4BUWA

Crystal structure of human tankyrase 2 in complex with 2-(4-(2-oxo-1, 3-oxazolidin-3-yl)phenyl)-3,4-dihydroquinazolin-4-one
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buwA00
4UFYA 3UA9A 4BUDA 4F0EA 2RF5A 4AVUA 3L3LA 3W51A 2RCWA 3GOYA 4PJVA 4IUEA 4PNSA 5ECEA 4UVLA 4UX4A 4UXBA 1GS0A 3L3MA 4GV7A 4UVXA 5FPFA 4PNNA 3MHJA 4U6AA 4HKKA 3P0QA 3U9YA 4L33A 3KCZA 4UVOA 4L6SA 1UK0A 4HHYA 4BJ9A 4PY4A 2PAWA 2PQFA 4TKIA 5AL1A 3GEYA 5C5RA 1PAXA 4TKFA 3UDDA 3C49A 3GN7A 1UK1A 4UFUA 4L7UA 3SE2A 4BU8A 4BU6A 4BUYA 4AVWA 4UI8A 4ZZZA 4L0TA 4UI3A 5LXPA 3KR7A 4GV0A 4L09A 4OA7A 4BUUA 4L10A 5AL5A 5FPGA 4TJWA 4TKGA 4K4EA 3MHKA 4UI7A 4UVSA 4OPXC 5ADQA 4F1QA 4R5WA 4BU3A 4TORA 3GJWA 4F1LA 3CE0A 4BJCA 4KZLA 4W5IA 4KZQA 4BUXA 4N3RA 3U9HA 4L7RA 3PAXA 4W5SA 1WOKA 5AL2A 3SMIA 4UVPA 4X52A 4HYFA 2RD6A 4I9IA 4PAXA 4PNRA 4PNMA 4BUWA 4LI7A 4N4VA 4UVVA 4L70A 4PNTA 4BS4A 4TVJA 4BU5A 5AKUA 4HLMA 5ADSA 5LX6A 3HKVA 4UVNA 4MT9A 5AEHA 4HMHA 3SMJA 4UVZA 4L6ZA 4OQAC 1A26A 4GV2A 4MSGA 4UI5A 5AL4A 4BU7A 4UI6A 3P0PA 3UH2A 4BUSA 4L31A 5ADTA 4UVYA 4UHGA 4PJTA 4KRSA 4J21A 4XHUA 4BUIA 4ZZXA 1EFYA 5ETYA 4J1ZA 4UVUA 4L0IA 4J3LA 5DCZA 3P0NA 4UVTA 4BFPA 3BLJA 4MSKA 3UH4A 4L7OA 4GV4A 3FHBA 4TOSA 4DVIA 3C4HA 4L0BA 4DQYC 4L7PA 4RV6A 4UI4A 4OQBC 4HKNA 4UVWA 4BU9A 5A00A 4HHZA 4HLHA 5ADRA 4PMLA 4PNLA 4N4TA 4TK0A 4BUTA 4BUFA 5EBTA 4TK5A 5AKWA 4PNQA 4M7BA 4HKIA 4BUEA 2X5YA 5AL3A 4HL5A 4HLKA 5LYHA 4TJUA 4LI6A 4ZZYA 5C5QA 4L2FA 4KZUA 5C5PA 3KR8A 4W6EA 4UW1A 3KJDA 4L7NA 4HLFA 4L7LA 4BUAA 4L0VA 4L34A 4TJYA 4BUVA 4L2GA 2PAXA 4HLGA 4J3MA 4LI8A 4K4FA 4BJBA 4L32A 4UNDA 4L2KA 4L0SA 4J22A 4UUHA 4R6EA
chains in the Genus database with same CATH superfamily
4UFYA 1J3BA 3UA9A 4BUDA 4F0EA 2RF5A 1K3CA 4AVUA 5FH3A 1KHFA 2OLRA 5I67A 3L3LA 3W51A 2RCWA 3GOYA 4PJVA 4IUEA 4PNSA 5ECEA 1YVYA 4UVLA 4UX4A 4UXBA 1GS0A 3L3MA 4GV7A 4UVXA 4GNOA 2ZCIA 5FPFA 4PNNA 3MHJA 4U6AA 4HKKA 3P0QA 4GNQA 4L33A 3KCZA 4UVOA 4L6SA 3U9YA 1AQ2A 1UK0A 4HHYA 4BJ9A 4YW8A 4PY4A 2PAWA 2PQFA 4TKIA 5AL1A 2RK7A 3GEYA 2QEYA 1XKVA 3DTBA 4GMZA 5C5RA 1PAXA 2QEWA 2PXZX 4TKFA 3UDDA 3C49A 3GN7A 4GNMA 5FH5A 1UK1A 4UFUA 4L7UA 3SE2A 4BU8A 4BU6A 4BUYA 4AVWA 4UI8A 4ZZZA 4L0TA 4UI3A 5LXPA 3KR7A 4GV0A 1II2A 4L09A 4OA7A 4BUUA 4L10A 5AL5A 5FPGA 4TJWA 4TKGA 4K4EA 2RKDA 2QZYA 3MHKA 4UI7A 5FH4A 4UVSA 4OPXC 2FAFA 4F1QA 3MOEA 4R5WA 4BU3A 1YTMA 2RK8A 4TORA 3GJWA 4F1LA 3CE0A 4BJCA 4KZLA 4R43A 3MOHA 4KZQA 4W5IA 1OENA 4N3RA 4L7RA 3U9HA 4BUXA 3PAXA 4W5SA 2OLQA 1WOKA 4RCGA 5AL2A 3SMIA 4UVPA 4X52A 4HYFA 1AYLA 2RD6A 4I9IA 4PAXA 4PNRA 4PNMA 4BUWA 4LI7A 4N4VA 4UVVA 4L70A 4PNTA 4WL8A 4BS4A 4TVJA 4BU5A 5AKUA 4HLMA 4GMMA 4WIEA 5ADSA 3HKVA 4UVNA 5LX6A 4MT9A 5AEHA 4HMHA 3SMJA 4UVZA 3DT2A 4L6ZA 4OQAC 1A26A 4GV2A 4MSGA 4UI5A 5AL4A 4BU7A 4YWBA 4UI6A 3P0PA 4YWDA 3UH2A 4BUSA 4L31A 1YLHA 4GMUA 4YW9A 5ADTA 4UVYA 4UHGA 4GNPA 4PJTA 4KRSA 2PC9A 4J21A 4GMWA 2QF2A 4XHUA 4BUIA 4ZZXA 1EFYA 5ETYA 4J1ZA 4UVUA 4L0IA 4J3LA 5DCZA 3P0NA 4UVTA 2RKAA 4OX2A 4BFPA 3BLJA 4MSKA 3DT7A 1KHEA 2GMVA 4WIUA 3DT4A 4L7OA 4GV4A 3UH4A 3FHBA 4TOSA 4DVIA 4WPVA 3C4HA 4L0BA 4DQYC 4L7PA 4RV6A 4UI4A 4OQBC 4HKNA 5ADQA 2FAHA 4UVWA 4WOUA 4BU9A 5A00A 2PY7X 4HHZA 4HLHA 5ADRA 4PMLA 4PNLA 4N4TA 4TK0A 4GNLA 1KHBA 1KHGA 4BUTA 2QF1A 4BUFA 5EBTA 4TK5A 5AKWA 4PNQA 4M7BA 4HKIA 4BUEA 2X5YA 5AL3A 1OS1A 4HL5A 1M51A 1NHXA 4HLKA 4TJUA 5LYHA 4LI6A 4ZZYA 5FH2A 4L2FA 5C5QA 1YGGA 4KZUA 5C5PA 3KR8A 4W6EA 4UW1A 3KJDA 4WPTA 4L7NA 4HLFA 4L7LA 4BUAA 4L0VA 4L34A 4TJYA 2RKEA 4BUVA 3MOFA 1K3DA 2PAXA 4HLGA 4J3MA 4K4FA 4L2GA 4LI8A 5FH0A 5FH1A 4BJBA 4L32A 4UNDA 4L2KA 4WPUA 4L0SA 4J22A 4UUHA 4R6EA
chains in the Genus database with same CATH topology
4UFYA 1J3BA 3UA9A 4BUDA 4F0EA 2RF5A 1K3CA 4AVUA 5FH3A 1KHFA 2OLRA 5I67A 3L3LA 3W51A 2RCWA 3GOYA 4PJVA 4IUEA 4PNSA 5ECEA 1YVYA 4UVLA 4UX4A 4UXBA 1GS0A 3L3MA 4GV7A 4UVXA 4GNOA 2ZCIA 5FPFA 4PNNA 3MHJA 4U6AA 4HKKA 3P0QA 4GNQA 4L33A 3KCZA 4UVOA 4L6SA 3U9YA 1AQ2A 1UK0A 4HHYA 4BJ9A 4YW8A 4PY4A 2PAWA 2PQFA 4TKIA 5AL1A 2RK7A 3GEYA 2QEYA 1XKVA 3DTBA 4GMZA 5C5RA 1PAXA 2QEWA 2PXZX 4TKFA 3UDDA 3C49A 3GN7A 4GNMA 5FH5A 1UK1A 4UFUA 4L7UA 3SE2A 4BU8A 4BU6A 4BUYA 4AVWA 4UI8A 4ZZZA 4L0TA 4UI3A 5LXPA 3KR7A 4GV0A 1II2A 4L09A 4OA7A 4BUUA 4L10A 5AL5A 5FPGA 4TJWA 4TKGA 4K4EA 2RKDA 2QZYA 3MHKA 4UI7A 5FH4A 4UVSA 4OPXC 2FAFA 4F1QA 3MOEA 4R5WA 4BU3A 1YTMA 2RK8A 4TORA 3GJWA 4F1LA 3CE0A 4BJCA 4KZLA 4R43A 3MOHA 4KZQA 4W5IA 1OENA 4N3RA 4L7RA 3U9HA 4BUXA 3PAXA 4W5SA 2OLQA 1WOKA 4RCGA 5AL2A 3SMIA 4UVPA 4X52A 4HYFA 1AYLA 2RD6A 4I9IA 4PAXA 4PNRA 4PNMA 4BUWA 4LI7A 4N4VA 4UVVA 4L70A 4PNTA 4WL8A 4BS4A 4TVJA 4BU5A 5AKUA 4HLMA 4GMMA 4WIEA 5ADSA 3HKVA 4UVNA 5LX6A 4MT9A 5AEHA 4HMHA 3SMJA 4UVZA 3DT2A 4L6ZA 4OQAC 1A26A 4GV2A 4MSGA 4UI5A 5AL4A 4BU7A 4YWBA 4UI6A 3P0PA 4YWDA 3UH2A 4BUSA 4L31A 1YLHA 4GMUA 4YW9A 5ADTA 4UVYA 4UHGA 4GNPA 4PJTA 4KRSA 2PC9A 4J21A 4GMWA 2QF2A 4XHUA 4BUIA 4ZZXA 1EFYA 5ETYA 4J1ZA 4UVUA 4L0IA 4J3LA 5DCZA 3P0NA 4UVTA 2RKAA 4OX2A 4BFPA 3BLJA 4MSKA 3DT7A 1KHEA 2GMVA 4WIUA 3DT4A 4L7OA 4GV4A 3UH4A 3FHBA 4TOSA 4DVIA 4WPVA 3C4HA 4L0BA 4DQYC 4L7PA 4RV6A 4UI4A 4OQBC 4HKNA 5ADQA 2FAHA 4UVWA 4WOUA 4BU9A 5A00A 2PY7X 4HHZA 4HLHA 5ADRA 4PMLA 4PNLA 4N4TA 4TK0A 4GNLA 1KHBA 1KHGA 4BUTA 2QF1A 4BUFA 5EBTA 4TK5A 5AKWA 4PNQA 4M7BA 4HKIA 4BUEA 2X5YA 5AL3A 1OS1A 4HL5A 1M51A 1NHXA 4HLKA 4TJUA 5LYHA 4LI6A 4ZZYA 5FH2A 4L2FA 5C5QA 1YGGA 4KZUA 5C5PA 3KR8A 4W6EA 4UW1A 3KJDA 4WPTA 4L7NA 4HLFA 4L7LA 4BUAA 4L0VA 4L34A 4TJYA 2RKEA 4BUVA 3MOFA 1K3DA 2PAXA 4HLGA 4J3MA 4K4FA 4L2GA 4LI8A 5FH0A 5FH1A 4BJBA 4L32A 4UNDA 4L2KA 4WPUA 4L0SA 4J22A 4UUHA 4R6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFY A;  3UA9 A;  4BUD A;  4F0E A;  2RF5 A;  4AVU A;  3L3L A;  3W51 A;  2RCW A;  3GOY A;  4PJV A;  4IUE A;  4PNS A;  5ECE A;  4UVL A;  4UX4 A;  4UXB A;  1GS0 A;  3L3M A;  4GV7 A;  4UVX A;  5FPF A;  4PNN A;  3MHJ A;  4U6A A;  4HKK A;  3P0Q A;  3U9Y A;  4L33 A;  3KCZ A;  4UVO A;  4L6S A;  1UK0 A;  4HHY A;  4BJ9 A;  4PY4 A;  2PAW A;  2PQF A;  4TKI A;  5AL1 A;  3GEY A;  5C5R A;  1PAX A;  4TKF A;  3UDD A;  3C49 A;  3GN7 A;  1UK1 A;  4UFU A;  4L7U A;  3SE2 A;  4BU8 A;  4BU6 A;  4BUY A;  4AVW A;  4UI8 A;  4ZZZ A;  4L0T A;  4UI3 A;  5LXP A;  3KR7 A;  4GV0 A;  4L09 A;  4OA7 A;  4BUU A;  4L10 A;  5AL5 A;  5FPG A;  4TJW A;  4TKG A;  4K4E A;  3MHK A;  4UI7 A;  4UVS A;  4OPX C;  5ADQ A;  4F1Q A;  4R5W A;  4BU3 A;  4TOR A;  3GJW A;  4F1L A;  3CE0 A;  4BJC A;  4KZL A;  4W5I A;  4KZQ A;  4BUX A;  4N3R A;  3U9H A;  4L7R A;  3PAX A;  4W5S A;  1WOK A;  5AL2 A;  3SMI A;  4UVP A;  4X52 A;  4HYF A;  2RD6 A;  4I9I A;  4PAX A;  4PNR A;  4PNM A;  4BUW A;  4LI7 A;  4N4V A;  4UVV A;  4L70 A;  4PNT A;  4BS4 A;  4TVJ A;  4BU5 A;  5AKU A;  4HLM A;  5ADS A;  5LX6 A;  3HKV A;  4UVN A;  4MT9 A;  5AEH A;  4HMH A;  3SMJ A;  4UVZ A;  4L6Z A;  4OQA C;  1A26 A;  4GV2 A;  4MSG A;  4UI5 A;  5AL4 A;  4BU7 A;  4UI6 A;  3P0P A;  3UH2 A;  4BUS A;  4L31 A;  5ADT A;  4UVY A;  4UHG A;  4PJT A;  4KRS A;  4J21 A;  4XHU A;  4BUI A;  4ZZX A;  1EFY A;  5ETY A;  4J1Z A;  4UVU A;  4L0I A;  4J3L A;  5DCZ A;  3P0N A;  4UVT A;  4BFP A;  3BLJ A;  4MSK A;  3UH4 A;  4L7O A;  4GV4 A;  3FHB A;  4TOS A;  4DVI A;  3C4H A;  4L0B A;  4DQY C;  4L7P A;  4RV6 A;  4UI4 A;  4OQB C;  4HKN A;  4UVW A;  4BU9 A;  5A00 A;  4HHZ A;  4HLH A;  5ADR A;  4PML A;  4PNL A;  4N4T A;  4TK0 A;  4BUT A;  4BUF A;  5EBT A;  4TK5 A;  5AKW A;  4PNQ A;  4M7B A;  4HKI A;  4BUE A;  2X5Y A;  5AL3 A;  4HL5 A;  4HLK A;  5LYH A;  4TJU A;  4LI6 A;  4ZZY A;  5C5Q A;  4L2F A;  4KZU A;  5C5P A;  3KR8 A;  4W6E A;  4UW1 A;  3KJD A;  4L7N A;  4HLF A;  4L7L A;  4BUA A;  4L0V A;  4L34 A;  4TJY A;  4BUV A;  4L2G A;  2PAX A;  4HLG A;  4J3M A;  4LI8 A;  4K4F A;  4BJB A;  4L32 A;  4UND A;  4L2K A;  4L0S A;  4J22 A;  4UUH A;  4R6E A; 
#chains in the Genus database with same CATH topology
 4UFY A;  1J3B A;  3UA9 A;  4BUD A;  4F0E A;  2RF5 A;  1K3C A;  4AVU A;  5FH3 A;  1KHF A;  2OLR A;  5I67 A;  3L3L A;  3W51 A;  2RCW A;  3GOY A;  4PJV A;  4IUE A;  4PNS A;  5ECE A;  1YVY A;  4UVL A;  4UX4 A;  4UXB A;  1GS0 A;  3L3M A;  4GV7 A;  4UVX A;  4GNO A;  2ZCI A;  5FPF A;  4PNN A;  3MHJ A;  4U6A A;  4HKK A;  3P0Q A;  4GNQ A;  4L33 A;  3KCZ A;  4UVO A;  4L6S A;  3U9Y A;  1AQ2 A;  1UK0 A;  4HHY A;  4BJ9 A;  4YW8 A;  4PY4 A;  2PAW A;  2PQF A;  4TKI A;  5AL1 A;  2RK7 A;  3GEY A;  2QEY A;  1XKV A;  3DTB A;  4GMZ A;  5C5R A;  1PAX A;  2QEW A;  2PXZ X;  4TKF A;  3UDD A;  3C49 A;  3GN7 A;  4GNM A;  5FH5 A;  1UK1 A;  4UFU A;  4L7U A;  3SE2 A;  4BU8 A;  4BU6 A;  4BUY A;  4AVW A;  4UI8 A;  4ZZZ A;  4L0T A;  4UI3 A;  5LXP A;  3KR7 A;  4GV0 A;  1II2 A;  4L09 A;  4OA7 A;  4BUU A;  4L10 A;  5AL5 A;  5FPG A;  4TJW A;  4TKG A;  4K4E A;  2RKD A;  2QZY A;  3MHK A;  4UI7 A;  5FH4 A;  4UVS A;  4OPX C;  2FAF A;  4F1Q A;  3MOE A;  4R5W A;  4BU3 A;  1YTM A;  2RK8 A;  4TOR A;  3GJW A;  4F1L A;  3CE0 A;  4BJC A;  4KZL A;  4R43 A;  3MOH A;  4KZQ A;  4W5I A;  1OEN A;  4N3R A;  4L7R A;  3U9H A;  4BUX A;  3PAX A;  4W5S A;  2OLQ A;  1WOK A;  4RCG A;  5AL2 A;  3SMI A;  4UVP A;  4X52 A;  4HYF A;  1AYL A;  2RD6 A;  4I9I A;  4PAX A;  4PNR A;  4PNM A;  4BUW A;  4LI7 A;  4N4V A;  4UVV A;  4L70 A;  4PNT A;  4WL8 A;  4BS4 A;  4TVJ A;  4BU5 A;  5AKU A;  4HLM A;  4GMM A;  4WIE A;  5ADS A;  3HKV A;  4UVN A;  5LX6 A;  4MT9 A;  5AEH A;  4HMH A;  3SMJ A;  4UVZ A;  3DT2 A;  4L6Z A;  4OQA C;  1A26 A;  4GV2 A;  4MSG A;  4UI5 A;  5AL4 A;  4BU7 A;  4YWB A;  4UI6 A;  3P0P A;  4YWD A;  3UH2 A;  4BUS A;  4L31 A;  1YLH A;  4GMU A;  4YW9 A;  5ADT A;  4UVY A;  4UHG A;  4GNP A;  4PJT A;  4KRS A;  2PC9 A;  4J21 A;  4GMW A;  2QF2 A;  4XHU A;  4BUI A;  4ZZX A;  1EFY A;  5ETY A;  4J1Z A;  4UVU A;  4L0I A;  4J3L A;  5DCZ A;  3P0N A;  4UVT A;  2RKA A;  4OX2 A;  4BFP A;  3BLJ A;  4MSK A;  3DT7 A;  1KHE A;  2GMV A;  4WIU A;  3DT4 A;  4L7O A;  4GV4 A;  3UH4 A;  3FHB A;  4TOS A;  4DVI A;  4WPV A;  3C4H A;  4L0B A;  4DQY C;  4L7P A;  4RV6 A;  4UI4 A;  4OQB C;  4HKN A;  5ADQ A;  2FAH A;  4UVW A;  4WOU A;  4BU9 A;  5A00 A;  2PY7 X;  4HHZ A;  4HLH A;  5ADR A;  4PML A;  4PNL A;  4N4T A;  4TK0 A;  4GNL A;  1KHB A;  1KHG A;  4BUT A;  2QF1 A;  4BUF A;  5EBT A;  4TK5 A;  5AKW A;  4PNQ A;  4M7B A;  4HKI A;  4BUE A;  2X5Y A;  5AL3 A;  1OS1 A;  4HL5 A;  1M51 A;  1NHX A;  4HLK A;  4TJU A;  5LYH A;  4LI6 A;  4ZZY A;  5FH2 A;  4L2F A;  5C5Q A;  1YGG A;  4KZU A;  5C5P A;  3KR8 A;  4W6E A;  4UW1 A;  3KJD A;  4WPT A;  4L7N A;  4HLF A;  4L7L A;  4BUA A;  4L0V A;  4L34 A;  4TJY A;  2RKE A;  4BUV A;  3MOF A;  1K3D A;  2PAX A;  4HLG A;  4J3M A;  4K4F A;  4L2G A;  4LI8 A;  5FH0 A;  5FH1 A;  4BJB A;  4L32 A;  4UND A;  4L2K A;  4WPU A;  4L0S A;  4J22 A;  4UUH A;  4R6E A; 
#chains in the Genus database with same CATH homology
 4UFY A;  1J3B A;  3UA9 A;  4BUD A;  4F0E A;  2RF5 A;  1K3C A;  4AVU A;  5FH3 A;  1KHF A;  2OLR A;  5I67 A;  3L3L A;  3W51 A;  2RCW A;  3GOY A;  4PJV A;  4IUE A;  4PNS A;  5ECE A;  1YVY A;  4UVL A;  4UX4 A;  4UXB A;  1GS0 A;  3L3M A;  4GV7 A;  4UVX A;  4GNO A;  2ZCI A;  5FPF A;  4PNN A;  3MHJ A;  4U6A A;  4HKK A;  3P0Q A;  4GNQ A;  4L33 A;  3KCZ A;  4UVO A;  4L6S A;  3U9Y A;  1AQ2 A;  1UK0 A;  4HHY A;  4BJ9 A;  4YW8 A;  4PY4 A;  2PAW A;  2PQF A;  4TKI A;  5AL1 A;  2RK7 A;  3GEY A;  2QEY A;  1XKV A;  3DTB A;  4GMZ A;  5C5R A;  1PAX A;  2QEW A;  2PXZ X;  4TKF A;  3UDD A;  3C49 A;  3GN7 A;  4GNM A;  5FH5 A;  1UK1 A;  4UFU A;  4L7U A;  3SE2 A;  4BU8 A;  4BU6 A;  4BUY A;  4AVW A;  4UI8 A;  4ZZZ A;  4L0T A;  4UI3 A;  5LXP A;  3KR7 A;  4GV0 A;  1II2 A;  4L09 A;  4OA7 A;  4BUU A;  4L10 A;  5AL5 A;  5FPG A;  4TJW A;  4TKG A;  4K4E A;  2RKD A;  2QZY A;  3MHK A;  4UI7 A;  5FH4 A;  4UVS A;  4OPX C;  2FAF A;  4F1Q A;  3MOE A;  4R5W A;  4BU3 A;  1YTM A;  2RK8 A;  4TOR A;  3GJW A;  4F1L A;  3CE0 A;  4BJC A;  4KZL A;  4R43 A;  3MOH A;  4KZQ A;  4W5I A;  1OEN A;  4N3R A;  4L7R A;  3U9H A;  4BUX A;  3PAX A;  4W5S A;  2OLQ A;  1WOK A;  4RCG A;  5AL2 A;  3SMI A;  4UVP A;  4X52 A;  4HYF A;  1AYL A;  2RD6 A;  4I9I A;  4PAX A;  4PNR A;  4PNM A;  4BUW A;  4LI7 A;  4N4V A;  4UVV A;  4L70 A;  4PNT A;  4WL8 A;  4BS4 A;  4TVJ A;  4BU5 A;  5AKU A;  4HLM A;  4GMM A;  4WIE A;  5ADS A;  3HKV A;  4UVN A;  5LX6 A;  4MT9 A;  5AEH A;  4HMH A;  3SMJ A;  4UVZ A;  3DT2 A;  4L6Z A;  4OQA C;  1A26 A;  4GV2 A;  4MSG A;  4UI5 A;  5AL4 A;  4BU7 A;  4YWB A;  4UI6 A;  3P0P A;  4YWD A;  3UH2 A;  4BUS A;  4L31 A;  1YLH A;  4GMU A;  4YW9 A;  5ADT A;  4UVY A;  4UHG A;  4GNP A;  4PJT A;  4KRS A;  2PC9 A;  4J21 A;  4GMW A;  2QF2 A;  4XHU A;  4BUI A;  4ZZX A;  1EFY A;  5ETY A;  4J1Z A;  4UVU A;  4L0I A;  4J3L A;  5DCZ A;  3P0N A;  4UVT A;  2RKA A;  4OX2 A;  4BFP A;  3BLJ A;  4MSK A;  3DT7 A;  1KHE A;  2GMV A;  4WIU A;  3DT4 A;  4L7O A;  4GV4 A;  3UH4 A;  3FHB A;  4TOS A;  4DVI A;  4WPV A;  3C4H A;  4L0B A;  4DQY C;  4L7P A;  4RV6 A;  4UI4 A;  4OQB C;  4HKN A;  5ADQ A;  2FAH A;  4UVW A;  4WOU A;  4BU9 A;  5A00 A;  2PY7 X;  4HHZ A;  4HLH A;  5ADR A;  4PML A;  4PNL A;  4N4T A;  4TK0 A;  4GNL A;  1KHB A;  1KHG A;  4BUT A;  2QF1 A;  4BUF A;  5EBT A;  4TK5 A;  5AKW A;  4PNQ A;  4M7B A;  4HKI A;  4BUE A;  2X5Y A;  5AL3 A;  1OS1 A;  4HL5 A;  1M51 A;  1NHX A;  4HLK A;  4TJU A;  5LYH A;  4LI6 A;  4ZZY A;  5FH2 A;  4L2F A;  5C5Q A;  1YGG A;  4KZU A;  5C5P A;  3KR8 A;  4W6E A;  4UW1 A;  3KJD A;  4WPT A;  4L7N A;  4HLF A;  4L7L A;  4BUA A;  4L0V A;  4L34 A;  4TJY A;  2RKE A;  4BUV A;  3MOF A;  1K3D A;  2PAX A;  4HLG A;  4J3M A;  4K4F A;  4L2G A;  4LI8 A;  5FH0 A;  5FH1 A;  4BJB A;  4L32 A;  4UND A;  4L2K A;  4WPU A;  4L0S A;  4J22 A;  4UUH A;  4R6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...