4BUUA

Crystal structure of human tankyrase 2 in complex with (4-(4-oxo-3,4- dihydroquinazolin-2-yl)phenyl)methanesulfonamide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
211
structure length
209
Chain Sequence
b'SGTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 71
structure length 209
sequence length 211
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buuA00
4L7OA 4N4TA 5LXPA 4TVJA 2RD6A 4UVPA 4UFYA 5ADTA 5LYHA 4I9IA 3U9YA 4L0TA 4BUEA 4K4FA 4L6SA 4L6ZA 4L09A 4PMLA 4TJUA 3C49A 3GOYA 4N3RA 4L0VA 1A26A 4UXBA 4BUDA 4L70A 5ADSA 3MHKA 4L7RA 3MHJA 4HHZA 4UI5A 4L7UA 3CE0A 4LI6A 4L2FA 4PAXA 4BU6A 3KR7A 5ADRA 4ZZZA 3U9HA 2PAXA 4N4VA 5FPGA 4UW1A 4BU3A 4BU5A 4R6EA 4UVTA 4HHYA 4TKGA 4UVVA 4HLKA 4HKNA 4L7NA 4TOSA 4ZZXA 4AVUA 4M7BA 4X52A 4KRSA 4HKKA 4KZQA 1PAXA 4L31A 1UK1A 4DVIA 3UDDA 1WOKA 4HLFA 4BUIA 4F0EA 4L7PA 4UVYA 4L10A 4PNMA 4OQAC 4TKIA 4TK5A 5AKUA 4W6EA 4L2KA 4BUFA 4L33A 3PAXA 2PQFA 4L0SA 3P0PA 4OA7A 2X5YA 3UH4A 4J1ZA 4J3MA 4UI3A 4BUUA 5AL1A 4TK0A 4L0BA 4U6AA 4UX4A 4BUAA 4LI7A 4UVSA 4PNSA 5ECEA 4K4EA 4TORA 4BFPA 4KZUA 5C5RA 4BS4A 4UI7A 1EFYA 4BJCA 4HL5A 3C4HA 3FHBA 5C5QA 4UHGA 4UI6A 4UFUA 4PJVA 3P0QA 3KJDA 4HLMA 4J22A 4UVLA 5FPFA 4BU8A 4PNQA 2PAWA 4OQBC 1GS0A 4J3LA 4HLHA 4UVZA 4IUEA 4UI8A 3L3MA 4XHUA 4PJTA 3SMIA 4PNLA 5AL2A 4TJYA 4W5SA 4W5IA 4F1QA 4HLGA 4RV6A 4PY4A 5ADQA 4GV4A 4UVNA 3HKVA 3GJWA 5ETYA 4OPXC 4BU7A 4UI4A 3W51A 4ZZYA 4BUVA 5LX6A 3KCZA 4BUWA 3GEYA 5A00A 4UNDA 4MT9A 4PNTA 2RF5A 3KR8A 5AEHA 3UH2A 4AVWA 4PNRA 4L32A 4HKIA 4L7LA 4BUSA 3GN7A 4GV2A 4MSKA 4UVWA 4BUXA 5AKWA 4BU9A 4HYFA 4LI8A 3SMJA 5AL5A 5EBTA 4J21A 4MSGA 4GV0A 5AL3A 4UVXA 4BUTA 4BJ9A 4HMHA 4L2GA 3BLJA 5AL4A 4UVOA 5DCZA 4BJBA 4KZLA 2RCWA 4DQYC 4PNNA 4GV7A 3SE2A 4TJWA 4UUHA 4BUYA 4TKFA 4R5WA 4L0IA 4F1LA 5C5PA 4UVUA 1UK0A 3UA9A 3P0NA 4L34A 3L3LA
chains in the Genus database with same CATH superfamily
4L7OA 2FAFA 5FH3A 1XKVA 4N4TA 5LXPA 4TVJA 2RD6A 2QF1A 4UVPA 4RCGA 4UFYA 5ADTA 5LYHA 4I9IA 3U9YA 2OLQA 4L0TA 4BUEA 4K4FA 2ZCIA 4L6SA 4GMMA 4L6ZA 3UH4A 4L09A 4PMLA 4TJUA 3C49A 3GOYA 4GNMA 4L0VA 1A26A 4N3RA 4UXBA 4BUDA 4L70A 5ADSA 3MHKA 4L7RA 3MHJA 4HHZA 4UI5A 4L7UA 3CE0A 4LI6A 4L2FA 4PAXA 5FH0A 4BU6A 3KR7A 2PXZX 3DT4A 4WIEA 4ZZZA 3U9HA 5ADRA 2PAXA 1AQ2A 4N4VA 5FH2A 5FPGA 4UW1A 4GNQA 4BU3A 1KHEA 5I67A 4BU5A 4R6EA 4UVTA 4HHYA 4TKGA 4GMUA 1AYLA 4GNLA 4HLKA 4HKNA 4UVVA 4L7NA 4TOSA 4ZZXA 4GNPA 4M7BA 4GMWA 4X52A 4KRSA 4HKKA 4AVUA 4KZQA 4YWBA 1PAXA 4L31A 1UK1A 4DVIA 3UDDA 2RKDA 1YGGA 1WOKA 4HLFA 2QF2A 4BUIA 2PY7X 1K3CA 4L7PA 4UVYA 4F0EA 4L10A 4OX2A 4PNMA 4OQAC 4TKIA 4TK5A 5AKUA 4W6EA 4L2KA 4BUFA 4L33A 3PAXA 2PQFA 4L0SA 3P0PA 4OA7A 2X5YA 4WPUA 4J1ZA 4J3MA 4UI3A 4BUUA 5AL1A 3MOEA 4TK0A 4L0BA 4U6AA 4UX4A 4BUAA 1YLHA 4LI7A 4UVSA 4PNSA 4WPVA 5ECEA 4K4EA 1KHBA 4TORA 4BFPA 4YWDA 4KZUA 5C5RA 4WPTA 4BS4A 4UI7A 1EFYA 1J3BA 4BJCA 4HL5A 2RKEA 3C4HA 3FHBA 5C5QA 4YW9A 4UHGA 4WIUA 4UI6A 4UFUA 2RK8A 3P0QA 3KJDA 4HLMA 4J22A 4PJVA 4UVLA 4R43A 3MOHA 4BU8A 5FPFA 4PNQA 2PAWA 4YW8A 1GS0A 4J3LA 4HLHA 4UVZA 4OQBC 4IUEA 1YTMA 3L3MA 4UI8A 4XHUA 5FH5A 5FH1A 1K3DA 4PJTA 3SMIA 2FAHA 2OLRA 4PNLA 5AL2A 1KHFA 4TJYA 4W5SA 4W5IA 4F1QA 3DTBA 4HLGA 4RV6A 4PY4A 5ADQA 4GV4A 4UVNA 3HKVA 3GJWA 5ETYA 4OPXC 2PC9A 4WL8A 4BU7A 2QEWA 4UI4A 3W51A 4ZZYA 5FH4A 4BUVA 3DT7A 5LX6A 3KCZA 1KHGA 4BUWA 3GEYA 5A00A 2RKAA 4UNDA 4MT9A 4PNTA 2RF5A 3KR8A 5AEHA 4GNOA 2QZYA 3UH2A 1M51A 4AVWA 4PNRA 4L32A 4HKIA 4L7LA 4BUSA 3GN7A 1II2A 4GV2A 4MSKA 4UVWA 4BUXA 4GMZA 5AKWA 4BU9A 2QEYA 4HYFA 4LI8A 3SMJA 5AL5A 5EBTA 4J21A 4MSGA 3MOFA 4GV0A 5AL3A 4UVXA 4BUTA 4BJ9A 4HMHA 4WOUA 4L2GA 3BLJA 5AL4A 4UVOA 5DCZA 4BJBA 4KZLA 2RCWA 4DQYC 4PNNA 1OS1A 4GV7A 3DT2A 1OENA 4TJWA 4UUHA 3SE2A 4BUYA 4TKFA 1NHXA 1YVYA 2RK7A 4L0IA 2GMVA 4R5WA 4UVUA 1UK0A 3UA9A 4F1LA 5C5PA 3P0NA 4L34A 3L3LA
chains in the Genus database with same CATH topology
4L7OA 2FAFA 5FH3A 1XKVA 4N4TA 5LXPA 4TVJA 2RD6A 2QF1A 4UVPA 4RCGA 4UFYA 5ADTA 5LYHA 4I9IA 3U9YA 2OLQA 4L0TA 4BUEA 4K4FA 2ZCIA 4L6SA 4GMMA 4L6ZA 3UH4A 4L09A 4PMLA 4TJUA 3C49A 3GOYA 4GNMA 4L0VA 1A26A 4N3RA 4UXBA 4BUDA 4L70A 5ADSA 3MHKA 4L7RA 3MHJA 4HHZA 4UI5A 4L7UA 3CE0A 4LI6A 4L2FA 4PAXA 5FH0A 4BU6A 3KR7A 2PXZX 3DT4A 4WIEA 4ZZZA 3U9HA 5ADRA 2PAXA 1AQ2A 4N4VA 5FH2A 5FPGA 4UW1A 4GNQA 4BU3A 1KHEA 5I67A 4BU5A 4R6EA 4UVTA 4HHYA 4TKGA 4GMUA 1AYLA 4GNLA 4HLKA 4HKNA 4UVVA 4L7NA 4TOSA 4ZZXA 4GNPA 4M7BA 4GMWA 4X52A 4KRSA 4HKKA 4AVUA 4KZQA 4YWBA 1PAXA 4L31A 1UK1A 4DVIA 3UDDA 2RKDA 1YGGA 1WOKA 4HLFA 2QF2A 4BUIA 2PY7X 1K3CA 4L7PA 4UVYA 4F0EA 4L10A 4OX2A 4PNMA 4OQAC 4TKIA 4TK5A 5AKUA 4W6EA 4L2KA 4BUFA 4L33A 3PAXA 2PQFA 4L0SA 3P0PA 4OA7A 2X5YA 4WPUA 4J1ZA 4J3MA 4UI3A 4BUUA 5AL1A 3MOEA 4TK0A 4L0BA 4U6AA 4UX4A 4BUAA 1YLHA 4LI7A 4UVSA 4PNSA 4WPVA 5ECEA 4K4EA 1KHBA 4TORA 4BFPA 4YWDA 4KZUA 5C5RA 4WPTA 4BS4A 4UI7A 1EFYA 1J3BA 4BJCA 4HL5A 2RKEA 3C4HA 3FHBA 5C5QA 4YW9A 4UHGA 4WIUA 4UI6A 4UFUA 2RK8A 3P0QA 3KJDA 4HLMA 4J22A 4PJVA 4UVLA 4R43A 3MOHA 4BU8A 5FPFA 4PNQA 2PAWA 4YW8A 1GS0A 4J3LA 4HLHA 4UVZA 4OQBC 4IUEA 1YTMA 3L3MA 4UI8A 4XHUA 5FH5A 5FH1A 1K3DA 4PJTA 3SMIA 2FAHA 2OLRA 4PNLA 5AL2A 1KHFA 4TJYA 4W5SA 4W5IA 4F1QA 3DTBA 4HLGA 4RV6A 4PY4A 5ADQA 4GV4A 4UVNA 3HKVA 3GJWA 5ETYA 4OPXC 2PC9A 4WL8A 4BU7A 2QEWA 4UI4A 3W51A 4ZZYA 5FH4A 4BUVA 3DT7A 5LX6A 3KCZA 1KHGA 4BUWA 3GEYA 5A00A 2RKAA 4UNDA 4MT9A 4PNTA 2RF5A 3KR8A 5AEHA 4GNOA 2QZYA 3UH2A 1M51A 4AVWA 4PNRA 4L32A 4HKIA 4L7LA 4BUSA 3GN7A 1II2A 4GV2A 4MSKA 4UVWA 4BUXA 4GMZA 5AKWA 4BU9A 2QEYA 4HYFA 4LI8A 3SMJA 5AL5A 5EBTA 4J21A 4MSGA 3MOFA 4GV0A 5AL3A 4UVXA 4BUTA 4BJ9A 4HMHA 4WOUA 4L2GA 3BLJA 5AL4A 4UVOA 5DCZA 4BJBA 4KZLA 2RCWA 4DQYC 4PNNA 1OS1A 4GV7A 3DT2A 1OENA 4TJWA 4UUHA 3SE2A 4BUYA 4TKFA 1NHXA 1YVYA 2RK7A 4L0IA 2GMVA 4R5WA 4UVUA 1UK0A 3UA9A 4F1LA 5C5PA 3P0NA 4L34A 3L3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L7O A;  4N4T A;  5LXP A;  4TVJ A;  2RD6 A;  4UVP A;  4UFY A;  5ADT A;  5LYH A;  4I9I A;  3U9Y A;  4L0T A;  4BUE A;  4K4F A;  4L6S A;  4L6Z A;  4L09 A;  4PML A;  4TJU A;  3C49 A;  3GOY A;  4N3R A;  4L0V A;  1A26 A;  4UXB A;  4BUD A;  4L70 A;  5ADS A;  3MHK A;  4L7R A;  3MHJ A;  4HHZ A;  4UI5 A;  4L7U A;  3CE0 A;  4LI6 A;  4L2F A;  4PAX A;  4BU6 A;  3KR7 A;  5ADR A;  4ZZZ A;  3U9H A;  2PAX A;  4N4V A;  5FPG A;  4UW1 A;  4BU3 A;  4BU5 A;  4R6E A;  4UVT A;  4HHY A;  4TKG A;  4UVV A;  4HLK A;  4HKN A;  4L7N A;  4TOS A;  4ZZX A;  4AVU A;  4M7B A;  4X52 A;  4KRS A;  4HKK A;  4KZQ A;  1PAX A;  4L31 A;  1UK1 A;  4DVI A;  3UDD A;  1WOK A;  4HLF A;  4BUI A;  4F0E A;  4L7P A;  4UVY A;  4L10 A;  4PNM A;  4OQA C;  4TKI A;  4TK5 A;  5AKU A;  4W6E A;  4L2K A;  4BUF A;  4L33 A;  3PAX A;  2PQF A;  4L0S A;  3P0P A;  4OA7 A;  2X5Y A;  3UH4 A;  4J1Z A;  4J3M A;  4UI3 A;  4BUU A;  5AL1 A;  4TK0 A;  4L0B A;  4U6A A;  4UX4 A;  4BUA A;  4LI7 A;  4UVS A;  4PNS A;  5ECE A;  4K4E A;  4TOR A;  4BFP A;  4KZU A;  5C5R A;  4BS4 A;  4UI7 A;  1EFY A;  4BJC A;  4HL5 A;  3C4H A;  3FHB A;  5C5Q A;  4UHG A;  4UI6 A;  4UFU A;  4PJV A;  3P0Q A;  3KJD A;  4HLM A;  4J22 A;  4UVL A;  5FPF A;  4BU8 A;  4PNQ A;  2PAW A;  4OQB C;  1GS0 A;  4J3L A;  4HLH A;  4UVZ A;  4IUE A;  4UI8 A;  3L3M A;  4XHU A;  4PJT A;  3SMI A;  4PNL A;  5AL2 A;  4TJY A;  4W5S A;  4W5I A;  4F1Q A;  4HLG A;  4RV6 A;  4PY4 A;  5ADQ A;  4GV4 A;  4UVN A;  3HKV A;  3GJW A;  5ETY A;  4OPX C;  4BU7 A;  4UI4 A;  3W51 A;  4ZZY A;  4BUV A;  5LX6 A;  3KCZ A;  4BUW A;  3GEY A;  5A00 A;  4UND A;  4MT9 A;  4PNT A;  2RF5 A;  3KR8 A;  5AEH A;  3UH2 A;  4AVW A;  4PNR A;  4L32 A;  4HKI A;  4L7L A;  4BUS A;  3GN7 A;  4GV2 A;  4MSK A;  4UVW A;  4BUX A;  5AKW A;  4BU9 A;  4HYF A;  4LI8 A;  3SMJ A;  5AL5 A;  5EBT A;  4J21 A;  4MSG A;  4GV0 A;  5AL3 A;  4UVX A;  4BUT A;  4BJ9 A;  4HMH A;  4L2G A;  3BLJ A;  5AL4 A;  4UVO A;  5DCZ A;  4BJB A;  4KZL A;  2RCW A;  4DQY C;  4PNN A;  4GV7 A;  3SE2 A;  4TJW A;  4UUH A;  4BUY A;  4TKF A;  4R5W A;  4L0I A;  4F1L A;  5C5P A;  4UVU A;  1UK0 A;  3UA9 A;  3P0N A;  4L34 A;  3L3L A; 
#chains in the Genus database with same CATH topology
 4L7O A;  2FAF A;  5FH3 A;  1XKV A;  4N4T A;  5LXP A;  4TVJ A;  2RD6 A;  2QF1 A;  4UVP A;  4RCG A;  4UFY A;  5ADT A;  5LYH A;  4I9I A;  3U9Y A;  2OLQ A;  4L0T A;  4BUE A;  4K4F A;  2ZCI A;  4L6S A;  4GMM A;  4L6Z A;  3UH4 A;  4L09 A;  4PML A;  4TJU A;  3C49 A;  3GOY A;  4GNM A;  4L0V A;  1A26 A;  4N3R A;  4UXB A;  4BUD A;  4L70 A;  5ADS A;  3MHK A;  4L7R A;  3MHJ A;  4HHZ A;  4UI5 A;  4L7U A;  3CE0 A;  4LI6 A;  4L2F A;  4PAX A;  5FH0 A;  4BU6 A;  3KR7 A;  2PXZ X;  3DT4 A;  4WIE A;  4ZZZ A;  3U9H A;  5ADR A;  2PAX A;  1AQ2 A;  4N4V A;  5FH2 A;  5FPG A;  4UW1 A;  4GNQ A;  4BU3 A;  1KHE A;  5I67 A;  4BU5 A;  4R6E A;  4UVT A;  4HHY A;  4TKG A;  4GMU A;  1AYL A;  4GNL A;  4HLK A;  4HKN A;  4UVV A;  4L7N A;  4TOS A;  4ZZX A;  4GNP A;  4M7B A;  4GMW A;  4X52 A;  4KRS A;  4HKK A;  4AVU A;  4KZQ A;  4YWB A;  1PAX A;  4L31 A;  1UK1 A;  4DVI A;  3UDD A;  2RKD A;  1YGG A;  1WOK A;  4HLF A;  2QF2 A;  4BUI A;  2PY7 X;  1K3C A;  4L7P A;  4UVY A;  4F0E A;  4L10 A;  4OX2 A;  4PNM A;  4OQA C;  4TKI A;  4TK5 A;  5AKU A;  4W6E A;  4L2K A;  4BUF A;  4L33 A;  3PAX A;  2PQF A;  4L0S A;  3P0P A;  4OA7 A;  2X5Y A;  4WPU A;  4J1Z A;  4J3M A;  4UI3 A;  4BUU A;  5AL1 A;  3MOE A;  4TK0 A;  4L0B A;  4U6A A;  4UX4 A;  4BUA A;  1YLH A;  4LI7 A;  4UVS A;  4PNS A;  4WPV A;  5ECE A;  4K4E A;  1KHB A;  4TOR A;  4BFP A;  4YWD A;  4KZU A;  5C5R A;  4WPT A;  4BS4 A;  4UI7 A;  1EFY A;  1J3B A;  4BJC A;  4HL5 A;  2RKE A;  3C4H A;  3FHB A;  5C5Q A;  4YW9 A;  4UHG A;  4WIU A;  4UI6 A;  4UFU A;  2RK8 A;  3P0Q A;  3KJD A;  4HLM A;  4J22 A;  4PJV A;  4UVL A;  4R43 A;  3MOH A;  4BU8 A;  5FPF A;  4PNQ A;  2PAW A;  4YW8 A;  1GS0 A;  4J3L A;  4HLH A;  4UVZ A;  4OQB C;  4IUE A;  1YTM A;  3L3M A;  4UI8 A;  4XHU A;  5FH5 A;  5FH1 A;  1K3D A;  4PJT A;  3SMI A;  2FAH A;  2OLR A;  4PNL A;  5AL2 A;  1KHF A;  4TJY A;  4W5S A;  4W5I A;  4F1Q A;  3DTB A;  4HLG A;  4RV6 A;  4PY4 A;  5ADQ A;  4GV4 A;  4UVN A;  3HKV A;  3GJW A;  5ETY A;  4OPX C;  2PC9 A;  4WL8 A;  4BU7 A;  2QEW A;  4UI4 A;  3W51 A;  4ZZY A;  5FH4 A;  4BUV A;  3DT7 A;  5LX6 A;  3KCZ A;  1KHG A;  4BUW A;  3GEY A;  5A00 A;  2RKA A;  4UND A;  4MT9 A;  4PNT A;  2RF5 A;  3KR8 A;  5AEH A;  4GNO A;  2QZY A;  3UH2 A;  1M51 A;  4AVW A;  4PNR A;  4L32 A;  4HKI A;  4L7L A;  4BUS A;  3GN7 A;  1II2 A;  4GV2 A;  4MSK A;  4UVW A;  4BUX A;  4GMZ A;  5AKW A;  4BU9 A;  2QEY A;  4HYF A;  4LI8 A;  3SMJ A;  5AL5 A;  5EBT A;  4J21 A;  4MSG A;  3MOF A;  4GV0 A;  5AL3 A;  4UVX A;  4BUT A;  4BJ9 A;  4HMH A;  4WOU A;  4L2G A;  3BLJ A;  5AL4 A;  4UVO A;  5DCZ A;  4BJB A;  4KZL A;  2RCW A;  4DQY C;  4PNN A;  1OS1 A;  4GV7 A;  3DT2 A;  1OEN A;  4TJW A;  4UUH A;  3SE2 A;  4BUY A;  4TKF A;  1NHX A;  1YVY A;  2RK7 A;  4L0I A;  2GMV A;  4R5W A;  4UVU A;  1UK0 A;  3UA9 A;  4F1L A;  5C5P A;  3P0N A;  4L34 A;  3L3L A; 
#chains in the Genus database with same CATH homology
 4L7O A;  2FAF A;  5FH3 A;  1XKV A;  4N4T A;  5LXP A;  4TVJ A;  2RD6 A;  2QF1 A;  4UVP A;  4RCG A;  4UFY A;  5ADT A;  5LYH A;  4I9I A;  3U9Y A;  2OLQ A;  4L0T A;  4BUE A;  4K4F A;  2ZCI A;  4L6S A;  4GMM A;  4L6Z A;  3UH4 A;  4L09 A;  4PML A;  4TJU A;  3C49 A;  3GOY A;  4GNM A;  4L0V A;  1A26 A;  4N3R A;  4UXB A;  4BUD A;  4L70 A;  5ADS A;  3MHK A;  4L7R A;  3MHJ A;  4HHZ A;  4UI5 A;  4L7U A;  3CE0 A;  4LI6 A;  4L2F A;  4PAX A;  5FH0 A;  4BU6 A;  3KR7 A;  2PXZ X;  3DT4 A;  4WIE A;  4ZZZ A;  3U9H A;  5ADR A;  2PAX A;  1AQ2 A;  4N4V A;  5FH2 A;  5FPG A;  4UW1 A;  4GNQ A;  4BU3 A;  1KHE A;  5I67 A;  4BU5 A;  4R6E A;  4UVT A;  4HHY A;  4TKG A;  4GMU A;  1AYL A;  4GNL A;  4HLK A;  4HKN A;  4UVV A;  4L7N A;  4TOS A;  4ZZX A;  4GNP A;  4M7B A;  4GMW A;  4X52 A;  4KRS A;  4HKK A;  4AVU A;  4KZQ A;  4YWB A;  1PAX A;  4L31 A;  1UK1 A;  4DVI A;  3UDD A;  2RKD A;  1YGG A;  1WOK A;  4HLF A;  2QF2 A;  4BUI A;  2PY7 X;  1K3C A;  4L7P A;  4UVY A;  4F0E A;  4L10 A;  4OX2 A;  4PNM A;  4OQA C;  4TKI A;  4TK5 A;  5AKU A;  4W6E A;  4L2K A;  4BUF A;  4L33 A;  3PAX A;  2PQF A;  4L0S A;  3P0P A;  4OA7 A;  2X5Y A;  4WPU A;  4J1Z A;  4J3M A;  4UI3 A;  4BUU A;  5AL1 A;  3MOE A;  4TK0 A;  4L0B A;  4U6A A;  4UX4 A;  4BUA A;  1YLH A;  4LI7 A;  4UVS A;  4PNS A;  4WPV A;  5ECE A;  4K4E A;  1KHB A;  4TOR A;  4BFP A;  4YWD A;  4KZU A;  5C5R A;  4WPT A;  4BS4 A;  4UI7 A;  1EFY A;  1J3B A;  4BJC A;  4HL5 A;  2RKE A;  3C4H A;  3FHB A;  5C5Q A;  4YW9 A;  4UHG A;  4WIU A;  4UI6 A;  4UFU A;  2RK8 A;  3P0Q A;  3KJD A;  4HLM A;  4J22 A;  4PJV A;  4UVL A;  4R43 A;  3MOH A;  4BU8 A;  5FPF A;  4PNQ A;  2PAW A;  4YW8 A;  1GS0 A;  4J3L A;  4HLH A;  4UVZ A;  4OQB C;  4IUE A;  1YTM A;  3L3M A;  4UI8 A;  4XHU A;  5FH5 A;  5FH1 A;  1K3D A;  4PJT A;  3SMI A;  2FAH A;  2OLR A;  4PNL A;  5AL2 A;  1KHF A;  4TJY A;  4W5S A;  4W5I A;  4F1Q A;  3DTB A;  4HLG A;  4RV6 A;  4PY4 A;  5ADQ A;  4GV4 A;  4UVN A;  3HKV A;  3GJW A;  5ETY A;  4OPX C;  2PC9 A;  4WL8 A;  4BU7 A;  2QEW A;  4UI4 A;  3W51 A;  4ZZY A;  5FH4 A;  4BUV A;  3DT7 A;  5LX6 A;  3KCZ A;  1KHG A;  4BUW A;  3GEY A;  5A00 A;  2RKA A;  4UND A;  4MT9 A;  4PNT A;  2RF5 A;  3KR8 A;  5AEH A;  4GNO A;  2QZY A;  3UH2 A;  1M51 A;  4AVW A;  4PNR A;  4L32 A;  4HKI A;  4L7L A;  4BUS A;  3GN7 A;  1II2 A;  4GV2 A;  4MSK A;  4UVW A;  4BUX A;  4GMZ A;  5AKW A;  4BU9 A;  2QEY A;  4HYF A;  4LI8 A;  3SMJ A;  5AL5 A;  5EBT A;  4J21 A;  4MSG A;  3MOF A;  4GV0 A;  5AL3 A;  4UVX A;  4BUT A;  4BJ9 A;  4HMH A;  4WOU A;  4L2G A;  3BLJ A;  5AL4 A;  4UVO A;  5DCZ A;  4BJB A;  4KZL A;  2RCW A;  4DQY C;  4PNN A;  1OS1 A;  4GV7 A;  3DT2 A;  1OEN A;  4TJW A;  4UUH A;  3SE2 A;  4BUY A;  4TKF A;  1NHX A;  1YVY A;  2RK7 A;  4L0I A;  2GMV A;  4R5W A;  4UVU A;  1UK0 A;  3UA9 A;  4F1L A;  5C5P A;  3P0N A;  4L34 A;  3L3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...