4BUUA

Crystal structure of human tankyrase 2 in complex with (4-(4-oxo-3,4- dihydroquinazolin-2-yl)phenyl)methanesulfonamide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
211
structure length
209
Chain Sequence
SGTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 209
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buuA00
4BUAA 5ECEA 4OQBC 4HLKA 4GV7A 4HLMA 4J3LA 4ZZXA 4DQYC 4TORA 4BU5A 5AL5A 4L2FA 4PNNA 4TKIA 4KRSA 4UI5A 5ADQA 5AKUA 4L0SA 4L2GA 4MSKA 5AEHA 3KR7A 5ETYA 4TOSA 4LI6A 4L6SA 1PAXA 1UK0A 5DCZA 5C5PA 3W51A 4HLGA 4DVIA 3GJWA 4BU9A 4LI8A 3BLJA 4BJ9A 4UVSA 4L7UA 4BUDA 4L2KA 4PNRA 4KZQA 4GV4A 2X5YA 4UI4A 4UX4A 3KJDA 3P0NA 4AVWA 4PNMA 4J1ZA 4L0BA 4BUTA 4PAXA 4UVOA 4TK0A 4HKNA 4BUUA 4L31A 4BFPA 2RD6A 4W6EA 3UA9A 3GEYA 4TVJA 4UVTA 5A00A 5C5QA 3C49A 4L0TA 4U6AA 4HKKA 4HHYA 4L7OA 4PNLA 4L34A 4BU7A 4UHGA 4K4EA 4BUXA 4RV6A 4F1QA 3L3LA 4UVYA 4L10A 4L7LA 4W5IA 4TK5A 4BU8A 4I9IA 4TJWA 5AL4A 4N4VA 4GV0A 5AL3A 4L6ZA 5FPGA 4UFUA 4HLHA 4PJVA 4TKGA 4UVZA 4HYFA 3MHJA 4L09A 4L32A 4OQAC 5ADSA 4IUEA 4HMHA 4BUWA 3GN7A 4J3MA 4LI7A 4HL5A 4R6EA 4X52A 4R5WA 3GOYA 4W5SA 4BS4A 4PNQA 4UI6A 4TJUA 4OA7A 5AKWA 4AVUA 5ADTA 5LYHA 3SE2A 4BUSA 4UVVA 4UNDA 4BU6A 4BU3A 5C5RA 4BUFA 1GS0A 4HKIA 4TKFA 4UVPA 4L0IA 5AL2A 2RF5A 4K4FA 4UVUA 3CE0A 5ADRA 4ZZZA 1WOKA 5EBTA 1UK1A 3FHBA 2RCWA 2PQFA 4BUIA 5LX6A 3P0PA 4L33A 3SMIA 4HLFA 3UH2A 3MHKA 4OPXC 3KR8A 4HHZA 4N4TA 4TJYA 4XHUA 1A26A 4MSGA 4UVWA 4UVNA 4ZZYA 1EFYA 4GV2A 4PY4A 5FPFA 4J22A 4BUVA 4UFYA 4BUEA 4KZLA 4PJTA 4UUHA 4BUYA 4PNTA 4PMLA 3C4HA 4L0VA 4UXBA 4L70A 4UI7A 3U9YA 4F0EA 3KCZA 4M7BA 4UVLA 4BJBA 4UW1A 3L3MA 3UDDA 4BJCA 3PAXA 3U9HA 4L7PA 5LXPA 4J21A 4UI3A 4L7NA 4MT9A 5AL1A 3P0QA 3SMJA 4UVXA 2PAXA 4N3RA 2PAWA 4L7RA 4KZUA 4F1LA 3HKVA 3UH4A 4PNSA 4UI8A
chains in the Genus database with same CATH superfamily
4BUAA 5ECEA 4OQBC 4HLKA 4GV7A 4HLMA 4J3LA 4ZZXA 4DQYC 4TORA 4BU5A 5AL5A 4L2FA 4WOUA 4GNOA 4PNNA 4TKIA 1II2A 1M51A 4KRSA 4UI5A 5ADQA 5AKUA 4L0SA 4L2GA 4MSKA 5AEHA 3KR7A 5ETYA 4TOSA 4BUDA 1XKVA 4LI6A 4L6SA 1PAXA 1UK0A 2OLRA 5DCZA 3W51A 5C5PA 4HLGA 2QF1A 4DVIA 2PXZX 3GJWA 4BU9A 1KHEA 4LI8A 5FH2A 3BLJA 4BJ9A 4UVSA 4L7UA 2QF2A 4L2KA 4PNRA 4GV4A 4KZQA 2X5YA 3MOFA 4GMMA 4UI4A 4UX4A 3KJDA 3P0NA 4AVWA 1YGGA 4PNMA 4J1ZA 4L0BA 4BUTA 4PAXA 4UVOA 1K3DA 4HKNA 4BUUA 4TK0A 4L31A 4BFPA 2GMVA 2RD6A 4W6EA 3UA9A 3GEYA 4OX2A 2PC9A 4TVJA 2OLQA 4UVTA 5A00A 5C5QA 3C49A 4L0TA 4U6AA 4WL8A 4HKKA 5FH0A 4HHYA 2RKDA 4L7OA 4L34A 4PNLA 4BU7A 4UHGA 4K4EA 4BUXA 4RV6A 4F1QA 3L3LA 4UVYA 4L10A 4L7LA 4W5IA 4TK5A 4BU8A 4I9IA 3DT2A 4TJWA 5AL4A 4N4VA 4GV0A 5AL3A 5I67A 4L6ZA 1NHXA 5FPGA 2QEWA 4GNMA 4HLHA 4PJVA 4TKGA 4UFUA 4HYFA 3MHJA 4L09A 4L32A 4UVZA 4RCGA 4GNQA 5ADSA 4IUEA 4HMHA 2RK7A 4BUWA 1AYLA 3GN7A 3MOHA 4J3MA 4LI7A 2FAHA 2RK8A 4HL5A 4R6EA 4X52A 4R5WA 3GOYA 4W5SA 4BS4A 4PNQA 4UI6A 4TJUA 4OA7A 5AKWA 4AVUA 5ADTA 5LYHA 1K3CA 3SE2A 4BUSA 4UVVA 4UNDA 1YLHA 4BU6A 3DTBA 4BU3A 5C5RA 4BUFA 1GS0A 2RKEA 4HKIA 1OENA 4TKFA 4UVPA 4L0IA 1YTMA 2RF5A 4GMUA 4K4FA 5AL2A 4UVUA 3CE0A 5ADRA 2QEYA 4ZZZA 1WOKA 5EBTA 1UK1A 3FHBA 2RCWA 4OQAC 2PQFA 4BUIA 5LX6A 3DT7A 3P0PA 1OS1A 4L33A 4YWBA 3SMIA 4WPVA 4GNLA 4HLFA 4GMZA 3UH2A 3MHKA 4WIUA 4OPXC 3KR8A 4HHZA 4N4TA 4TJYA 4YW8A 5FH1A 4XHUA 1A26A 4MSGA 2FAFA 3MOEA 4UVWA 1EFYA 4UVNA 3DT4A 4GMWA 4GV2A 4PY4A 4ZZYA 5FH3A 5FPFA 4J22A 2ZCIA 4BUVA 4UFYA 1KHFA 4BUEA 4KZLA 4PJTA 5FH4A 1KHBA 4UUHA 4BUYA 4PNTA 4PMLA 2PY7X 2RKAA 3C4HA 4L0VA 2QZYA 4UXBA 4L70A 4UI7A 4YW9A 4R43A 4WPUA 1KHGA 3U9YA 4F0EA 3KCZA 1J3BA 4M7BA 4UVLA 4UW1A 4BJBA 5FH5A 3L3MA 3UDDA 4BJCA 3PAXA 4WPTA 4L7PA 4GNPA 3U9HA 5LXPA 4WIEA 4J21A 4UI3A 4L7NA 4MT9A 5AL1A 3P0QA 3SMJA 4UVXA 1YVYA 2PAXA 4N3RA 1AQ2A 2PAWA 4L7RA 4KZUA 4F1LA 4YWDA 3HKVA 3UH4A 4PNSA 4UI8A
chains in the Genus database with same CATH topology
4BUAA 5ECEA 4OQBC 4HLKA 4GV7A 4HLMA 4J3LA 4ZZXA 4DQYC 4TORA 4BU5A 5AL5A 4L2FA 4WOUA 4GNOA 4PNNA 4TKIA 1II2A 1M51A 4KRSA 4UI5A 5ADQA 5AKUA 4L0SA 4L2GA 4MSKA 5AEHA 3KR7A 5ETYA 4TOSA 4BUDA 1XKVA 4LI6A 4L6SA 1PAXA 1UK0A 2OLRA 5DCZA 3W51A 5C5PA 4HLGA 2QF1A 4DVIA 2PXZX 3GJWA 4BU9A 1KHEA 4LI8A 5FH2A 3BLJA 4BJ9A 4UVSA 4L7UA 2QF2A 4L2KA 4PNRA 4GV4A 4KZQA 2X5YA 3MOFA 4GMMA 4UI4A 4UX4A 3KJDA 3P0NA 4AVWA 1YGGA 4PNMA 4J1ZA 4L0BA 4BUTA 4PAXA 4UVOA 1K3DA 4HKNA 4BUUA 4TK0A 4L31A 4BFPA 2GMVA 2RD6A 4W6EA 3UA9A 3GEYA 4OX2A 2PC9A 4TVJA 2OLQA 4UVTA 5A00A 5C5QA 3C49A 4L0TA 4U6AA 4WL8A 4HKKA 5FH0A 4HHYA 2RKDA 4L7OA 4L34A 4PNLA 4BU7A 4UHGA 4K4EA 4BUXA 4RV6A 4F1QA 3L3LA 4UVYA 4L10A 4L7LA 4W5IA 4TK5A 4BU8A 4I9IA 3DT2A 4TJWA 5AL4A 4N4VA 4GV0A 5AL3A 5I67A 4L6ZA 1NHXA 5FPGA 2QEWA 4GNMA 4HLHA 4PJVA 4TKGA 4UFUA 4HYFA 3MHJA 4L09A 4L32A 4UVZA 4RCGA 4GNQA 5ADSA 4IUEA 4HMHA 2RK7A 4BUWA 1AYLA 3GN7A 3MOHA 4J3MA 4LI7A 2FAHA 2RK8A 4HL5A 4R6EA 4X52A 4R5WA 3GOYA 4W5SA 4BS4A 4PNQA 4UI6A 4TJUA 4OA7A 5AKWA 4AVUA 5ADTA 5LYHA 1K3CA 3SE2A 4BUSA 4UVVA 4UNDA 1YLHA 4BU6A 3DTBA 4BU3A 5C5RA 4BUFA 1GS0A 2RKEA 4HKIA 1OENA 4TKFA 4UVPA 4L0IA 1YTMA 2RF5A 4GMUA 4K4FA 5AL2A 4UVUA 3CE0A 5ADRA 2QEYA 4ZZZA 1WOKA 5EBTA 1UK1A 3FHBA 2RCWA 4OQAC 2PQFA 4BUIA 5LX6A 3DT7A 3P0PA 1OS1A 4L33A 4YWBA 3SMIA 4WPVA 4GNLA 4HLFA 4GMZA 3UH2A 3MHKA 4WIUA 4OPXC 3KR8A 4HHZA 4N4TA 4TJYA 4YW8A 5FH1A 4XHUA 1A26A 4MSGA 2FAFA 3MOEA 4UVWA 1EFYA 4UVNA 3DT4A 4GMWA 4GV2A 4PY4A 4ZZYA 5FH3A 5FPFA 4J22A 2ZCIA 4BUVA 4UFYA 1KHFA 4BUEA 4KZLA 4PJTA 5FH4A 1KHBA 4UUHA 4BUYA 4PNTA 4PMLA 2PY7X 2RKAA 3C4HA 4L0VA 2QZYA 4UXBA 4L70A 4UI7A 4YW9A 4R43A 4WPUA 1KHGA 3U9YA 4F0EA 3KCZA 1J3BA 4M7BA 4UVLA 4UW1A 4BJBA 5FH5A 3L3MA 3UDDA 4BJCA 3PAXA 4WPTA 4L7PA 4GNPA 3U9HA 5LXPA 4WIEA 4J21A 4UI3A 4L7NA 4MT9A 5AL1A 3P0QA 3SMJA 4UVXA 1YVYA 2PAXA 4N3RA 1AQ2A 2PAWA 4L7RA 4KZUA 4F1LA 4YWDA 3HKVA 3UH4A 4PNSA 4UI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUA A;  5ECE A;  4OQB C;  4HLK A;  4GV7 A;  4HLM A;  4J3L A;  4ZZX A;  4DQY C;  4TOR A;  4BU5 A;  5AL5 A;  4L2F A;  4PNN A;  4TKI A;  4KRS A;  4UI5 A;  5ADQ A;  5AKU A;  4L0S A;  4L2G A;  4MSK A;  5AEH A;  3KR7 A;  5ETY A;  4TOS A;  4LI6 A;  4L6S A;  1PAX A;  1UK0 A;  5DCZ A;  5C5P A;  3W51 A;  4HLG A;  4DVI A;  3GJW A;  4BU9 A;  4LI8 A;  3BLJ A;  4BJ9 A;  4UVS A;  4L7U A;  4BUD A;  4L2K A;  4PNR A;  4KZQ A;  4GV4 A;  2X5Y A;  4UI4 A;  4UX4 A;  3KJD A;  3P0N A;  4AVW A;  4PNM A;  4J1Z A;  4L0B A;  4BUT A;  4PAX A;  4UVO A;  4TK0 A;  4HKN A;  4BUU A;  4L31 A;  4BFP A;  2RD6 A;  4W6E A;  3UA9 A;  3GEY A;  4TVJ A;  4UVT A;  5A00 A;  5C5Q A;  3C49 A;  4L0T A;  4U6A A;  4HKK A;  4HHY A;  4L7O A;  4PNL A;  4L34 A;  4BU7 A;  4UHG A;  4K4E A;  4BUX A;  4RV6 A;  4F1Q A;  3L3L A;  4UVY A;  4L10 A;  4L7L A;  4W5I A;  4TK5 A;  4BU8 A;  4I9I A;  4TJW A;  5AL4 A;  4N4V A;  4GV0 A;  5AL3 A;  4L6Z A;  5FPG A;  4UFU A;  4HLH A;  4PJV A;  4TKG A;  4UVZ A;  4HYF A;  3MHJ A;  4L09 A;  4L32 A;  4OQA C;  5ADS A;  4IUE A;  4HMH A;  4BUW A;  3GN7 A;  4J3M A;  4LI7 A;  4HL5 A;  4R6E A;  4X52 A;  4R5W A;  3GOY A;  4W5S A;  4BS4 A;  4PNQ A;  4UI6 A;  4TJU A;  4OA7 A;  5AKW A;  4AVU A;  5ADT A;  5LYH A;  3SE2 A;  4BUS A;  4UVV A;  4UND A;  4BU6 A;  4BU3 A;  5C5R A;  4BUF A;  1GS0 A;  4HKI A;  4TKF A;  4UVP A;  4L0I A;  5AL2 A;  2RF5 A;  4K4F A;  4UVU A;  3CE0 A;  5ADR A;  4ZZZ A;  1WOK A;  5EBT A;  1UK1 A;  3FHB A;  2RCW A;  2PQF A;  4BUI A;  5LX6 A;  3P0P A;  4L33 A;  3SMI A;  4HLF A;  3UH2 A;  3MHK A;  4OPX C;  3KR8 A;  4HHZ A;  4N4T A;  4TJY A;  4XHU A;  1A26 A;  4MSG A;  4UVW A;  4UVN A;  4ZZY A;  1EFY A;  4GV2 A;  4PY4 A;  5FPF A;  4J22 A;  4BUV A;  4UFY A;  4BUE A;  4KZL A;  4PJT A;  4UUH A;  4BUY A;  4PNT A;  4PML A;  3C4H A;  4L0V A;  4UXB A;  4L70 A;  4UI7 A;  3U9Y A;  4F0E A;  3KCZ A;  4M7B A;  4UVL A;  4BJB A;  4UW1 A;  3L3M A;  3UDD A;  4BJC A;  3PAX A;  3U9H A;  4L7P A;  5LXP A;  4J21 A;  4UI3 A;  4L7N A;  4MT9 A;  5AL1 A;  3P0Q A;  3SMJ A;  4UVX A;  2PAX A;  4N3R A;  2PAW A;  4L7R A;  4KZU A;  4F1L A;  3HKV A;  3UH4 A;  4PNS A;  4UI8 A; 
#chains in the Genus database with same CATH topology
 4BUA A;  5ECE A;  4OQB C;  4HLK A;  4GV7 A;  4HLM A;  4J3L A;  4ZZX A;  4DQY C;  4TOR A;  4BU5 A;  5AL5 A;  4L2F A;  4WOU A;  4GNO A;  4PNN A;  4TKI A;  1II2 A;  1M51 A;  4KRS A;  4UI5 A;  5ADQ A;  5AKU A;  4L0S A;  4L2G A;  4MSK A;  5AEH A;  3KR7 A;  5ETY A;  4TOS A;  4BUD A;  1XKV A;  4LI6 A;  4L6S A;  1PAX A;  1UK0 A;  2OLR A;  5DCZ A;  3W51 A;  5C5P A;  4HLG A;  2QF1 A;  4DVI A;  2PXZ X;  3GJW A;  4BU9 A;  1KHE A;  4LI8 A;  5FH2 A;  3BLJ A;  4BJ9 A;  4UVS A;  4L7U A;  2QF2 A;  4L2K A;  4PNR A;  4GV4 A;  4KZQ A;  2X5Y A;  3MOF A;  4GMM A;  4UI4 A;  4UX4 A;  3KJD A;  3P0N A;  4AVW A;  1YGG A;  4PNM A;  4J1Z A;  4L0B A;  4BUT A;  4PAX A;  4UVO A;  1K3D A;  4HKN A;  4BUU A;  4TK0 A;  4L31 A;  4BFP A;  2GMV A;  2RD6 A;  4W6E A;  3UA9 A;  3GEY A;  4OX2 A;  2PC9 A;  4TVJ A;  2OLQ A;  4UVT A;  5A00 A;  5C5Q A;  3C49 A;  4L0T A;  4U6A A;  4WL8 A;  4HKK A;  5FH0 A;  4HHY A;  2RKD A;  4L7O A;  4L34 A;  4PNL A;  4BU7 A;  4UHG A;  4K4E A;  4BUX A;  4RV6 A;  4F1Q A;  3L3L A;  4UVY A;  4L10 A;  4L7L A;  4W5I A;  4TK5 A;  4BU8 A;  4I9I A;  3DT2 A;  4TJW A;  5AL4 A;  4N4V A;  4GV0 A;  5AL3 A;  5I67 A;  4L6Z A;  1NHX A;  5FPG A;  2QEW A;  4GNM A;  4HLH A;  4PJV A;  4TKG A;  4UFU A;  4HYF A;  3MHJ A;  4L09 A;  4L32 A;  4UVZ A;  4RCG A;  4GNQ A;  5ADS A;  4IUE A;  4HMH A;  2RK7 A;  4BUW A;  1AYL A;  3GN7 A;  3MOH A;  4J3M A;  4LI7 A;  2FAH A;  2RK8 A;  4HL5 A;  4R6E A;  4X52 A;  4R5W A;  3GOY A;  4W5S A;  4BS4 A;  4PNQ A;  4UI6 A;  4TJU A;  4OA7 A;  5AKW A;  4AVU A;  5ADT A;  5LYH A;  1K3C A;  3SE2 A;  4BUS A;  4UVV A;  4UND A;  1YLH A;  4BU6 A;  3DTB A;  4BU3 A;  5C5R A;  4BUF A;  1GS0 A;  2RKE A;  4HKI A;  1OEN A;  4TKF A;  4UVP A;  4L0I A;  1YTM A;  2RF5 A;  4GMU A;  4K4F A;  5AL2 A;  4UVU A;  3CE0 A;  5ADR A;  2QEY A;  4ZZZ A;  1WOK A;  5EBT A;  1UK1 A;  3FHB A;  2RCW A;  4OQA C;  2PQF A;  4BUI A;  5LX6 A;  3DT7 A;  3P0P A;  1OS1 A;  4L33 A;  4YWB A;  3SMI A;  4WPV A;  4GNL A;  4HLF A;  4GMZ A;  3UH2 A;  3MHK A;  4WIU A;  4OPX C;  3KR8 A;  4HHZ A;  4N4T A;  4TJY A;  4YW8 A;  5FH1 A;  4XHU A;  1A26 A;  4MSG A;  2FAF A;  3MOE A;  4UVW A;  1EFY A;  4UVN A;  3DT4 A;  4GMW A;  4GV2 A;  4PY4 A;  4ZZY A;  5FH3 A;  5FPF A;  4J22 A;  2ZCI A;  4BUV A;  4UFY A;  1KHF A;  4BUE A;  4KZL A;  4PJT A;  5FH4 A;  1KHB A;  4UUH A;  4BUY A;  4PNT A;  4PML A;  2PY7 X;  2RKA A;  3C4H A;  4L0V A;  2QZY A;  4UXB A;  4L70 A;  4UI7 A;  4YW9 A;  4R43 A;  4WPU A;  1KHG A;  3U9Y A;  4F0E A;  3KCZ A;  1J3B A;  4M7B A;  4UVL A;  4UW1 A;  4BJB A;  5FH5 A;  3L3M A;  3UDD A;  4BJC A;  3PAX A;  4WPT A;  4L7P A;  4GNP A;  3U9H A;  5LXP A;  4WIE A;  4J21 A;  4UI3 A;  4L7N A;  4MT9 A;  5AL1 A;  3P0Q A;  3SMJ A;  4UVX A;  1YVY A;  2PAX A;  4N3R A;  1AQ2 A;  2PAW A;  4L7R A;  4KZU A;  4F1L A;  4YWD A;  3HKV A;  3UH4 A;  4PNS A;  4UI8 A; 
#chains in the Genus database with same CATH homology
 4BUA A;  5ECE A;  4OQB C;  4HLK A;  4GV7 A;  4HLM A;  4J3L A;  4ZZX A;  4DQY C;  4TOR A;  4BU5 A;  5AL5 A;  4L2F A;  4WOU A;  4GNO A;  4PNN A;  4TKI A;  1II2 A;  1M51 A;  4KRS A;  4UI5 A;  5ADQ A;  5AKU A;  4L0S A;  4L2G A;  4MSK A;  5AEH A;  3KR7 A;  5ETY A;  4TOS A;  4BUD A;  1XKV A;  4LI6 A;  4L6S A;  1PAX A;  1UK0 A;  2OLR A;  5DCZ A;  3W51 A;  5C5P A;  4HLG A;  2QF1 A;  4DVI A;  2PXZ X;  3GJW A;  4BU9 A;  1KHE A;  4LI8 A;  5FH2 A;  3BLJ A;  4BJ9 A;  4UVS A;  4L7U A;  2QF2 A;  4L2K A;  4PNR A;  4GV4 A;  4KZQ A;  2X5Y A;  3MOF A;  4GMM A;  4UI4 A;  4UX4 A;  3KJD A;  3P0N A;  4AVW A;  1YGG A;  4PNM A;  4J1Z A;  4L0B A;  4BUT A;  4PAX A;  4UVO A;  1K3D A;  4HKN A;  4BUU A;  4TK0 A;  4L31 A;  4BFP A;  2GMV A;  2RD6 A;  4W6E A;  3UA9 A;  3GEY A;  4OX2 A;  2PC9 A;  4TVJ A;  2OLQ A;  4UVT A;  5A00 A;  5C5Q A;  3C49 A;  4L0T A;  4U6A A;  4WL8 A;  4HKK A;  5FH0 A;  4HHY A;  2RKD A;  4L7O A;  4L34 A;  4PNL A;  4BU7 A;  4UHG A;  4K4E A;  4BUX A;  4RV6 A;  4F1Q A;  3L3L A;  4UVY A;  4L10 A;  4L7L A;  4W5I A;  4TK5 A;  4BU8 A;  4I9I A;  3DT2 A;  4TJW A;  5AL4 A;  4N4V A;  4GV0 A;  5AL3 A;  5I67 A;  4L6Z A;  1NHX A;  5FPG A;  2QEW A;  4GNM A;  4HLH A;  4PJV A;  4TKG A;  4UFU A;  4HYF A;  3MHJ A;  4L09 A;  4L32 A;  4UVZ A;  4RCG A;  4GNQ A;  5ADS A;  4IUE A;  4HMH A;  2RK7 A;  4BUW A;  1AYL A;  3GN7 A;  3MOH A;  4J3M A;  4LI7 A;  2FAH A;  2RK8 A;  4HL5 A;  4R6E A;  4X52 A;  4R5W A;  3GOY A;  4W5S A;  4BS4 A;  4PNQ A;  4UI6 A;  4TJU A;  4OA7 A;  5AKW A;  4AVU A;  5ADT A;  5LYH A;  1K3C A;  3SE2 A;  4BUS A;  4UVV A;  4UND A;  1YLH A;  4BU6 A;  3DTB A;  4BU3 A;  5C5R A;  4BUF A;  1GS0 A;  2RKE A;  4HKI A;  1OEN A;  4TKF A;  4UVP A;  4L0I A;  1YTM A;  2RF5 A;  4GMU A;  4K4F A;  5AL2 A;  4UVU A;  3CE0 A;  5ADR A;  2QEY A;  4ZZZ A;  1WOK A;  5EBT A;  1UK1 A;  3FHB A;  2RCW A;  4OQA C;  2PQF A;  4BUI A;  5LX6 A;  3DT7 A;  3P0P A;  1OS1 A;  4L33 A;  4YWB A;  3SMI A;  4WPV A;  4GNL A;  4HLF A;  4GMZ A;  3UH2 A;  3MHK A;  4WIU A;  4OPX C;  3KR8 A;  4HHZ A;  4N4T A;  4TJY A;  4YW8 A;  5FH1 A;  4XHU A;  1A26 A;  4MSG A;  2FAF A;  3MOE A;  4UVW A;  1EFY A;  4UVN A;  3DT4 A;  4GMW A;  4GV2 A;  4PY4 A;  4ZZY A;  5FH3 A;  5FPF A;  4J22 A;  2ZCI A;  4BUV A;  4UFY A;  1KHF A;  4BUE A;  4KZL A;  4PJT A;  5FH4 A;  1KHB A;  4UUH A;  4BUY A;  4PNT A;  4PML A;  2PY7 X;  2RKA A;  3C4H A;  4L0V A;  2QZY A;  4UXB A;  4L70 A;  4UI7 A;  4YW9 A;  4R43 A;  4WPU A;  1KHG A;  3U9Y A;  4F0E A;  3KCZ A;  1J3B A;  4M7B A;  4UVL A;  4UW1 A;  4BJB A;  5FH5 A;  3L3M A;  3UDD A;  4BJC A;  3PAX A;  4WPT A;  4L7P A;  4GNP A;  3U9H A;  5LXP A;  4WIE A;  4J21 A;  4UI3 A;  4L7N A;  4MT9 A;  5AL1 A;  3P0Q A;  3SMJ A;  4UVX A;  1YVY A;  2PAX A;  4N3R A;  1AQ2 A;  2PAW A;  4L7R A;  4KZU A;  4F1L A;  4YWD A;  3HKV A;  3UH4 A;  4PNS A;  4UI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...