TVJA 4UI8A 4UVLA 4BUAA 4X52A 4L10A 5A00A 3KR7A 4BU7A 5AL4A 5AL2A 2OLRA 3MOFA 4F0EA 1K3CA 4J21A 5EBTA 4RCGA 4L0BA 4WPVA 3DT7A 3P0NA 4WPUA 4HLKA 4HKIA 4WPTA 4PMLA 4WIUA 5AL3A 3KJDA 3L3MA 3MHKA 5AL5A 4PNMA 4L34A 1OS1A 1PAXA 4N3RA 4L31A 4TJYA 4J3MA 2RKAA 1M51A 4GMMA 4L33A 4LI7A 4W5SA 4ZZYA 1KHGA 3P0QA 5FH5A 4L7LA 4TORA 4BU3A 4OQAC 3DT4A 1YGGA 1KHBA 4BUYA 4L2FA
chains in the Genus database with same CATH topology
4L6ZA 1XKVA 1NHXA 5LX6A 3GEYA 2FAHA 3UH4A 1GS0A 4J3LA 4UNDA 4BUIA 4L0SA 4DVIA 4F1QA 3U9YA 4KZUA 1II2A 3BLJA 4PNTA 4GV2A 5FH3A 5I67A 4HYFA 4UXBA 4TK0A 4M7BA 4W6EA 4PNLA 4YWBA 4L7RA 4GNQA 4YWDA 3UH2A 4UI3A 4BUEA 4BUSA 4WOUA 3SMJA 3GOYA 4HKNA 3KR8A 5AEHA 2RKEA 1AQ2A 4BU9A 4OPXC 2RK7A 4BUVA 4HLFA 4HMHA 4BU5A 1YTMA 4K4EA 5FPGA 4HLGA 4UVUA 5C5PA 3MOEA 4YW8A 5FH1A 1KHEA 4K4FA 4GNLA 4GNPA 4L7OA 4HHZA 4UUHA 2RKDA 4GV0A 2PY7X 3CE0A 4U6AA 4WIEA 5ETYA 4HHYA 4L0TA 4IUEA 3DTBA 1YLHA 4L70A 2PC9A 4R43A 3C49A 4L32A 4GNMA 4PJTA 4PNRA 1YVYA 4UVOA 4BUFA 4J22A 3U9HA 4L09A 4BJBA 2FAFA 3UDDA 2PAXA 4L2KA 4OA7A 4PJVA 4MSGA 2PXZX 4L7PA 3PAXA 4L7NA 4PNSA 3HKVA 5ADSA 4LI8A 4TKFA 5FH2A 4R5WA 4TKGA 4BJ9A 4KZQA 4UVYA 4KZLA 4OX2A 4UI4A 4GNOA 4UI7A 4BUXA 4XHUA 4GMUA 1AYLA 4AVWA 5DCZA 2RF5A 3W51A 4KRSA 5FPFA 5AL1A 3SE2A 2QEWA 4UI6A 4N4TA 2ZCIA 4UI5A 4UVVA 5FH0A 5LXPA 3GJWA 4UVXA 5C5RA 4GMWA 3L3LA 4I9IA 4L2GA 4N4VA 1EFYA 2X5YA 2GMVA 2RD6A 2PQFA 3GN7A 4TJWA 1OENA 2QEYA 4GMZA 4DQYC 4L0IA 4UVSA 1J3BA 1KHFA 2QZYA 2RCWA 3C4HA 4HLMA 4L7UA 4R6EA 4UVNA 4L0VA 4WL8A 4YW9A 4BFPA 3FHBA 1A26A 5LYHA 2PAWA 4MT9A 4W5IA 4UVTA 4TJUA 4HL5A 1UK0A 4UVWA 5FH4A 4RV6A 5C5QA 4BS4A 5ADTA 1WOKA 4TOSA 3DT2A 4J1ZA 4GV7A 4LI6A 4MSKA 4PNQA 4UFUA 4TKIA 4PAXA 4UVPA 4OQBC 4PY4A 4BJCA 4ZZZA 3MHJA 5ADRA 2QF1A 1K3DA 3MOHA 4HLHA 4L6SA 5AKWA 4UFYA 3SMIA 4BUWA 4TK5A 4BU6A 4F1LA 3UA9A 5ECEA 4UX4A 1UK1A 4GV4A 4BUUA 3KCZA 4ZZXA 2OLQA 4BUDA 2RK8A 4HKKA 4UVZA 4BU8A 4UHGA 4UW1A 5AKUA 4AVUA 4PNNA 4BUTA 5ADQA 2QF2A 3P0PA 4TVJA 4UI8A 4UVLA 4BUAA 4X52A 4L10A 5A00A 3KR7A 4BU7A 5AL4A 5AL2A 2OLRA 3MOFA 4F0EA 1K3CA 4J21A 5EBTA 4RCGA 4L0BA 4WPVA 3DT7A 3P0NA 4WPUA 4HLKA 4HKIA 4WPTA 4PMLA 4WIUA 5AL3A 3KJDA 3L3MA 3MHKA 5AL5A 4PNMA 4L34A 1OS1A 1PAXA 4N3RA 4L31A 4TJYA 4J3MA 2RKAA 1M51A 4GMMA 4L33A 4LI7A 4W5SA 4ZZYA 1KHGA 3P0QA 5FH5A 4L7LA 4TORA 4BU3A 4OQAC 3DT4A 1YGGA 1KHBA 4BUYA 4L2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6Z A;  5LX6 A;  3GEY A;  3UH4 A;  1GS0 A;  4J3L A;  4UND A;  4BUI A;  4L0S A;  4DVI A;  4F1Q A;  3U9Y A;  4KZU A;  3BLJ A;  4PNT A;  4GV2 A;  4HYF A;  4UXB A;  4TK0 A;  4M7B A;  4W6E A;  4PNL A;  4L7R A;  4BUS A;  3UH2 A;  4UI3 A;  4BUE A;  3SMJ A;  3GOY A;  4HKN A;  3KR8 A;  5AEH A;  4BU9 A;  4OPX C;  4BUV A;  4HLF A;  4HMH A;  4BU5 A;  5FPG A;  4K4E A;  4HLG A;  4UVU A;  5C5P A;  4K4F A;  4L7O A;  4HHZ A;  4UUH A;  4GV0 A;  3CE0 A;  4U6A A;  5ETY A;  4L0T A;  4HHY A;  4IUE A;  4L70 A;  3C49 A;  4L32 A;  4PJT A;  4PNR A;  4UVO A;  4BUF A;  4J22 A;  3U9H A;  4L09 A;  4BJB A;  2PAX A;  4L2K A;  4OA7 A;  4PJV A;  4MSG A;  4L7P A;  3PAX A;  4L7N A;  4PNS A;  3HKV A;  5ADS A;  4LI8 A;  4TKF A;  4R5W A;  4TKG A;  4BJ9 A;  4KZQ A;  4UVY A;  4KZL A;  4UI4 A;  4BUX A;  4UI7 A;  4XHU A;  4AVW A;  5DCZ A;  2RF5 A;  3W51 A;  4KRS A;  5FPF A;  5AL1 A;  3SE2 A;  4UI6 A;  4N4T A;  4UVV A;  4UI5 A;  5LXP A;  3GJW A;  4UVX A;  5C5R A;  4I9I A;  3L3L A;  4L2G A;  4N4V A;  2X5Y A;  1EFY A;  2RD6 A;  2PQF A;  3GN7 A;  4TJW A;  4DQY C;  4L0I A;  4UVS A;  3C4H A;  2RCW A;  4R6E A;  4HLM A;  4UVN A;  4L7U A;  3UDD A;  3UA9 A;  4BFP A;  4L0V A;  3FHB A;  1A26 A;  5LYH A;  2PAW A;  4MT9 A;  4W5I A;  4UVT A;  4TJU A;  4HL5 A;  1UK0 A;  4UVW A;  4RV6 A;  5C5Q A;  4BS4 A;  5ADT A;  1WOK A;  4TOS A;  4J1Z A;  4GV7 A;  4LI6 A;  4MSK A;  4PNQ A;  4UFU A;  4TKI A;  4PAX A;  4UVP A;  4OQB C;  4PY4 A;  4BJC A;  4ZZZ A;  3MHJ A;  5ADR A;  4HLH A;  4L6S A;  3SMI A;  5AKW A;  4UFY A;  4BUW A;  4TK5 A;  4BU6 A;  4F1L A;  5ECE A;  4UX4 A;  1UK1 A;  4GV4 A;  4BUU A;  3KCZ A;  4ZZX A;  4BUD A;  4HKK A;  4UVZ A;  4BU8 A;  4UHG A;  4UW1 A;  5AKU A;  4AVU A;  4PNN A;  4BUT A;  5ADQ A;  3P0P A;  4TVJ A;  4UI8 A;  4UVL A;  4BUA A;  4X52 A;  4L10 A;  5A00 A;  3KR7 A;  4BU7 A;  5AL4 A;  5AL2 A;  4F0E A;  4J21 A;  5EBT A;  4L0B A;  3P0N A;  4HLK A;  4HKI A;  4PML A;  5AL3 A;  3KJD A;  3L3M A;  3MHK A;  5AL5 A;  4PNM A;  4L34 A;  4N3R A;  1PAX A;  4L31 A;  4TJY A;  4J3M A;  4W5S A;  4L33 A;  4LI7 A;  4ZZY A;  3P0Q A;  4L7L A;  4TOR A;  4BU3 A;  4OQA C;  4BUY A;  4L2F A; 
#chains in the Genus database with same CATH topology
 4L6Z A;  1XKV A;  1NHX A;  5LX6 A;  3GEY A;  2FAH A;  3UH4 A;  1GS0 A;  4J3L A;  4UND A;  4BUI A;  4L0S A;  4DVI A;  4F1Q A;  3U9Y A;  4KZU A;  1II2 A;  3BLJ A;  4PNT A;  4GV2 A;  5FH3 A;  5I67 A;  4HYF A;  4UXB A;  4TK0 A;  4M7B A;  4W6E A;  4PNL A;  4YWB A;  4L7R A;  4GNQ A;  4YWD A;  3UH2 A;  4UI3 A;  4BUE A;  4BUS A;  4WOU A;  3SMJ A;  3GOY A;  4HKN A;  3KR8 A;  5AEH A;  2RKE A;  1AQ2 A;  4BU9 A;  4OPX C;  2RK7 A;  4BUV A;  4HLF A;  4HMH A;  4BU5 A;  1YTM A;  4K4E A;  5FPG A;  4HLG A;  4UVU A;  5C5P A;  3MOE A;  4YW8 A;  5FH1 A;  1KHE A;  4K4F A;  4GNL A;  4GNP A;  4L7O A;  4HHZ A;  4UUH A;  2RKD A;  4GV0 A;  2PY7 X;  3CE0 A;  4U6A A;  4WIE A;  5ETY A;  4HHY A;  4L0T A;  4IUE A;  3DTB A;  1YLH A;  4L70 A;  2PC9 A;  4R43 A;  3C49 A;  4L32 A;  4GNM A;  4PJT A;  4PNR A;  1YVY A;  4UVO A;  4BUF A;  4J22 A;  3U9H A;  4L09 A;  4BJB A;  2FAF A;  3UDD A;  2PAX A;  4L2K A;  4OA7 A;  4PJV A;  4MSG A;  2PXZ X;  4L7P A;  3PAX A;  4L7N A;  4PNS A;  3HKV A;  5ADS A;  4LI8 A;  4TKF A;  5FH2 A;  4R5W A;  4TKG A;  4BJ9 A;  4KZQ A;  4UVY A;  4KZL A;  4OX2 A;  4UI4 A;  4GNO A;  4UI7 A;  4BUX A;  4XHU A;  4GMU A;  1AYL A;  4AVW A;  5DCZ A;  2RF5 A;  3W51 A;  4KRS A;  5FPF A;  5AL1 A;  3SE2 A;  2QEW A;  4UI6 A;  4N4T A;  2ZCI A;  4UI5 A;  4UVV A;  5FH0 A;  5LXP A;  3GJW A;  4UVX A;  5C5R A;  4GMW A;  3L3L A;  4I9I A;  4L2G A;  4N4V A;  1EFY A;  2X5Y A;  2GMV A;  2RD6 A;  2PQF A;  3GN7 A;  4TJW A;  1OEN A;  2QEY A;  4GMZ A;  4DQY C;  4L0I A;  4UVS A;  1J3B A;  1KHF A;  2QZY A;  2RCW A;  3C4H A;  4HLM A;  4L7U A;  4R6E A;  4UVN A;  4L0V A;  4WL8 A;  4YW9 A;  4BFP A;  3FHB A;  1A26 A;  5LYH A;  2PAW A;  4MT9 A;  4W5I A;  4UVT A;  4TJU A;  4HL5 A;  1UK0 A;  4UVW A;  5FH4 A;  4RV6 A;  5C5Q A;  4BS4 A;  5ADT A;  1WOK A;  4TOS A;  3DT2 A;  4J1Z A;  4GV7 A;  4LI6 A;  4MSK A;  4PNQ A;  4UFU A;  4TKI A;  4PAX A;  4UVP A;  4OQB C;  4PY4 A;  4BJC A;  4ZZZ A;  3MHJ A;  5ADR A;  2QF1 A;  1K3D A;  3MOH A;  4HLH A;  4L6S A;  5AKW A;  4UFY A;  3SMI A;  4BUW A;  4TK5 A;  4BU6 A;  4F1L A;  3UA9 A;  5ECE A;  4UX4 A;  1UK1 A;  4GV4 A;  4BUU A;  3KCZ A;  4ZZX A;  2OLQ A;  4BUD A;  2RK8 A;  4HKK A;  4UVZ A;  4BU8 A;  4UHG A;  4UW1 A;  5AKU A;  4AVU A;  4PNN A;  4BUT A;  5ADQ A;  2QF2 A;  3P0P A;  4TVJ A;  4UI8 A;  4UVL A;  4BUA A;  4X52 A;  4L10 A;  5A00 A;  3KR7 A;  4BU7 A;  5AL4 A;  5AL2 A;  2OLR A;  3MOF A;  4F0E A;  1K3C A;  4J21 A;  5EBT A;  4RCG A;  4L0B A;  4WPV A;  3DT7 A;  3P0N A;  4WPU A;  4HLK A;  4HKI A;  4WPT A;  4PML A;  4WIU A;  5AL3 A;  3KJD A;  3L3M A;  3MHK A;  5AL5 A;  4PNM A;  4L34 A;  1OS1 A;  1PAX A;  4N3R A;  4L31 A;  4TJY A;  4J3M A;  2RKA A;  1M51 A;  4GMM A;  4L33 A;  4LI7 A;  4W5S A;  4ZZY A;  1KHG A;  3P0Q A;  5FH5 A;  4L7L A;  4TOR A;  4BU3 A;  4OQA C;  3DT4 A;  1YGG A;  1KHB A;  4BUY A;  4L2F A; 
#chains in the Genus database with same CATH homology
 4L6Z A;  1XKV A;  1NHX A;  5LX6 A;  3GEY A;  2FAH A;  3UH4 A;  1GS0 A;  4J3L A;  4UND A;  4BUI A;  4L0S A;  4DVI A;  4F1Q A;  3U9Y A;  4KZU A;  1II2 A;  3BLJ A;  4PNT A;  4GV2 A;  5FH3 A;  5I67 A;  4HYF A;  4UXB A;  4TK0 A;  4M7B A;  4W6E A;  4PNL A;  4YWB A;  4L7R A;  4GNQ A;  4YWD A;  3UH2 A;  4UI3 A;  4BUE A;  4BUS A;  4WOU A;  3SMJ A;  3GOY A;  4HKN A;  3KR8 A;  5AEH A;  2RKE A;  1AQ2 A;  4BU9 A;  4OPX C;  2RK7 A;  4BUV A;  4HLF A;  4HMH A;  4BU5 A;  1YTM A;  4K4E A;  5FPG A;  4HLG A;  4UVU A;  5C5P A;  3MOE A;  4YW8 A;  5FH1 A;  1KHE A;  4K4F A;  4GNL A;  4GNP A;  4L7O A;  4HHZ A;  4UUH A;  2RKD A;  4GV0 A;  2PY7 X;  3CE0 A;  4U6A A;  4WIE A;  5ETY A;  4HHY A;  4L0T A;  4IUE A;  3DTB A;  1YLH A;  4L70 A;  2PC9 A;  4R43 A;  3C49 A;  4L32 A;  4GNM A;  4PJT A;  4PNR A;  1YVY A;  4UVO A;  4BUF A;  4J22 A;  3U9H A;  4L09 A;  4BJB A;  2FAF A;  3UDD A;  2PAX A;  4L2K A;  4OA7 A;  4PJV A;  4MSG A;  2PXZ X;  4L7P A;  3PAX A;  4L7N A;  4PNS A;  3HKV A;  5ADS A;  4LI8 A;  4TKF A;  5FH2 A;  4R5W A;  4TKG A;  4BJ9 A;  4KZQ A;  4UVY A;  4KZL A;  4OX2 A;  4UI4 A;  4GNO A;  4UI7 A;  4BUX A;  4XHU A;  4GMU A;  1AYL A;  4AVW A;  5DCZ A;  2RF5 A;  3W51 A;  4KRS A;  5FPF A;  5AL1 A;  3SE2 A;  2QEW A;  4UI6 A;  4N4T A;  2ZCI A;  4UI5 A;  4UVV A;  5FH0 A;  5LXP A;  3GJW A;  4UVX A;  5C5R A;  4GMW A;  3L3L A;  4I9I A;  4L2G A;  4N4V A;  1EFY A;  2X5Y A;  2GMV A;  2RD6 A;  2PQF A;  3GN7 A;  4TJW A;  1OEN A;  2QEY A;  4GMZ A;  4DQY C;  4L0I A;  4UVS A;  1J3B A;  1KHF A;  2QZY A;  2RCW A;  3C4H A;  4HLM A;  4L7U A;  4R6E A;  4UVN A;  4L0V A;  4WL8 A;  4YW9 A;  4BFP A;  3FHB A;  1A26 A;  5LYH A;  2PAW A;  4MT9 A;  4W5I A;  4UVT A;  4TJU A;  4HL5 A;  1UK0 A;  4UVW A;  5FH4 A;  4RV6 A;  5C5Q A;  4BS4 A;  5ADT A;  1WOK A;  4TOS A;  3DT2 A;  4J1Z A;  4GV7 A;  4LI6 A;  4MSK A;  4PNQ A;  4UFU A;  4TKI A;  4PAX A;  4UVP A;  4OQB C;  4PY4 A;  4BJC A;  4ZZZ A;  3MHJ A;  5ADR A;  2QF1 A;  1K3D A;  3MOH A;  4HLH A;  4L6S A;  5AKW A;  4UFY A;  3SMI A;  4BUW A;  4TK5 A;  4BU6 A;  4F1L A;  3UA9 A;  5ECE A;  4UX4 A;  1UK1 A;  4GV4 A;  4BUU A;  3KCZ A;  4ZZX A;  2OLQ A;  4BUD A;  2RK8 A;  4HKK A;  4UVZ A;  4BU8 A;  4UHG A;  4UW1 A;  5AKU A;  4AVU A;  4PNN A;  4BUT A;  5ADQ A;  2QF2 A;  3P0P A;  4TVJ A;  4UI8 A;  4UVL A;  4BUA A;  4X52 A;  4L10 A;  5A00 A;  3KR7 A;  4BU7 A;  5AL4 A;  5AL2 A;  2OLR A;  3MOF A;  4F0E A;  1K3C A;  4J21 A;  5EBT A;  4RCG A;  4L0B A;  4WPV A;  3DT7 A;  3P0N A;  4WPU A;  4HLK A;  4HKI A;  4WPT A;  4PML A;  4WIU A;  5AL3 A;  3KJD A;  3L3M A;  3MHK A;  5AL5 A;  4PNM A;  4L34 A;  1OS1 A;  1PAX A;  4N3R A;  4L31 A;  4TJY A;  4J3M A;  2RKA A;  1M51 A;  4GMM A;  4L33 A;  4LI7 A;  4W5S A;  4ZZY A;  1KHG A;  3P0Q A;  5FH5 A;  4L7L A;  4TOR A;  4BU3 A;  4OQA C;  3DT4 A;  1YGG A;  1KHB A;  4BUY A;  4L2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...