4BUVA

Crystal structure of human tankyrase 2 in complex with n-(4-(4-oxo-3, 4-dihydroquinazolin-2-yl)phenyl)thiophene-2-carboxamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 68
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buvA00
4HLMA 3KJDA 4BFPA 4ZZYA 4L7RA 4TK5A 4UI5A 4UX4A 4MSGA 4L0SA 4UVSA 4TK0A 3GJWA 4KZQA 4N4TA 3FHBA 4LI7A 4X52A 3C4HA 3P0PA 3UA9A 3MHJA 2X5YA 4HKIA 1A26A 3KCZA 4PNTA 5ADTA 4OQBC 4PJVA 5AKWA 4BUUA 4AVWA 5AL4A 5AL3A 4HKKA 4L33A 4PJTA 5DCZA 4BU5A 2PAXA 4UVWA 5C5QA 4L0VA 2PAWA 2PQFA 4HLHA 4IUEA 4M7BA 3P0QA 4OQAC 4F1QA 4PY4A 4HLKA 4UI7A 1WOKA 4ZZZA 4W5IA 5ADSA 1UK0A 4W6EA 5C5RA 4UFYA 4LI6A 4UVVA 4AVUA 3SMIA 4TKGA 4UVTA 5ECEA 5AL5A 4MT9A 5ETYA 4BU7A 4L32A 4L34A 4HL5A 4KZLA 4DQYC 3C49A 3KR7A 4UVZA 4HLFA 5LXPA 5ADRA 4LI8A 4UVXA 4UI8A 4L7UA 4HLGA 4BUDA 4L0TA 5AL1A 1PAXA 3L3LA 4BU8A 4J21A 4UVPA 4BS4A 4BUIA 4L0IA 4L2GA 4PNMA 4TKIA 5AL2A 3CE0A 4L09A 4U6AA 4OPXC 4BUVA 4TJYA 4UVYA 4XHUA 4J3LA 2RD6A 3GEYA 4GV7A 4J22A 3U9YA 3UH2A 4BJ9A 4BJBA 4HYFA 4RV6A 3U9HA 4TJWA 4MSKA 5AEHA 3GOYA 4BUWA 5C5PA 4PMLA 5LX6A 4HKNA 1EFYA 3P0NA 4UW1A 3UDDA 4L10A 4PNSA 3SE2A 4UI4A 4UVLA 4UVOA 3PAXA 4KZUA 4L7NA 4PNLA 3SMJA 3MHKA 4UVNA 1UK1A 4J3MA 4UI6A 4F0EA 5AKUA 4BUXA 3UH4A 4L0BA 3BLJA 4HMHA 4BU6A 4L2KA 4BUAA 4ZZXA 1GS0A 4L7LA 4L70A 4L7PA 4TJUA 4UI3A 4UVUA 4BU9A 5FPFA 4UNDA 4R6EA 3L3MA 4HHZA 5EBTA 4UUHA 3HKVA 4KRSA 4GV2A 4F1LA 4TOSA 3KR8A 4N3RA 4L7OA 4OA7A 4PAXA 4PNRA 5FPGA 4BJCA 4DVIA 4BUYA 5LYHA 4L6SA 4TORA 4TVJA 4N4VA 4L6ZA 2RF5A 3W51A 4PNQA 4BUTA 4L31A 4R5WA 4BU3A 4GV0A 4L2FA 4J1ZA 4BUFA 4GV4A 4PNNA 4UFUA 4UXBA 4HHYA 2RCWA 4BUSA 4TKFA 5A00A 4K4FA 4BUEA 4K4EA 4UHGA 5ADQA 4I9IA 3GN7A 4W5SA
chains in the Genus database with same CATH superfamily
4HLMA 3KJDA 2RKDA 4BFPA 4ZZYA 4L7RA 4TK5A 4UI5A 4UX4A 4MSGA 4L0SA 4UVSA 4TK0A 3GJWA 4KZQA 3MOFA 4RCGA 4N4TA 3FHBA 4LI7A 4GNPA 4X52A 3C4HA 3P0PA 3UA9A 3MHJA 2X5YA 4HKIA 1A26A 3KCZA 4PNTA 5ADTA 5FH5A 4PJVA 2QF1A 4OQBC 5AKWA 4BUUA 4AVWA 5AL4A 5AL3A 3DT4A 4GMUA 3DT2A 4HKKA 4L33A 1NHXA 4PJTA 4WPUA 5DCZA 4BU5A 1M51A 2PAXA 2RKAA 4UVWA 2ZCIA 4WPVA 5C5QA 2RKEA 4L0VA 2PAWA 2PQFA 4GNQA 4HLHA 4IUEA 4M7BA 3P0QA 5FH0A 4YWDA 4OQAC 4F1QA 4PY4A 2QEYA 4HLKA 1WOKA 4UI7A 3MOHA 2QF2A 4W5IA 4ZZZA 5ADSA 1UK0A 5FH3A 4W6EA 5C5RA 4GNMA 4UFYA 4LI6A 4UVVA 4AVUA 3SMIA 4TKGA 1XKVA 4UVTA 5ECEA 5AL5A 4WOUA 5C5PA 4MT9A 5ETYA 5FH2A 4BU7A 4YW9A 4L32A 4L34A 4HL5A 4KZLA 4DQYC 3C49A 3KR7A 4UVZA 4HLFA 5LXPA 5ADRA 4LI8A 4UVXA 4UI8A 4L7UA 4HLGA 4BUDA 1KHGA 4L0TA 2FAFA 5AL1A 4GMMA 1PAXA 3L3LA 2PY7X 4BU8A 4J21A 4UVPA 4BS4A 4BUIA 4L0IA 4L2GA 4PNMA 4TKIA 5AL2A 3CE0A 4L09A 4U6AA 4WIUA 4OPXC 4BUVA 4TJYA 4UVYA 4XHUA 2OLRA 5FH4A 4J3LA 2RD6A 3GEYA 4GV7A 4J22A 3U9YA 3UH2A 4BJ9A 4BJBA 4HYFA 4RV6A 3U9HA 3DTBA 4WL8A 2QEWA 4GMZA 4MSKA 3GOYA 4TJWA 5AEHA 4YWBA 4PMLA 4BUWA 4HKNA 5LX6A 1EFYA 3P0NA 4UW1A 3UDDA 1OENA 4L10A 4PNSA 3SE2A 4GNOA 1II2A 4UI4A 4UVLA 3PAXA 4KZUA 4UVOA 4R43A 4L7NA 4PNLA 5I67A 3SMJA 2PXZX 3MHKA 4UVNA 1UK1A 4J3MA 1YTMA 4UI6A 4WIEA 5AKUA 4BUXA 3UH4A 4F0EA 4L0BA 3BLJA 4HMHA 4BU6A 4GMWA 4L2KA 4BUAA 4ZZXA 1GS0A 2RK8A 4L70A 4L7PA 4L7LA 4TJUA 4UI3A 4UVUA 4BU9A 5FPFA 1J3BA 2QZYA 4UNDA 4R6EA 1OS1A 2FAHA 3L3MA 4HHZA 5EBTA 4UUHA 3HKVA 4KRSA 1YLHA 4GV2A 4TOSA 3KR8A 4F1LA 4N3RA 1K3CA 1KHFA 5FH1A 4L7OA 3DT7A 4OA7A 4OX2A 4PAXA 4PNRA 4YW8A 5FPGA 4BJCA 4DVIA 4BUYA 4GNLA 4L6SA 5LYHA 4TORA 1AQ2A 4TVJA 4N4VA 4L6ZA 1KHEA 2RF5A 2RK7A 1YGGA 3W51A 1K3DA 4PNQA 4BUTA 4L31A 4R5WA 4BU3A 4GV0A 1KHBA 4J1ZA 4L2FA 4GV4A 4BUFA 1YVYA 4PNNA 4UFUA 4UXBA 4HHYA 2RCWA 4BUSA 2OLQA 4WPTA 3MOEA 4TKFA 5A00A 1AYLA 2GMVA 2PC9A 4K4FA 4BUEA 4K4EA 4UHGA 5ADQA 4I9IA 3GN7A 4W5SA
chains in the Genus database with same CATH topology
4HLMA 3KJDA 2RKDA 4BFPA 4ZZYA 4L7RA 4TK5A 4UI5A 4UX4A 4MSGA 4L0SA 4UVSA 4TK0A 3GJWA 4KZQA 3MOFA 4RCGA 4N4TA 3FHBA 4LI7A 4GNPA 4X52A 3C4HA 3P0PA 3UA9A 3MHJA 2X5YA 4HKIA 1A26A 3KCZA 4PNTA 5ADTA 5FH5A 4PJVA 2QF1A 4OQBC 5AKWA 4BUUA 4AVWA 5AL4A 5AL3A 3DT4A 4GMUA 3DT2A 4HKKA 4L33A 1NHXA 4PJTA 4WPUA 5DCZA 4BU5A 1M51A 2PAXA 2RKAA 4UVWA 2ZCIA 4WPVA 5C5QA 2RKEA 4L0VA 2PAWA 2PQFA 4GNQA 4HLHA 4IUEA 4M7BA 3P0QA 5FH0A 4YWDA 4OQAC 4F1QA 4PY4A 2QEYA 4HLKA 1WOKA 4UI7A 3MOHA 2QF2A 4W5IA 4ZZZA 5ADSA 1UK0A 5FH3A 4W6EA 5C5RA 4GNMA 4UFYA 4LI6A 4UVVA 4AVUA 3SMIA 4TKGA 1XKVA 4UVTA 5ECEA 5AL5A 4WOUA 5C5PA 4MT9A 5ETYA 5FH2A 4BU7A 4YW9A 4L32A 4L34A 4HL5A 4KZLA 4DQYC 3C49A 3KR7A 4UVZA 4HLFA 5LXPA 5ADRA 4LI8A 4UVXA 4UI8A 4L7UA 4HLGA 4BUDA 1KHGA 4L0TA 2FAFA 5AL1A 4GMMA 1PAXA 3L3LA 2PY7X 4BU8A 4J21A 4UVPA 4BS4A 4BUIA 4L0IA 4L2GA 4PNMA 4TKIA 5AL2A 3CE0A 4L09A 4U6AA 4WIUA 4OPXC 4BUVA 4TJYA 4UVYA 4XHUA 2OLRA 5FH4A 4J3LA 2RD6A 3GEYA 4GV7A 4J22A 3U9YA 3UH2A 4BJ9A 4BJBA 4HYFA 4RV6A 3U9HA 3DTBA 4WL8A 2QEWA 4GMZA 4MSKA 3GOYA 4TJWA 5AEHA 4YWBA 4PMLA 4BUWA 4HKNA 5LX6A 1EFYA 3P0NA 4UW1A 3UDDA 1OENA 4L10A 4PNSA 3SE2A 4GNOA 1II2A 4UI4A 4UVLA 3PAXA 4KZUA 4UVOA 4R43A 4L7NA 4PNLA 5I67A 3SMJA 2PXZX 3MHKA 4UVNA 1UK1A 4J3MA 1YTMA 4UI6A 4WIEA 5AKUA 4BUXA 3UH4A 4F0EA 4L0BA 3BLJA 4HMHA 4BU6A 4GMWA 4L2KA 4BUAA 4ZZXA 1GS0A 2RK8A 4L70A 4L7PA 4L7LA 4TJUA 4UI3A 4UVUA 4BU9A 5FPFA 1J3BA 2QZYA 4UNDA 4R6EA 1OS1A 2FAHA 3L3MA 4HHZA 5EBTA 4UUHA 3HKVA 4KRSA 1YLHA 4GV2A 4TOSA 3KR8A 4F1LA 4N3RA 1K3CA 1KHFA 5FH1A 4L7OA 3DT7A 4OA7A 4OX2A 4PAXA 4PNRA 4YW8A 5FPGA 4BJCA 4DVIA 4BUYA 4GNLA 4L6SA 5LYHA 4TORA 1AQ2A 4TVJA 4N4VA 4L6ZA 1KHEA 2RF5A 2RK7A 1YGGA 3W51A 1K3DA 4PNQA 4BUTA 4L31A 4R5WA 4BU3A 4GV0A 1KHBA 4J1ZA 4L2FA 4GV4A 4BUFA 1YVYA 4PNNA 4UFUA 4UXBA 4HHYA 2RCWA 4BUSA 2OLQA 4WPTA 3MOEA 4TKFA 5A00A 1AYLA 2GMVA 2PC9A 4K4FA 4BUEA 4K4EA 4UHGA 5ADQA 4I9IA 3GN7A 4W5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HLM A;  3KJD A;  4BFP A;  4ZZY A;  4L7R A;  4TK5 A;  4UI5 A;  4UX4 A;  4MSG A;  4L0S A;  4UVS A;  4TK0 A;  3GJW A;  4KZQ A;  4N4T A;  3FHB A;  4LI7 A;  4X52 A;  3C4H A;  3P0P A;  3UA9 A;  3MHJ A;  2X5Y A;  4HKI A;  1A26 A;  3KCZ A;  4PNT A;  5ADT A;  4OQB C;  4PJV A;  5AKW A;  4BUU A;  4AVW A;  5AL4 A;  5AL3 A;  4HKK A;  4L33 A;  4PJT A;  5DCZ A;  4BU5 A;  2PAX A;  4UVW A;  5C5Q A;  4L0V A;  2PAW A;  2PQF A;  4HLH A;  4IUE A;  4M7B A;  3P0Q A;  4OQA C;  4F1Q A;  4PY4 A;  4HLK A;  4UI7 A;  1WOK A;  4ZZZ A;  4W5I A;  5ADS A;  1UK0 A;  4W6E A;  5C5R A;  4UFY A;  4LI6 A;  4UVV A;  4AVU A;  3SMI A;  4TKG A;  4UVT A;  5ECE A;  5AL5 A;  4MT9 A;  5ETY A;  4BU7 A;  4L32 A;  4L34 A;  4HL5 A;  4KZL A;  4DQY C;  3C49 A;  3KR7 A;  4UVZ A;  4HLF A;  5LXP A;  5ADR A;  4LI8 A;  4UVX A;  4UI8 A;  4L7U A;  4HLG A;  4BUD A;  4L0T A;  5AL1 A;  1PAX A;  3L3L A;  4BU8 A;  4J21 A;  4UVP A;  4BS4 A;  4BUI A;  4L0I A;  4L2G A;  4PNM A;  4TKI A;  5AL2 A;  3CE0 A;  4L09 A;  4U6A A;  4OPX C;  4BUV A;  4TJY A;  4UVY A;  4XHU A;  4J3L A;  2RD6 A;  3GEY A;  4GV7 A;  4J22 A;  3U9Y A;  3UH2 A;  4BJ9 A;  4BJB A;  4HYF A;  4RV6 A;  3U9H A;  4TJW A;  4MSK A;  5AEH A;  3GOY A;  4BUW A;  5C5P A;  4PML A;  5LX6 A;  4HKN A;  1EFY A;  3P0N A;  4UW1 A;  3UDD A;  4L10 A;  4PNS A;  3SE2 A;  4UI4 A;  4UVL A;  4UVO A;  3PAX A;  4KZU A;  4L7N A;  4PNL A;  3SMJ A;  3MHK A;  4UVN A;  1UK1 A;  4J3M A;  4UI6 A;  4F0E A;  5AKU A;  4BUX A;  3UH4 A;  4L0B A;  3BLJ A;  4HMH A;  4BU6 A;  4L2K A;  4BUA A;  4ZZX A;  1GS0 A;  4L7L A;  4L70 A;  4L7P A;  4TJU A;  4UI3 A;  4UVU A;  4BU9 A;  5FPF A;  4UND A;  4R6E A;  3L3M A;  4HHZ A;  5EBT A;  4UUH A;  3HKV A;  4KRS A;  4GV2 A;  4F1L A;  4TOS A;  3KR8 A;  4N3R A;  4L7O A;  4OA7 A;  4PAX A;  4PNR A;  5FPG A;  4BJC A;  4DVI A;  4BUY A;  5LYH A;  4L6S A;  4TOR A;  4TVJ A;  4N4V A;  4L6Z A;  2RF5 A;  3W51 A;  4PNQ A;  4BUT A;  4L31 A;  4R5W A;  4BU3 A;  4GV0 A;  4L2F A;  4J1Z A;  4BUF A;  4GV4 A;  4PNN A;  4UFU A;  4UXB A;  4HHY A;  2RCW A;  4BUS A;  4TKF A;  5A00 A;  4K4F A;  4BUE A;  4K4E A;  4UHG A;  5ADQ A;  4I9I A;  3GN7 A;  4W5S A; 
#chains in the Genus database with same CATH topology
 4HLM A;  3KJD A;  2RKD A;  4BFP A;  4ZZY A;  4L7R A;  4TK5 A;  4UI5 A;  4UX4 A;  4MSG A;  4L0S A;  4UVS A;  4TK0 A;  3GJW A;  4KZQ A;  3MOF A;  4RCG A;  4N4T A;  3FHB A;  4LI7 A;  4GNP A;  4X52 A;  3C4H A;  3P0P A;  3UA9 A;  3MHJ A;  2X5Y A;  4HKI A;  1A26 A;  3KCZ A;  4PNT A;  5ADT A;  5FH5 A;  4PJV A;  2QF1 A;  4OQB C;  5AKW A;  4BUU A;  4AVW A;  5AL4 A;  5AL3 A;  3DT4 A;  4GMU A;  3DT2 A;  4HKK A;  4L33 A;  1NHX A;  4PJT A;  4WPU A;  5DCZ A;  4BU5 A;  1M51 A;  2PAX A;  2RKA A;  4UVW A;  2ZCI A;  4WPV A;  5C5Q A;  2RKE A;  4L0V A;  2PAW A;  2PQF A;  4GNQ A;  4HLH A;  4IUE A;  4M7B A;  3P0Q A;  5FH0 A;  4YWD A;  4OQA C;  4F1Q A;  4PY4 A;  2QEY A;  4HLK A;  1WOK A;  4UI7 A;  3MOH A;  2QF2 A;  4W5I A;  4ZZZ A;  5ADS A;  1UK0 A;  5FH3 A;  4W6E A;  5C5R A;  4GNM A;  4UFY A;  4LI6 A;  4UVV A;  4AVU A;  3SMI A;  4TKG A;  1XKV A;  4UVT A;  5ECE A;  5AL5 A;  4WOU A;  5C5P A;  4MT9 A;  5ETY A;  5FH2 A;  4BU7 A;  4YW9 A;  4L32 A;  4L34 A;  4HL5 A;  4KZL A;  4DQY C;  3C49 A;  3KR7 A;  4UVZ A;  4HLF A;  5LXP A;  5ADR A;  4LI8 A;  4UVX A;  4UI8 A;  4L7U A;  4HLG A;  4BUD A;  1KHG A;  4L0T A;  2FAF A;  5AL1 A;  4GMM A;  1PAX A;  3L3L A;  2PY7 X;  4BU8 A;  4J21 A;  4UVP A;  4BS4 A;  4BUI A;  4L0I A;  4L2G A;  4PNM A;  4TKI A;  5AL2 A;  3CE0 A;  4L09 A;  4U6A A;  4WIU A;  4OPX C;  4BUV A;  4TJY A;  4UVY A;  4XHU A;  2OLR A;  5FH4 A;  4J3L A;  2RD6 A;  3GEY A;  4GV7 A;  4J22 A;  3U9Y A;  3UH2 A;  4BJ9 A;  4BJB A;  4HYF A;  4RV6 A;  3U9H A;  3DTB A;  4WL8 A;  2QEW A;  4GMZ A;  4MSK A;  3GOY A;  4TJW A;  5AEH A;  4YWB A;  4PML A;  4BUW A;  4HKN A;  5LX6 A;  1EFY A;  3P0N A;  4UW1 A;  3UDD A;  1OEN A;  4L10 A;  4PNS A;  3SE2 A;  4GNO A;  1II2 A;  4UI4 A;  4UVL A;  3PAX A;  4KZU A;  4UVO A;  4R43 A;  4L7N A;  4PNL A;  5I67 A;  3SMJ A;  2PXZ X;  3MHK A;  4UVN A;  1UK1 A;  4J3M A;  1YTM A;  4UI6 A;  4WIE A;  5AKU A;  4BUX A;  3UH4 A;  4F0E A;  4L0B A;  3BLJ A;  4HMH A;  4BU6 A;  4GMW A;  4L2K A;  4BUA A;  4ZZX A;  1GS0 A;  2RK8 A;  4L70 A;  4L7P A;  4L7L A;  4TJU A;  4UI3 A;  4UVU A;  4BU9 A;  5FPF A;  1J3B A;  2QZY A;  4UND A;  4R6E A;  1OS1 A;  2FAH A;  3L3M A;  4HHZ A;  5EBT A;  4UUH A;  3HKV A;  4KRS A;  1YLH A;  4GV2 A;  4TOS A;  3KR8 A;  4F1L A;  4N3R A;  1K3C A;  1KHF A;  5FH1 A;  4L7O A;  3DT7 A;  4OA7 A;  4OX2 A;  4PAX A;  4PNR A;  4YW8 A;  5FPG A;  4BJC A;  4DVI A;  4BUY A;  4GNL A;  4L6S A;  5LYH A;  4TOR A;  1AQ2 A;  4TVJ A;  4N4V A;  4L6Z A;  1KHE A;  2RF5 A;  2RK7 A;  1YGG A;  3W51 A;  1K3D A;  4PNQ A;  4BUT A;  4L31 A;  4R5W A;  4BU3 A;  4GV0 A;  1KHB A;  4J1Z A;  4L2F A;  4GV4 A;  4BUF A;  1YVY A;  4PNN A;  4UFU A;  4UXB A;  4HHY A;  2RCW A;  4BUS A;  2OLQ A;  4WPT A;  3MOE A;  4TKF A;  5A00 A;  1AYL A;  2GMV A;  2PC9 A;  4K4F A;  4BUE A;  4K4E A;  4UHG A;  5ADQ A;  4I9I A;  3GN7 A;  4W5S A; 
#chains in the Genus database with same CATH homology
 4HLM A;  3KJD A;  2RKD A;  4BFP A;  4ZZY A;  4L7R A;  4TK5 A;  4UI5 A;  4UX4 A;  4MSG A;  4L0S A;  4UVS A;  4TK0 A;  3GJW A;  4KZQ A;  3MOF A;  4RCG A;  4N4T A;  3FHB A;  4LI7 A;  4GNP A;  4X52 A;  3C4H A;  3P0P A;  3UA9 A;  3MHJ A;  2X5Y A;  4HKI A;  1A26 A;  3KCZ A;  4PNT A;  5ADT A;  5FH5 A;  4PJV A;  2QF1 A;  4OQB C;  5AKW A;  4BUU A;  4AVW A;  5AL4 A;  5AL3 A;  3DT4 A;  4GMU A;  3DT2 A;  4HKK A;  4L33 A;  1NHX A;  4PJT A;  4WPU A;  5DCZ A;  4BU5 A;  1M51 A;  2PAX A;  2RKA A;  4UVW A;  2ZCI A;  4WPV A;  5C5Q A;  2RKE A;  4L0V A;  2PAW A;  2PQF A;  4GNQ A;  4HLH A;  4IUE A;  4M7B A;  3P0Q A;  5FH0 A;  4YWD A;  4OQA C;  4F1Q A;  4PY4 A;  2QEY A;  4HLK A;  1WOK A;  4UI7 A;  3MOH A;  2QF2 A;  4W5I A;  4ZZZ A;  5ADS A;  1UK0 A;  5FH3 A;  4W6E A;  5C5R A;  4GNM A;  4UFY A;  4LI6 A;  4UVV A;  4AVU A;  3SMI A;  4TKG A;  1XKV A;  4UVT A;  5ECE A;  5AL5 A;  4WOU A;  5C5P A;  4MT9 A;  5ETY A;  5FH2 A;  4BU7 A;  4YW9 A;  4L32 A;  4L34 A;  4HL5 A;  4KZL A;  4DQY C;  3C49 A;  3KR7 A;  4UVZ A;  4HLF A;  5LXP A;  5ADR A;  4LI8 A;  4UVX A;  4UI8 A;  4L7U A;  4HLG A;  4BUD A;  1KHG A;  4L0T A;  2FAF A;  5AL1 A;  4GMM A;  1PAX A;  3L3L A;  2PY7 X;  4BU8 A;  4J21 A;  4UVP A;  4BS4 A;  4BUI A;  4L0I A;  4L2G A;  4PNM A;  4TKI A;  5AL2 A;  3CE0 A;  4L09 A;  4U6A A;  4WIU A;  4OPX C;  4BUV A;  4TJY A;  4UVY A;  4XHU A;  2OLR A;  5FH4 A;  4J3L A;  2RD6 A;  3GEY A;  4GV7 A;  4J22 A;  3U9Y A;  3UH2 A;  4BJ9 A;  4BJB A;  4HYF A;  4RV6 A;  3U9H A;  3DTB A;  4WL8 A;  2QEW A;  4GMZ A;  4MSK A;  3GOY A;  4TJW A;  5AEH A;  4YWB A;  4PML A;  4BUW A;  4HKN A;  5LX6 A;  1EFY A;  3P0N A;  4UW1 A;  3UDD A;  1OEN A;  4L10 A;  4PNS A;  3SE2 A;  4GNO A;  1II2 A;  4UI4 A;  4UVL A;  3PAX A;  4KZU A;  4UVO A;  4R43 A;  4L7N A;  4PNL A;  5I67 A;  3SMJ A;  2PXZ X;  3MHK A;  4UVN A;  1UK1 A;  4J3M A;  1YTM A;  4UI6 A;  4WIE A;  5AKU A;  4BUX A;  3UH4 A;  4F0E A;  4L0B A;  3BLJ A;  4HMH A;  4BU6 A;  4GMW A;  4L2K A;  4BUA A;  4ZZX A;  1GS0 A;  2RK8 A;  4L70 A;  4L7P A;  4L7L A;  4TJU A;  4UI3 A;  4UVU A;  4BU9 A;  5FPF A;  1J3B A;  2QZY A;  4UND A;  4R6E A;  1OS1 A;  2FAH A;  3L3M A;  4HHZ A;  5EBT A;  4UUH A;  3HKV A;  4KRS A;  1YLH A;  4GV2 A;  4TOS A;  3KR8 A;  4F1L A;  4N3R A;  1K3C A;  1KHF A;  5FH1 A;  4L7O A;  3DT7 A;  4OA7 A;  4OX2 A;  4PAX A;  4PNR A;  4YW8 A;  5FPG A;  4BJC A;  4DVI A;  4BUY A;  4GNL A;  4L6S A;  5LYH A;  4TOR A;  1AQ2 A;  4TVJ A;  4N4V A;  4L6Z A;  1KHE A;  2RF5 A;  2RK7 A;  1YGG A;  3W51 A;  1K3D A;  4PNQ A;  4BUT A;  4L31 A;  4R5W A;  4BU3 A;  4GV0 A;  1KHB A;  4J1Z A;  4L2F A;  4GV4 A;  4BUF A;  1YVY A;  4PNN A;  4UFU A;  4UXB A;  4HHY A;  2RCW A;  4BUS A;  2OLQ A;  4WPT A;  3MOE A;  4TKF A;  5A00 A;  1AYL A;  2GMV A;  2PC9 A;  4K4F A;  4BUE A;  4K4E A;  4UHG A;  5ADQ A;  4I9I A;  3GN7 A;  4W5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...