4BUTA

Crystal structure of human tankyrase 2 in complex with 4-(4-oxo-3,4- dihydroquinazolin-2-yl)benzene-1-sulfonamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4butA00
4UVLA 5ADRA 3KJDA 4W5SA 4OQBC 4L0IA 3GN7A 4L6SA 4L7LA 5ETYA 5LXPA 4BFPA 4PJVA 5FPFA 4UVVA 4UNDA 3UH4A 4PNNA 4HKNA 3FHBA 4BU7A 4L10A 4L32A 4ZZZA 3C49A 3C4HA 4N3RA 3KCZA 4KRSA 4BJBA 4L09A 4L0BA 4TK5A 4AVUA 4BUFA 4L31A 4BUEA 3P0NA 4L7RA 4LI7A 4TJUA 4UVSA 4UXBA 4GV2A 4BUXA 4OQAC 4LI8A 4X52A 4L70A 4UI3A 4BU6A 1GS0A 4J3MA 4I9IA 4TJYA 3MHJA 1PAXA 4M7BA 4BU8A 4UHGA 4L0VA 3L3LA 4MT9A 4N4VA 5DCZA 4HLFA 4BJ9A 3SE2A 4PNTA 4TKGA 4UVXA 4PAXA 4HHYA 5LYHA 4BU5A 4HKIA 5AL2A 4HLMA 4UVOA 4TJWA 3L3MA 4K4EA 4UVWA 4GV7A 5EBTA 4BS4A 4HYFA 4UFUA 4UI4A 2PAXA 4L0SA 4UI8A 2X5YA 4KZLA 4HL5A 4KZUA 4PNSA 2RD6A 4PNRA 4PNLA 1UK1A 5C5QA 4L2FA 4UVTA 4HLHA 4F1QA 4IUEA 4MSGA 3W51A 5AKWA 1WOKA 4J21A 3P0QA 4UX4A 5ADSA 1UK0A 4TKIA 1EFYA 3UH2A 4BJCA 4UUHA 4KZQA 4R5WA 3KR7A 4TVJA 4BUVA 3U9YA 4PNMA 4BUAA 3GJWA 4UVPA 5AKUA 4PJTA 4N4TA 5ECEA 4PMLA 2RF5A 4HLGA 4TKFA 4BU3A 4BUWA 4GV4A 5AEHA 4LI6A 4UFYA 4TORA 5ADTA 3BLJA 4U6AA 4ZZXA 4AVWA 4L2KA 4OA7A 5C5RA 4RV6A 5A00A 3GEYA 3SMIA 4K4FA 3U9HA 4BUUA 4BUDA 4UI7A 4BUYA 4BUIA 3MHKA 4HLKA 4UI6A 5AL4A 4W5IA 2PQFA 4J22A 4L34A 4TK0A 5ADQA 4UW1A 2RCWA 2PAWA 4L0TA 4L33A 4HHZA 3CE0A 3UA9A 4BUTA 4L6ZA 4L7NA 4BUSA 4OPXC 3GOYA 4R6EA 4L7OA 4J1ZA 4ZZYA 4L2GA 1A26A 4DQYC 4GV0A 4J3LA 4MSKA 5AL5A 3SMJA 4TOSA 3KR8A 3HKVA 4HKKA 4UI5A 4DVIA 4UVNA 4F1LA 5LX6A 5AL1A 4L7PA 4F0EA 5AL3A 5FPGA 3UDDA 4XHUA 4L7UA 4PNQA 4HMHA 3PAXA 4W6EA 5C5PA 4UVZA 4UVYA 4BU9A 3P0PA 4UVUA 4PY4A
chains in the Genus database with same CATH superfamily
4UVLA 5ADRA 3KJDA 4W5SA 4OQBC 4L0IA 3GN7A 3DT7A 1YGGA 2PXZX 4L6SA 4L7LA 5ETYA 5LXPA 1K3CA 1OENA 4BFPA 4YWBA 4PJVA 1II2A 5FPFA 4GNPA 4UVVA 5FH2A 4UNDA 3UH4A 2RKEA 4PNNA 4HKNA 4WL8A 3FHBA 1AYLA 4BU7A 4L10A 4L32A 4ZZZA 2QZYA 2QEYA 3C49A 3C4HA 4N3RA 4WPUA 3KCZA 4KRSA 5FH1A 4L09A 4L0BA 4TK5A 4AVUA 4BJBA 4BUFA 4L31A 4WPTA 4BUEA 4DVIA 4RCGA 3P0NA 5FH5A 4L7RA 4LI7A 4TJUA 4UVSA 5AL2A 4UXBA 4GV2A 1AQ2A 4BUXA 4OQAC 4LI8A 4X52A 1YTMA 4L70A 2OLRA 4GNLA 4UI3A 4BU6A 1XKVA 1GS0A 4YWDA 4J3MA 4I9IA 4TJYA 3MHJA 4GMWA 1PAXA 4M7BA 2ZCIA 4BU8A 4UHGA 4L0VA 3L3LA 4MT9A 4N4VA 5DCZA 4HLFA 4BJ9A 3SE2A 1YVYA 4PNTA 4TKGA 4UVXA 4PAXA 4HHYA 5LYHA 4BU5A 2PY7X 4HKIA 4HLMA 4UVOA 4TJWA 3L3MA 4K4EA 4UVWA 2QEWA 4GMZA 4GV7A 4BS4A 2PC9A 2QF1A 4HYFA 1KHEA 4UFUA 4UI4A 5EBTA 2PAXA 4L0SA 4UI8A 2X5YA 4KZLA 4HL5A 1KHBA 4KZUA 2RD6A 4PNSA 4PNRA 1UK1A 4PNLA 4L2FA 4UVTA 4HLHA 5FH4A 5C5QA 2RKDA 4IUEA 3DT4A 4MSGA 5AKWA 3W51A 1WOKA 4J21A 3P0QA 4UX4A 3DTBA 4OX2A 5ADSA 1K3DA 1UK0A 4TKIA 1EFYA 3UH2A 4BJCA 4R43A 4UUHA 4KZQA 4R5WA 4WOUA 3KR7A 4TVJA 2RK8A 2RKAA 4BUVA 3U9YA 4PNMA 4BUAA 4GNOA 3GJWA 4UVPA 5AKUA 1OS1A 4PJTA 2FAFA 4GNMA 2FAHA 4N4TA 5ECEA 4PMLA 2RF5A 4HLGA 4TKFA 4BU3A 4BUWA 4GV4A 5AEHA 4LI6A 4UFYA 4TORA 1KHGA 1NHXA 3BLJA 4U6AA 4WIEA 4ZZXA 5ADTA 4AVWA 4L2KA 4OA7A 2GMVA 5C5RA 4RV6A 5A00A 3GEYA 3SMIA 4K4FA 2RK7A 4GMMA 5FH0A 3U9HA 4BUUA 4BUDA 4UI7A 4BUYA 1KHFA 4BUIA 3MHKA 4HLKA 4UI6A 3DT2A 5AL4A 4GNQA 4W5IA 2PQFA 4J22A 4L34A 4TK0A 5ADQA 3MOFA 4UW1A 2RCWA 2PAWA 4L0TA 4L33A 1YLHA 3CE0A 4HHZA 3UA9A 4L6ZA 4L7NA 4BUSA 4BUTA 4DQYC 4OPXC 3GOYA 3MOHA 4R6EA 4L7OA 4J1ZA 4ZZYA 4L2GA 1A26A 4YW8A 4GV0A 4J3LA 4MSKA 5AL5A 3SMJA 4TOSA 3KR8A 3HKVA 4HKKA 4UI5A 4WIUA 4UVNA 4F1LA 5LX6A 4GMUA 2OLQA 2QF2A 4L7PA 5AL1A 5AL3A 5FPGA 3UDDA 4F0EA 5FH3A 4XHUA 1J3BA 3MOEA 4L7UA 4PNQA 4F1QA 4HMHA 4WPVA 3PAXA 4W6EA 5C5PA 4UVZA 4YW9A 5I67A 4UVYA 4BU9A 3P0PA 4UVUA 4PY4A 1M51A
chains in the Genus database with same CATH topology
4UVLA 5ADRA 3KJDA 4W5SA 4OQBC 4L0IA 3GN7A 3DT7A 1YGGA 2PXZX 4L6SA 4L7LA 5ETYA 5LXPA 1K3CA 1OENA 4BFPA 4YWBA 4PJVA 1II2A 5FPFA 4GNPA 4UVVA 5FH2A 4UNDA 3UH4A 2RKEA 4PNNA 4HKNA 4WL8A 3FHBA 1AYLA 4BU7A 4L10A 4L32A 4ZZZA 2QZYA 2QEYA 3C49A 3C4HA 4N3RA 4WPUA 3KCZA 4KRSA 5FH1A 4L09A 4L0BA 4TK5A 4AVUA 4BJBA 4BUFA 4L31A 4WPTA 4BUEA 4DVIA 4RCGA 3P0NA 5FH5A 4L7RA 4LI7A 4TJUA 4UVSA 5AL2A 4UXBA 4GV2A 1AQ2A 4BUXA 4OQAC 4LI8A 4X52A 1YTMA 4L70A 2OLRA 4GNLA 4UI3A 4BU6A 1XKVA 1GS0A 4YWDA 4J3MA 4I9IA 4TJYA 3MHJA 4GMWA 1PAXA 4M7BA 2ZCIA 4BU8A 4UHGA 4L0VA 3L3LA 4MT9A 4N4VA 5DCZA 4HLFA 4BJ9A 3SE2A 1YVYA 4PNTA 4TKGA 4UVXA 4PAXA 4HHYA 5LYHA 4BU5A 2PY7X 4HKIA 4HLMA 4UVOA 4TJWA 3L3MA 4K4EA 4UVWA 2QEWA 4GMZA 4GV7A 4BS4A 2PC9A 2QF1A 4HYFA 1KHEA 4UFUA 4UI4A 5EBTA 2PAXA 4L0SA 4UI8A 2X5YA 4KZLA 4HL5A 1KHBA 4KZUA 2RD6A 4PNSA 4PNRA 1UK1A 4PNLA 4L2FA 4UVTA 4HLHA 5FH4A 5C5QA 2RKDA 4IUEA 3DT4A 4MSGA 5AKWA 3W51A 1WOKA 4J21A 3P0QA 4UX4A 3DTBA 4OX2A 5ADSA 1K3DA 1UK0A 4TKIA 1EFYA 3UH2A 4BJCA 4R43A 4UUHA 4KZQA 4R5WA 4WOUA 3KR7A 4TVJA 2RK8A 2RKAA 4BUVA 3U9YA 4PNMA 4BUAA 4GNOA 3GJWA 4UVPA 5AKUA 1OS1A 4PJTA 2FAFA 4GNMA 2FAHA 4N4TA 5ECEA 4PMLA 2RF5A 4HLGA 4TKFA 4BU3A 4BUWA 4GV4A 5AEHA 4LI6A 4UFYA 4TORA 1KHGA 1NHXA 3BLJA 4U6AA 4WIEA 4ZZXA 5ADTA 4AVWA 4L2KA 4OA7A 2GMVA 5C5RA 4RV6A 5A00A 3GEYA 3SMIA 4K4FA 2RK7A 4GMMA 5FH0A 3U9HA 4BUUA 4BUDA 4UI7A 4BUYA 1KHFA 4BUIA 3MHKA 4HLKA 4UI6A 3DT2A 5AL4A 4GNQA 4W5IA 2PQFA 4J22A 4L34A 4TK0A 5ADQA 3MOFA 4UW1A 2RCWA 2PAWA 4L0TA 4L33A 1YLHA 3CE0A 4HHZA 3UA9A 4L6ZA 4L7NA 4BUSA 4BUTA 4DQYC 4OPXC 3GOYA 3MOHA 4R6EA 4L7OA 4J1ZA 4ZZYA 4L2GA 1A26A 4YW8A 4GV0A 4J3LA 4MSKA 5AL5A 3SMJA 4TOSA 3KR8A 3HKVA 4HKKA 4UI5A 4WIUA 4UVNA 4F1LA 5LX6A 4GMUA 2OLQA 2QF2A 4L7PA 5AL1A 5AL3A 5FPGA 3UDDA 4F0EA 5FH3A 4XHUA 1J3BA 3MOEA 4L7UA 4PNQA 4F1QA 4HMHA 4WPVA 3PAXA 4W6EA 5C5PA 4UVZA 4YW9A 5I67A 4UVYA 4BU9A 3P0PA 4UVUA 4PY4A 1M51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVL A;  5ADR A;  3KJD A;  4W5S A;  4OQB C;  4L0I A;  3GN7 A;  4L6S A;  4L7L A;  5ETY A;  5LXP A;  4BFP A;  4PJV A;  5FPF A;  4UVV A;  4UND A;  3UH4 A;  4PNN A;  4HKN A;  3FHB A;  4BU7 A;  4L10 A;  4L32 A;  4ZZZ A;  3C49 A;  3C4H A;  4N3R A;  3KCZ A;  4KRS A;  4BJB A;  4L09 A;  4L0B A;  4TK5 A;  4AVU A;  4BUF A;  4L31 A;  4BUE A;  3P0N A;  4L7R A;  4LI7 A;  4TJU A;  4UVS A;  4UXB A;  4GV2 A;  4BUX A;  4OQA C;  4LI8 A;  4X52 A;  4L70 A;  4UI3 A;  4BU6 A;  1GS0 A;  4J3M A;  4I9I A;  4TJY A;  3MHJ A;  1PAX A;  4M7B A;  4BU8 A;  4UHG A;  4L0V A;  3L3L A;  4MT9 A;  4N4V A;  5DCZ A;  4HLF A;  4BJ9 A;  3SE2 A;  4PNT A;  4TKG A;  4UVX A;  4PAX A;  4HHY A;  5LYH A;  4BU5 A;  4HKI A;  5AL2 A;  4HLM A;  4UVO A;  4TJW A;  3L3M A;  4K4E A;  4UVW A;  4GV7 A;  5EBT A;  4BS4 A;  4HYF A;  4UFU A;  4UI4 A;  2PAX A;  4L0S A;  4UI8 A;  2X5Y A;  4KZL A;  4HL5 A;  4KZU A;  4PNS A;  2RD6 A;  4PNR A;  4PNL A;  1UK1 A;  5C5Q A;  4L2F A;  4UVT A;  4HLH A;  4F1Q A;  4IUE A;  4MSG A;  3W51 A;  5AKW A;  1WOK A;  4J21 A;  3P0Q A;  4UX4 A;  5ADS A;  1UK0 A;  4TKI A;  1EFY A;  3UH2 A;  4BJC A;  4UUH A;  4KZQ A;  4R5W A;  3KR7 A;  4TVJ A;  4BUV A;  3U9Y A;  4PNM A;  4BUA A;  3GJW A;  4UVP A;  5AKU A;  4PJT A;  4N4T A;  5ECE A;  4PML A;  2RF5 A;  4HLG A;  4TKF A;  4BU3 A;  4BUW A;  4GV4 A;  5AEH A;  4LI6 A;  4UFY A;  4TOR A;  5ADT A;  3BLJ A;  4U6A A;  4ZZX A;  4AVW A;  4L2K A;  4OA7 A;  5C5R A;  4RV6 A;  5A00 A;  3GEY A;  3SMI A;  4K4F A;  3U9H A;  4BUU A;  4BUD A;  4UI7 A;  4BUY A;  4BUI A;  3MHK A;  4HLK A;  4UI6 A;  5AL4 A;  4W5I A;  2PQF A;  4J22 A;  4L34 A;  4TK0 A;  5ADQ A;  4UW1 A;  2RCW A;  2PAW A;  4L0T A;  4L33 A;  4HHZ A;  3CE0 A;  3UA9 A;  4BUT A;  4L6Z A;  4L7N A;  4BUS A;  4OPX C;  3GOY A;  4R6E A;  4L7O A;  4J1Z A;  4ZZY A;  4L2G A;  1A26 A;  4DQY C;  4GV0 A;  4J3L A;  4MSK A;  5AL5 A;  3SMJ A;  4TOS A;  3KR8 A;  3HKV A;  4HKK A;  4UI5 A;  4DVI A;  4UVN A;  4F1L A;  5LX6 A;  5AL1 A;  4L7P A;  4F0E A;  5AL3 A;  5FPG A;  3UDD A;  4XHU A;  4L7U A;  4PNQ A;  4HMH A;  3PAX A;  4W6E A;  5C5P A;  4UVZ A;  4UVY A;  4BU9 A;  3P0P A;  4UVU A;  4PY4 A; 
#chains in the Genus database with same CATH topology
 4UVL A;  5ADR A;  3KJD A;  4W5S A;  4OQB C;  4L0I A;  3GN7 A;  3DT7 A;  1YGG A;  2PXZ X;  4L6S A;  4L7L A;  5ETY A;  5LXP A;  1K3C A;  1OEN A;  4BFP A;  4YWB A;  4PJV A;  1II2 A;  5FPF A;  4GNP A;  4UVV A;  5FH2 A;  4UND A;  3UH4 A;  2RKE A;  4PNN A;  4HKN A;  4WL8 A;  3FHB A;  1AYL A;  4BU7 A;  4L10 A;  4L32 A;  4ZZZ A;  2QZY A;  2QEY A;  3C49 A;  3C4H A;  4N3R A;  4WPU A;  3KCZ A;  4KRS A;  5FH1 A;  4L09 A;  4L0B A;  4TK5 A;  4AVU A;  4BJB A;  4BUF A;  4L31 A;  4WPT A;  4BUE A;  4DVI A;  4RCG A;  3P0N A;  5FH5 A;  4L7R A;  4LI7 A;  4TJU A;  4UVS A;  5AL2 A;  4UXB A;  4GV2 A;  1AQ2 A;  4BUX A;  4OQA C;  4LI8 A;  4X52 A;  1YTM A;  4L70 A;  2OLR A;  4GNL A;  4UI3 A;  4BU6 A;  1XKV A;  1GS0 A;  4YWD A;  4J3M A;  4I9I A;  4TJY A;  3MHJ A;  4GMW A;  1PAX A;  4M7B A;  2ZCI A;  4BU8 A;  4UHG A;  4L0V A;  3L3L A;  4MT9 A;  4N4V A;  5DCZ A;  4HLF A;  4BJ9 A;  3SE2 A;  1YVY A;  4PNT A;  4TKG A;  4UVX A;  4PAX A;  4HHY A;  5LYH A;  4BU5 A;  2PY7 X;  4HKI A;  4HLM A;  4UVO A;  4TJW A;  3L3M A;  4K4E A;  4UVW A;  2QEW A;  4GMZ A;  4GV7 A;  4BS4 A;  2PC9 A;  2QF1 A;  4HYF A;  1KHE A;  4UFU A;  4UI4 A;  5EBT A;  2PAX A;  4L0S A;  4UI8 A;  2X5Y A;  4KZL A;  4HL5 A;  1KHB A;  4KZU A;  2RD6 A;  4PNS A;  4PNR A;  1UK1 A;  4PNL A;  4L2F A;  4UVT A;  4HLH A;  5FH4 A;  5C5Q A;  2RKD A;  4IUE A;  3DT4 A;  4MSG A;  5AKW A;  3W51 A;  1WOK A;  4J21 A;  3P0Q A;  4UX4 A;  3DTB A;  4OX2 A;  5ADS A;  1K3D A;  1UK0 A;  4TKI A;  1EFY A;  3UH2 A;  4BJC A;  4R43 A;  4UUH A;  4KZQ A;  4R5W A;  4WOU A;  3KR7 A;  4TVJ A;  2RK8 A;  2RKA A;  4BUV A;  3U9Y A;  4PNM A;  4BUA A;  4GNO A;  3GJW A;  4UVP A;  5AKU A;  1OS1 A;  4PJT A;  2FAF A;  4GNM A;  2FAH A;  4N4T A;  5ECE A;  4PML A;  2RF5 A;  4HLG A;  4TKF A;  4BU3 A;  4BUW A;  4GV4 A;  5AEH A;  4LI6 A;  4UFY A;  4TOR A;  1KHG A;  1NHX A;  3BLJ A;  4U6A A;  4WIE A;  4ZZX A;  5ADT A;  4AVW A;  4L2K A;  4OA7 A;  2GMV A;  5C5R A;  4RV6 A;  5A00 A;  3GEY A;  3SMI A;  4K4F A;  2RK7 A;  4GMM A;  5FH0 A;  3U9H A;  4BUU A;  4BUD A;  4UI7 A;  4BUY A;  1KHF A;  4BUI A;  3MHK A;  4HLK A;  4UI6 A;  3DT2 A;  5AL4 A;  4GNQ A;  4W5I A;  2PQF A;  4J22 A;  4L34 A;  4TK0 A;  5ADQ A;  3MOF A;  4UW1 A;  2RCW A;  2PAW A;  4L0T A;  4L33 A;  1YLH A;  3CE0 A;  4HHZ A;  3UA9 A;  4L6Z A;  4L7N A;  4BUS A;  4BUT A;  4DQY C;  4OPX C;  3GOY A;  3MOH A;  4R6E A;  4L7O A;  4J1Z A;  4ZZY A;  4L2G A;  1A26 A;  4YW8 A;  4GV0 A;  4J3L A;  4MSK A;  5AL5 A;  3SMJ A;  4TOS A;  3KR8 A;  3HKV A;  4HKK A;  4UI5 A;  4WIU A;  4UVN A;  4F1L A;  5LX6 A;  4GMU A;  2OLQ A;  2QF2 A;  4L7P A;  5AL1 A;  5AL3 A;  5FPG A;  3UDD A;  4F0E A;  5FH3 A;  4XHU A;  1J3B A;  3MOE A;  4L7U A;  4PNQ A;  4F1Q A;  4HMH A;  4WPV A;  3PAX A;  4W6E A;  5C5P A;  4UVZ A;  4YW9 A;  5I67 A;  4UVY A;  4BU9 A;  3P0P A;  4UVU A;  4PY4 A;  1M51 A; 
#chains in the Genus database with same CATH homology
 4UVL A;  5ADR A;  3KJD A;  4W5S A;  4OQB C;  4L0I A;  3GN7 A;  3DT7 A;  1YGG A;  2PXZ X;  4L6S A;  4L7L A;  5ETY A;  5LXP A;  1K3C A;  1OEN A;  4BFP A;  4YWB A;  4PJV A;  1II2 A;  5FPF A;  4GNP A;  4UVV A;  5FH2 A;  4UND A;  3UH4 A;  2RKE A;  4PNN A;  4HKN A;  4WL8 A;  3FHB A;  1AYL A;  4BU7 A;  4L10 A;  4L32 A;  4ZZZ A;  2QZY A;  2QEY A;  3C49 A;  3C4H A;  4N3R A;  4WPU A;  3KCZ A;  4KRS A;  5FH1 A;  4L09 A;  4L0B A;  4TK5 A;  4AVU A;  4BJB A;  4BUF A;  4L31 A;  4WPT A;  4BUE A;  4DVI A;  4RCG A;  3P0N A;  5FH5 A;  4L7R A;  4LI7 A;  4TJU A;  4UVS A;  5AL2 A;  4UXB A;  4GV2 A;  1AQ2 A;  4BUX A;  4OQA C;  4LI8 A;  4X52 A;  1YTM A;  4L70 A;  2OLR A;  4GNL A;  4UI3 A;  4BU6 A;  1XKV A;  1GS0 A;  4YWD A;  4J3M A;  4I9I A;  4TJY A;  3MHJ A;  4GMW A;  1PAX A;  4M7B A;  2ZCI A;  4BU8 A;  4UHG A;  4L0V A;  3L3L A;  4MT9 A;  4N4V A;  5DCZ A;  4HLF A;  4BJ9 A;  3SE2 A;  1YVY A;  4PNT A;  4TKG A;  4UVX A;  4PAX A;  4HHY A;  5LYH A;  4BU5 A;  2PY7 X;  4HKI A;  4HLM A;  4UVO A;  4TJW A;  3L3M A;  4K4E A;  4UVW A;  2QEW A;  4GMZ A;  4GV7 A;  4BS4 A;  2PC9 A;  2QF1 A;  4HYF A;  1KHE A;  4UFU A;  4UI4 A;  5EBT A;  2PAX A;  4L0S A;  4UI8 A;  2X5Y A;  4KZL A;  4HL5 A;  1KHB A;  4KZU A;  2RD6 A;  4PNS A;  4PNR A;  1UK1 A;  4PNL A;  4L2F A;  4UVT A;  4HLH A;  5FH4 A;  5C5Q A;  2RKD A;  4IUE A;  3DT4 A;  4MSG A;  5AKW A;  3W51 A;  1WOK A;  4J21 A;  3P0Q A;  4UX4 A;  3DTB A;  4OX2 A;  5ADS A;  1K3D A;  1UK0 A;  4TKI A;  1EFY A;  3UH2 A;  4BJC A;  4R43 A;  4UUH A;  4KZQ A;  4R5W A;  4WOU A;  3KR7 A;  4TVJ A;  2RK8 A;  2RKA A;  4BUV A;  3U9Y A;  4PNM A;  4BUA A;  4GNO A;  3GJW A;  4UVP A;  5AKU A;  1OS1 A;  4PJT A;  2FAF A;  4GNM A;  2FAH A;  4N4T A;  5ECE A;  4PML A;  2RF5 A;  4HLG A;  4TKF A;  4BU3 A;  4BUW A;  4GV4 A;  5AEH A;  4LI6 A;  4UFY A;  4TOR A;  1KHG A;  1NHX A;  3BLJ A;  4U6A A;  4WIE A;  4ZZX A;  5ADT A;  4AVW A;  4L2K A;  4OA7 A;  2GMV A;  5C5R A;  4RV6 A;  5A00 A;  3GEY A;  3SMI A;  4K4F A;  2RK7 A;  4GMM A;  5FH0 A;  3U9H A;  4BUU A;  4BUD A;  4UI7 A;  4BUY A;  1KHF A;  4BUI A;  3MHK A;  4HLK A;  4UI6 A;  3DT2 A;  5AL4 A;  4GNQ A;  4W5I A;  2PQF A;  4J22 A;  4L34 A;  4TK0 A;  5ADQ A;  3MOF A;  4UW1 A;  2RCW A;  2PAW A;  4L0T A;  4L33 A;  1YLH A;  3CE0 A;  4HHZ A;  3UA9 A;  4L6Z A;  4L7N A;  4BUS A;  4BUT A;  4DQY C;  4OPX C;  3GOY A;  3MOH A;  4R6E A;  4L7O A;  4J1Z A;  4ZZY A;  4L2G A;  1A26 A;  4YW8 A;  4GV0 A;  4J3L A;  4MSK A;  5AL5 A;  3SMJ A;  4TOS A;  3KR8 A;  3HKV A;  4HKK A;  4UI5 A;  4WIU A;  4UVN A;  4F1L A;  5LX6 A;  4GMU A;  2OLQ A;  2QF2 A;  4L7P A;  5AL1 A;  5AL3 A;  5FPG A;  3UDD A;  4F0E A;  5FH3 A;  4XHU A;  1J3B A;  3MOE A;  4L7U A;  4PNQ A;  4F1Q A;  4HMH A;  4WPV A;  3PAX A;  4W6E A;  5C5P A;  4UVZ A;  4YW9 A;  5I67 A;  4UVY A;  4BU9 A;  3P0P A;  4UVU A;  4PY4 A;  1M51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...