4BUVA

Crystal structure of human tankyrase 2 in complex with n-(4-(4-oxo-3, 4-dihydroquinazolin-2-yl)phenyl)thiophene-2-carboxamide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buvA00
5LXPA 4UI5A 3UA9A 2X5YA 4L0IA 3SMJA 4L0TA 4OQAC 4UXBA 4W5IA 4BUAA 2RCWA 4L7PA 2RF5A 4L7LA 4K4FA 4L0VA 4PNNA 3GOYA 5ECEA 4PNMA 1PAXA 1UK1A 4UVZA 4UX4A 1A26A 2PQFA 4OQBC 4F1LA 4PNLA 5ADSA 5FPFA 4BU8A 4UVSA 4HLHA 3KR7A 4PAXA 4L0BA 4TOSA 4AVUA 4TVJA 4UVLA 4L7RA 4BUYA 4BUEA 4BJCA 4F1QA 4PY4A 4XHUA 4L2FA 4GV7A 3MHJA 2PAXA 4PJTA 4UVWA 4L6SA 4BUSA 4L2GA 4ZZXA 4BUTA 4BUXA 4UI6A 4DQYC 5C5QA 3UDDA 5ADRA 4ZZYA 3L3MA 4HHYA 4BUVA 3UH4A 5EBTA 4L0SA 4KZLA 3KCZA 4TKGA 4HLGA 4L70A 4HHZA 4UI8A 4W5SA 3GN7A 3U9YA 4HYFA 3FHBA 4J3LA 4UVPA 3W51A 4UNDA 3P0NA 4GV4A 4OPXC 5AL4A 4UVNA 4BJ9A 4UI4A 3KR8A 4DVIA 3L3LA 1GS0A 4L7NA 4BU9A 4L7OA 4HLMA 5AKUA 4UFUA 4BJBA 3UH2A 4RV6A 5ADQA 4J22A 4PMLA 4R5WA 4I9IA 4HKNA 4UI3A 4PNRA 3C49A 4N3RA 4K4EA 4BS4A 4TJUA 4W6EA 4BU6A 4ZZZA 4BUUA 4HL5A 4TJYA 3SE2A 4HMHA 4TJWA 5DCZA 4TK0A 4L10A 3MHKA 5LYHA 4OA7A 4PNQA 3GJWA 3CE0A 4BU5A 4J1ZA 4UVXA 4X52A 4TORA 2RD6A 3GEYA 5AL3A 4R6EA 4UVYA 4L6ZA 4UVUA 5C5RA 4UVVA 4UHGA 4TKIA 1UK0A 4N4TA 5ADTA 4MSGA 4BFPA 4HLKA 4MSKA 4N4VA 4LI6A 4PJVA 4L09A 4UI7A 4L32A 4LI7A 4UUHA 5A00A 4TKFA 5AL2A 4BU7A 2PAWA 4GV0A 4L7UA 1WOKA 4UVOA 5ETYA 3U9HA 5LX6A 4MT9A 4HKKA 3P0PA 3C4HA 4U6AA 4L2KA 4F0EA 4GV2A 4PNSA 1EFYA 4AVWA 4IUEA 4KZQA 4M7BA 4UVTA 5FPGA 5AEHA 4BUIA 4BUDA 4PNTA 3SMIA 3KJDA 5AL5A 5AL1A 3P0QA 5C5PA 5AKWA 4L33A 4KRSA 4HKIA 4UW1A 4TK5A 3HKVA 4LI8A 4L31A 3BLJA 3PAXA 4L34A 4J21A 4BU3A 4J3MA 4UFYA 4BUWA 4BUFA 4KZUA 4HLFA
chains in the Genus database with same CATH superfamily
2RKEA 5LXPA 4UI5A 2RKDA 3UA9A 4WL8A 2X5YA 4L0IA 3SMJA 4L0TA 4OQAC 4UXBA 5FH1A 4W5IA 4BUAA 2RCWA 4GNPA 4L7PA 4YWBA 2PC9A 2RF5A 4L7LA 4K4FA 4L0VA 4PNNA 3GOYA 5ECEA 2OLQA 1PAXA 1UK1A 4GMZA 4PNMA 4UVZA 4UX4A 1A26A 2PQFA 3DT4A 4GNOA 4OQBC 4F1LA 2RKAA 4PNLA 5ADSA 1J3BA 5FPFA 4BU8A 1KHFA 4UVSA 2QEWA 4HLHA 3KR7A 4PAXA 4L0BA 4WIEA 5FH5A 4TOSA 4AVUA 4GNQA 2ZCIA 4TVJA 4GMUA 4UVLA 2QEYA 4L7RA 4BUYA 4BUEA 1YGGA 4BJCA 4F1QA 3DT2A 2GMVA 4PY4A 4XHUA 4L2FA 4GV7A 1K3CA 2PAXA 3MHJA 4PJTA 4L6SA 4UVWA 4L2GA 4ZZXA 4BUSA 4BUXA 4UI6A 4WIUA 4DQYC 5C5QA 3MOEA 3UDDA 5ADRA 4ZZYA 3L3MA 4HHYA 4BUVA 3MOFA 4WPTA 3UH4A 5EBTA 4L0SA 4GNMA 3KCZA 4KZLA 4TKGA 3DT7A 4HLGA 4L70A 4HHZA 1XKVA 4UI8A 4W5SA 4YW8A 3GN7A 3U9YA 2RK8A 4HYFA 3FHBA 4J3LA 4UVPA 3W51A 4UNDA 1M51A 2FAFA 3P0NA 1KHGA 4GV4A 5AL4A 4UVNA 1NHXA 4BJ9A 4OPXC 4UI4A 3KR8A 4DVIA 3L3LA 1GS0A 4L7NA 4BU9A 4L7OA 4HLMA 5AKUA 4UFUA 4BJBA 3UH2A 4RV6A 5ADQA 4J22A 4PMLA 4R5WA 4I9IA 4HKNA 1YLHA 4UI3A 5FH4A 4PNRA 3C49A 4N3RA 4WOUA 4K4EA 4BS4A 4TJUA 4YWDA 2QF1A 3MOHA 4W6EA 4BU6A 4ZZZA 4BUUA 1OENA 4HL5A 4TJYA 3SE2A 4HMHA 1AYLA 4TJWA 5DCZA 4TK0A 4GMMA 4L10A 2QZYA 3MHKA 3DTBA 5LYHA 1KHEA 5I67A 4OA7A 4PNQA 3GJWA 3CE0A 4BU5A 4J1ZA 4UVXA 4X52A 1YTMA 4TORA 2RD6A 3GEYA 5AL3A 4R6EA 4UVYA 4L6ZA 4R43A 4UVUA 5C5RA 2PXZX 4UVVA 4UHGA 4TKIA 1UK0A 4GNLA 4N4TA 4MSGA 5FH2A 5ADTA 4BFPA 4HLKA 4MSKA 4N4VA 4LI6A 4PJVA 4L09A 4RCGA 4UI7A 4L32A 4LI7A 4UUHA 5A00A 4TKFA 5AL2A 4BU7A 2PAWA 4GV0A 4L7UA 1WOKA 4UVOA 5ETYA 3U9HA 4BUTA 5LX6A 4MT9A 4HKKA 3P0PA 3C4HA 1II2A 4L2KA 4U6AA 4F0EA 4GV2A 4PNSA 1EFYA 5FH3A 5FH0A 4AVWA 4IUEA 4KZQA 4M7BA 4UVTA 1YVYA 5FPGA 5AEHA 4BUIA 4PNTA 4BUDA 3SMIA 3KJDA 2OLRA 5AL5A 5AL1A 3P0QA 4WPUA 5C5PA 5AKWA 4L33A 4KRSA 1AQ2A 4HKIA 4UW1A 4TK5A 1K3DA 3HKVA 2FAHA 1KHBA 2QF2A 4L31A 4LI8A 1OS1A 3BLJA 3PAXA 4GMWA 4WPVA 4OX2A 4L34A 4J21A 2PY7X 4J3MA 4UFYA 4BU3A 4BUWA 4YW9A 4KZUA 2RK7A 4BUFA 4HLFA
chains in the Genus database with same CATH topology
2RKEA 5LXPA 4UI5A 2RKDA 3UA9A 4WL8A 2X5YA 4L0IA 3SMJA 4L0TA 4OQAC 4UXBA 5FH1A 4W5IA 4BUAA 2RCWA 4GNPA 4L7PA 4YWBA 2PC9A 2RF5A 4L7LA 4K4FA 4L0VA 4PNNA 3GOYA 5ECEA 2OLQA 1PAXA 1UK1A 4GMZA 4PNMA 4UVZA 4UX4A 1A26A 2PQFA 3DT4A 4GNOA 4OQBC 4F1LA 2RKAA 4PNLA 5ADSA 1J3BA 5FPFA 4BU8A 1KHFA 4UVSA 2QEWA 4HLHA 3KR7A 4PAXA 4L0BA 4WIEA 5FH5A 4TOSA 4AVUA 4GNQA 2ZCIA 4TVJA 4GMUA 4UVLA 2QEYA 4L7RA 4BUYA 4BUEA 1YGGA 4BJCA 4F1QA 3DT2A 2GMVA 4PY4A 4XHUA 4L2FA 4GV7A 1K3CA 2PAXA 3MHJA 4PJTA 4L6SA 4UVWA 4L2GA 4ZZXA 4BUSA 4BUXA 4UI6A 4WIUA 4DQYC 5C5QA 3MOEA 3UDDA 5ADRA 4ZZYA 3L3MA 4HHYA 4BUVA 3MOFA 4WPTA 3UH4A 5EBTA 4L0SA 4GNMA 3KCZA 4KZLA 4TKGA 3DT7A 4HLGA 4L70A 4HHZA 1XKVA 4UI8A 4W5SA 4YW8A 3GN7A 3U9YA 2RK8A 4HYFA 3FHBA 4J3LA 4UVPA 3W51A 4UNDA 1M51A 2FAFA 3P0NA 1KHGA 4GV4A 5AL4A 4UVNA 1NHXA 4BJ9A 4OPXC 4UI4A 3KR8A 4DVIA 3L3LA 1GS0A 4L7NA 4BU9A 4L7OA 4HLMA 5AKUA 4UFUA 4BJBA 3UH2A 4RV6A 5ADQA 4J22A 4PMLA 4R5WA 4I9IA 4HKNA 1YLHA 4UI3A 5FH4A 4PNRA 3C49A 4N3RA 4WOUA 4K4EA 4BS4A 4TJUA 4YWDA 2QF1A 3MOHA 4W6EA 4BU6A 4ZZZA 4BUUA 1OENA 4HL5A 4TJYA 3SE2A 4HMHA 1AYLA 4TJWA 5DCZA 4TK0A 4GMMA 4L10A 2QZYA 3MHKA 3DTBA 5LYHA 1KHEA 5I67A 4OA7A 4PNQA 3GJWA 3CE0A 4BU5A 4J1ZA 4UVXA 4X52A 1YTMA 4TORA 2RD6A 3GEYA 5AL3A 4R6EA 4UVYA 4L6ZA 4R43A 4UVUA 5C5RA 2PXZX 4UVVA 4UHGA 4TKIA 1UK0A 4GNLA 4N4TA 4MSGA 5FH2A 5ADTA 4BFPA 4HLKA 4MSKA 4N4VA 4LI6A 4PJVA 4L09A 4RCGA 4UI7A 4L32A 4LI7A 4UUHA 5A00A 4TKFA 5AL2A 4BU7A 2PAWA 4GV0A 4L7UA 1WOKA 4UVOA 5ETYA 3U9HA 4BUTA 5LX6A 4MT9A 4HKKA 3P0PA 3C4HA 1II2A 4L2KA 4U6AA 4F0EA 4GV2A 4PNSA 1EFYA 5FH3A 5FH0A 4AVWA 4IUEA 4KZQA 4M7BA 4UVTA 1YVYA 5FPGA 5AEHA 4BUIA 4PNTA 4BUDA 3SMIA 3KJDA 2OLRA 5AL5A 5AL1A 3P0QA 4WPUA 5C5PA 5AKWA 4L33A 4KRSA 1AQ2A 4HKIA 4UW1A 4TK5A 1K3DA 3HKVA 2FAHA 1KHBA 2QF2A 4L31A 4LI8A 1OS1A 3BLJA 3PAXA 4GMWA 4WPVA 4OX2A 4L34A 4J21A 2PY7X 4J3MA 4UFYA 4BU3A 4BUWA 4YW9A 4KZUA 2RK7A 4BUFA 4HLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LXP A;  4UI5 A;  3UA9 A;  2X5Y A;  4L0I A;  3SMJ A;  4L0T A;  4OQA C;  4UXB A;  4W5I A;  4BUA A;  2RCW A;  4L7P A;  2RF5 A;  4L7L A;  4K4F A;  4L0V A;  4PNN A;  3GOY A;  5ECE A;  4PNM A;  1PAX A;  1UK1 A;  4UVZ A;  4UX4 A;  1A26 A;  2PQF A;  4OQB C;  4F1L A;  4PNL A;  5ADS A;  5FPF A;  4BU8 A;  4UVS A;  4HLH A;  3KR7 A;  4PAX A;  4L0B A;  4TOS A;  4AVU A;  4TVJ A;  4UVL A;  4L7R A;  4BUY A;  4BUE A;  4BJC A;  4F1Q A;  4PY4 A;  4XHU A;  4L2F A;  4GV7 A;  3MHJ A;  2PAX A;  4PJT A;  4UVW A;  4L6S A;  4BUS A;  4L2G A;  4ZZX A;  4BUT A;  4BUX A;  4UI6 A;  4DQY C;  5C5Q A;  3UDD A;  5ADR A;  4ZZY A;  3L3M A;  4HHY A;  4BUV A;  3UH4 A;  5EBT A;  4L0S A;  4KZL A;  3KCZ A;  4TKG A;  4HLG A;  4L70 A;  4HHZ A;  4UI8 A;  4W5S A;  3GN7 A;  3U9Y A;  4HYF A;  3FHB A;  4J3L A;  4UVP A;  3W51 A;  4UND A;  3P0N A;  4GV4 A;  4OPX C;  5AL4 A;  4UVN A;  4BJ9 A;  4UI4 A;  3KR8 A;  4DVI A;  3L3L A;  1GS0 A;  4L7N A;  4BU9 A;  4L7O A;  4HLM A;  5AKU A;  4UFU A;  4BJB A;  3UH2 A;  4RV6 A;  5ADQ A;  4J22 A;  4PML A;  4R5W A;  4I9I A;  4HKN A;  4UI3 A;  4PNR A;  3C49 A;  4N3R A;  4K4E A;  4BS4 A;  4TJU A;  4W6E A;  4BU6 A;  4ZZZ A;  4BUU A;  4HL5 A;  4TJY A;  3SE2 A;  4HMH A;  4TJW A;  5DCZ A;  4TK0 A;  4L10 A;  3MHK A;  5LYH A;  4OA7 A;  4PNQ A;  3GJW A;  3CE0 A;  4BU5 A;  4J1Z A;  4UVX A;  4X52 A;  4TOR A;  2RD6 A;  3GEY A;  5AL3 A;  4R6E A;  4UVY A;  4L6Z A;  4UVU A;  5C5R A;  4UVV A;  4UHG A;  4TKI A;  1UK0 A;  4N4T A;  5ADT A;  4MSG A;  4BFP A;  4HLK A;  4MSK A;  4N4V A;  4LI6 A;  4PJV A;  4L09 A;  4UI7 A;  4L32 A;  4LI7 A;  4UUH A;  5A00 A;  4TKF A;  5AL2 A;  4BU7 A;  2PAW A;  4GV0 A;  4L7U A;  1WOK A;  4UVO A;  5ETY A;  3U9H A;  5LX6 A;  4MT9 A;  4HKK A;  3P0P A;  3C4H A;  4U6A A;  4L2K A;  4F0E A;  4GV2 A;  4PNS A;  1EFY A;  4AVW A;  4IUE A;  4KZQ A;  4M7B A;  4UVT A;  5FPG A;  5AEH A;  4BUI A;  4BUD A;  4PNT A;  3SMI A;  3KJD A;  5AL5 A;  5AL1 A;  3P0Q A;  5C5P A;  5AKW A;  4L33 A;  4KRS A;  4HKI A;  4UW1 A;  4TK5 A;  3HKV A;  4LI8 A;  4L31 A;  3BLJ A;  3PAX A;  4L34 A;  4J21 A;  4BU3 A;  4J3M A;  4UFY A;  4BUW A;  4BUF A;  4KZU A;  4HLF A; 
#chains in the Genus database with same CATH topology
 2RKE A;  5LXP A;  4UI5 A;  2RKD A;  3UA9 A;  4WL8 A;  2X5Y A;  4L0I A;  3SMJ A;  4L0T A;  4OQA C;  4UXB A;  5FH1 A;  4W5I A;  4BUA A;  2RCW A;  4GNP A;  4L7P A;  4YWB A;  2PC9 A;  2RF5 A;  4L7L A;  4K4F A;  4L0V A;  4PNN A;  3GOY A;  5ECE A;  2OLQ A;  1PAX A;  1UK1 A;  4GMZ A;  4PNM A;  4UVZ A;  4UX4 A;  1A26 A;  2PQF A;  3DT4 A;  4GNO A;  4OQB C;  4F1L A;  2RKA A;  4PNL A;  5ADS A;  1J3B A;  5FPF A;  4BU8 A;  1KHF A;  4UVS A;  2QEW A;  4HLH A;  3KR7 A;  4PAX A;  4L0B A;  4WIE A;  5FH5 A;  4TOS A;  4AVU A;  4GNQ A;  2ZCI A;  4TVJ A;  4GMU A;  4UVL A;  2QEY A;  4L7R A;  4BUY A;  4BUE A;  1YGG A;  4BJC A;  4F1Q A;  3DT2 A;  2GMV A;  4PY4 A;  4XHU A;  4L2F A;  4GV7 A;  1K3C A;  2PAX A;  3MHJ A;  4PJT A;  4L6S A;  4UVW A;  4L2G A;  4ZZX A;  4BUS A;  4BUX A;  4UI6 A;  4WIU A;  4DQY C;  5C5Q A;  3MOE A;  3UDD A;  5ADR A;  4ZZY A;  3L3M A;  4HHY A;  4BUV A;  3MOF A;  4WPT A;  3UH4 A;  5EBT A;  4L0S A;  4GNM A;  3KCZ A;  4KZL A;  4TKG A;  3DT7 A;  4HLG A;  4L70 A;  4HHZ A;  1XKV A;  4UI8 A;  4W5S A;  4YW8 A;  3GN7 A;  3U9Y A;  2RK8 A;  4HYF A;  3FHB A;  4J3L A;  4UVP A;  3W51 A;  4UND A;  1M51 A;  2FAF A;  3P0N A;  1KHG A;  4GV4 A;  5AL4 A;  4UVN A;  1NHX A;  4BJ9 A;  4OPX C;  4UI4 A;  3KR8 A;  4DVI A;  3L3L A;  1GS0 A;  4L7N A;  4BU9 A;  4L7O A;  4HLM A;  5AKU A;  4UFU A;  4BJB A;  3UH2 A;  4RV6 A;  5ADQ A;  4J22 A;  4PML A;  4R5W A;  4I9I A;  4HKN A;  1YLH A;  4UI3 A;  5FH4 A;  4PNR A;  3C49 A;  4N3R A;  4WOU A;  4K4E A;  4BS4 A;  4TJU A;  4YWD A;  2QF1 A;  3MOH A;  4W6E A;  4BU6 A;  4ZZZ A;  4BUU A;  1OEN A;  4HL5 A;  4TJY A;  3SE2 A;  4HMH A;  1AYL A;  4TJW A;  5DCZ A;  4TK0 A;  4GMM A;  4L10 A;  2QZY A;  3MHK A;  3DTB A;  5LYH A;  1KHE A;  5I67 A;  4OA7 A;  4PNQ A;  3GJW A;  3CE0 A;  4BU5 A;  4J1Z A;  4UVX A;  4X52 A;  1YTM A;  4TOR A;  2RD6 A;  3GEY A;  5AL3 A;  4R6E A;  4UVY A;  4L6Z A;  4R43 A;  4UVU A;  5C5R A;  2PXZ X;  4UVV A;  4UHG A;  4TKI A;  1UK0 A;  4GNL A;  4N4T A;  4MSG A;  5FH2 A;  5ADT A;  4BFP A;  4HLK A;  4MSK A;  4N4V A;  4LI6 A;  4PJV A;  4L09 A;  4RCG A;  4UI7 A;  4L32 A;  4LI7 A;  4UUH A;  5A00 A;  4TKF A;  5AL2 A;  4BU7 A;  2PAW A;  4GV0 A;  4L7U A;  1WOK A;  4UVO A;  5ETY A;  3U9H A;  4BUT A;  5LX6 A;  4MT9 A;  4HKK A;  3P0P A;  3C4H A;  1II2 A;  4L2K A;  4U6A A;  4F0E A;  4GV2 A;  4PNS A;  1EFY A;  5FH3 A;  5FH0 A;  4AVW A;  4IUE A;  4KZQ A;  4M7B A;  4UVT A;  1YVY A;  5FPG A;  5AEH A;  4BUI A;  4PNT A;  4BUD A;  3SMI A;  3KJD A;  2OLR A;  5AL5 A;  5AL1 A;  3P0Q A;  4WPU A;  5C5P A;  5AKW A;  4L33 A;  4KRS A;  1AQ2 A;  4HKI A;  4UW1 A;  4TK5 A;  1K3D A;  3HKV A;  2FAH A;  1KHB A;  2QF2 A;  4L31 A;  4LI8 A;  1OS1 A;  3BLJ A;  3PAX A;  4GMW A;  4WPV A;  4OX2 A;  4L34 A;  4J21 A;  2PY7 X;  4J3M A;  4UFY A;  4BU3 A;  4BUW A;  4YW9 A;  4KZU A;  2RK7 A;  4BUF A;  4HLF A; 
#chains in the Genus database with same CATH homology
 2RKE A;  5LXP A;  4UI5 A;  2RKD A;  3UA9 A;  4WL8 A;  2X5Y A;  4L0I A;  3SMJ A;  4L0T A;  4OQA C;  4UXB A;  5FH1 A;  4W5I A;  4BUA A;  2RCW A;  4GNP A;  4L7P A;  4YWB A;  2PC9 A;  2RF5 A;  4L7L A;  4K4F A;  4L0V A;  4PNN A;  3GOY A;  5ECE A;  2OLQ A;  1PAX A;  1UK1 A;  4GMZ A;  4PNM A;  4UVZ A;  4UX4 A;  1A26 A;  2PQF A;  3DT4 A;  4GNO A;  4OQB C;  4F1L A;  2RKA A;  4PNL A;  5ADS A;  1J3B A;  5FPF A;  4BU8 A;  1KHF A;  4UVS A;  2QEW A;  4HLH A;  3KR7 A;  4PAX A;  4L0B A;  4WIE A;  5FH5 A;  4TOS A;  4AVU A;  4GNQ A;  2ZCI A;  4TVJ A;  4GMU A;  4UVL A;  2QEY A;  4L7R A;  4BUY A;  4BUE A;  1YGG A;  4BJC A;  4F1Q A;  3DT2 A;  2GMV A;  4PY4 A;  4XHU A;  4L2F A;  4GV7 A;  1K3C A;  2PAX A;  3MHJ A;  4PJT A;  4L6S A;  4UVW A;  4L2G A;  4ZZX A;  4BUS A;  4BUX A;  4UI6 A;  4WIU A;  4DQY C;  5C5Q A;  3MOE A;  3UDD A;  5ADR A;  4ZZY A;  3L3M A;  4HHY A;  4BUV A;  3MOF A;  4WPT A;  3UH4 A;  5EBT A;  4L0S A;  4GNM A;  3KCZ A;  4KZL A;  4TKG A;  3DT7 A;  4HLG A;  4L70 A;  4HHZ A;  1XKV A;  4UI8 A;  4W5S A;  4YW8 A;  3GN7 A;  3U9Y A;  2RK8 A;  4HYF A;  3FHB A;  4J3L A;  4UVP A;  3W51 A;  4UND A;  1M51 A;  2FAF A;  3P0N A;  1KHG A;  4GV4 A;  5AL4 A;  4UVN A;  1NHX A;  4BJ9 A;  4OPX C;  4UI4 A;  3KR8 A;  4DVI A;  3L3L A;  1GS0 A;  4L7N A;  4BU9 A;  4L7O A;  4HLM A;  5AKU A;  4UFU A;  4BJB A;  3UH2 A;  4RV6 A;  5ADQ A;  4J22 A;  4PML A;  4R5W A;  4I9I A;  4HKN A;  1YLH A;  4UI3 A;  5FH4 A;  4PNR A;  3C49 A;  4N3R A;  4WOU A;  4K4E A;  4BS4 A;  4TJU A;  4YWD A;  2QF1 A;  3MOH A;  4W6E A;  4BU6 A;  4ZZZ A;  4BUU A;  1OEN A;  4HL5 A;  4TJY A;  3SE2 A;  4HMH A;  1AYL A;  4TJW A;  5DCZ A;  4TK0 A;  4GMM A;  4L10 A;  2QZY A;  3MHK A;  3DTB A;  5LYH A;  1KHE A;  5I67 A;  4OA7 A;  4PNQ A;  3GJW A;  3CE0 A;  4BU5 A;  4J1Z A;  4UVX A;  4X52 A;  1YTM A;  4TOR A;  2RD6 A;  3GEY A;  5AL3 A;  4R6E A;  4UVY A;  4L6Z A;  4R43 A;  4UVU A;  5C5R A;  2PXZ X;  4UVV A;  4UHG A;  4TKI A;  1UK0 A;  4GNL A;  4N4T A;  4MSG A;  5FH2 A;  5ADT A;  4BFP A;  4HLK A;  4MSK A;  4N4V A;  4LI6 A;  4PJV A;  4L09 A;  4RCG A;  4UI7 A;  4L32 A;  4LI7 A;  4UUH A;  5A00 A;  4TKF A;  5AL2 A;  4BU7 A;  2PAW A;  4GV0 A;  4L7U A;  1WOK A;  4UVO A;  5ETY A;  3U9H A;  4BUT A;  5LX6 A;  4MT9 A;  4HKK A;  3P0P A;  3C4H A;  1II2 A;  4L2K A;  4U6A A;  4F0E A;  4GV2 A;  4PNS A;  1EFY A;  5FH3 A;  5FH0 A;  4AVW A;  4IUE A;  4KZQ A;  4M7B A;  4UVT A;  1YVY A;  5FPG A;  5AEH A;  4BUI A;  4PNT A;  4BUD A;  3SMI A;  3KJD A;  2OLR A;  5AL5 A;  5AL1 A;  3P0Q A;  4WPU A;  5C5P A;  5AKW A;  4L33 A;  4KRS A;  1AQ2 A;  4HKI A;  4UW1 A;  4TK5 A;  1K3D A;  3HKV A;  2FAH A;  1KHB A;  2QF2 A;  4L31 A;  4LI8 A;  1OS1 A;  3BLJ A;  3PAX A;  4GMW A;  4WPV A;  4OX2 A;  4L34 A;  4J21 A;  2PY7 X;  4J3M A;  4UFY A;  4BU3 A;  4BUW A;  4YW9 A;  4KZU A;  2RK7 A;  4BUF A;  4HLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...