4BUWA

Crystal structure of human tankyrase 2 in complex with 2-(4-(2-oxo-1, 3-oxazolidin-3-yl)phenyl)-3,4-dihydroquinazolin-4-one
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buwA00
4HKKA 3SE2A 4N4VA 4AVWA 1WOKA 5LX6A 4TOSA 3GEYA 5C5RA 1UK0A 4UVWA 4U6AA 4BFPA 4TORA 5C5QA 1EFYA 4TVJA 2X5YA 4L2KA 4UI8A 4UVUA 4BU7A 4UX4A 4BUTA 4TK0A 4UVZA 3KJDA 5C5PA 3UH2A 3P0PA 4HLFA 4MSGA 3PAXA 4M7BA 3KCZA 4X52A 4HLHA 4K4FA 3SMIA 4BJ9A 4L7LA 5A00A 4BUSA 4L0VA 4UHGA 4HLMA 4UW1A 4BU8A 3KR7A 3UA9A 4BUUA 3MHJA 4UVYA 4R5WA 4LI8A 4UUHA 5ADTA 4PMLA 4L0TA 4L31A 1A26A 4OQBC 3C49A 3FHBA 4UXBA 4KRSA 4HL5A 5AL1A 4UI3A 4BUDA 4ZZYA 2RCWA 3UH4A 3GJWA 4HKNA 4GV4A 4KZUA 4HHZA 4UVNA 4HKIA 4L7RA 4XHUA 4BU9A 4TJYA 3P0NA 4PNSA 5AL2A 4BUEA 4UVXA 4TKIA 5AEHA 5ECEA 4BUWA 4N3RA 4PNMA 4GV0A 4LI7A 4UFUA 4BUVA 4J22A 4F1LA 4OPXC 3C4HA 4UFYA 4BS4A 4UVPA 4L6SA 4L34A 4PNTA 4J1ZA 4L7OA 4IUEA 5ADQA 4LI6A 2RF5A 4UVOA 4L0BA 4ZZXA 4L7PA 4TJWA 4BU6A 4PNLA 4HHYA 5LXPA 4KZLA 4OA7A 3BLJA 5ADRA 4HLGA 4L09A 3UDDA 4DVIA 3GN7A 4TJUA 4BU3A 4F1QA 4L7UA 5DCZA 4BUFA 4PY4A 4UI7A 4L0IA 4HMHA 1UK1A 5AL5A 4MSKA 3P0QA 3L3MA 4GV7A 5ETYA 3W51A 4OQAC 4W5SA 5AL4A 3U9YA 2PAXA 4GV2A 4BUAA 5LYHA 4J21A 4UNDA 4W6EA 4UI4A 4J3LA 4HYFA 4RV6A 4I9IA 4BUXA 4J3MA 4PNRA 3SMJA 4BU5A 4F0EA 4L70A 4PJTA 4N4TA 4ZZZA 4L2GA 4L7NA 4TKGA 4L10A 3U9HA 5FPFA 4DQYC 3KR8A 4BJCA 4KZQA 5AL3A 4K4EA 3HKVA 4MT9A 4W5IA 2PQFA 4AVUA 4BJBA 4UVLA 4UVVA 3GOYA 4L0SA 2RD6A 4PNQA 4HLKA 4UVSA 4L33A 4TK5A 4L32A 4L6ZA 2PAWA 3MHKA 5AKWA 4BUYA 5EBTA 3CE0A 4PJVA 4PAXA 5ADSA 4TKFA 4L2FA 4R6EA 4UI6A 1PAXA 4UI5A 5AKUA 3L3LA 5FPGA 4BUIA 4PNNA 4UVTA 1GS0A
chains in the Genus database with same CATH superfamily
1OENA 4HKKA 1AQ2A 3SE2A 4N4VA 4AVWA 1WOKA 5LX6A 4TOSA 3GEYA 5C5RA 1UK0A 4UVWA 4U6AA 4BFPA 4TORA 4YWBA 5C5QA 1EFYA 4TVJA 2X5YA 4L2KA 4UI8A 4GNOA 4UVUA 4UX4A 4BU7A 4BUTA 4TK0A 4UVZA 3KJDA 5C5PA 3UH2A 3P0PA 2RK8A 4HLFA 3PAXA 2OLQA 3KCZA 4M7BA 1KHGA 4MSGA 4HLHA 4K4FA 3SMIA 4BJ9A 4L7LA 1II2A 5A00A 1OS1A 4BUSA 5FH3A 4L0VA 4UHGA 2QEYA 4HLMA 4UW1A 4BU8A 3KR7A 3UA9A 4BUUA 1KHBA 3MHJA 4UVYA 4R5WA 4LI8A 4UUHA 2RKDA 2RKAA 2PY7X 5ADTA 4PMLA 2QZYA 4L0TA 3DT2A 1A26A 3MOEA 4L31A 4OQBC 3C49A 3FHBA 4UXBA 2FAHA 4KRSA 2ZCIA 4HL5A 5AL1A 4UI3A 4BUDA 4ZZYA 2QEWA 4WPVA 4GNPA 1KHFA 2RCWA 3UH4A 3GJWA 4HKNA 4GV4A 2GMVA 4KZUA 3DT7A 1K3DA 1YLHA 4HHZA 4UVNA 4HKIA 5FH5A 1NHXA 4L7RA 4XHUA 4BU9A 4TJYA 2OLRA 3P0NA 4GMWA 4PNSA 5AL2A 4BUEA 4UVXA 4TKIA 5AEHA 5ECEA 4BUWA 4OX2A 4N3RA 4PNMA 4GV0A 4LI7A 4UFUA 4WIEA 4J22A 4BUVA 4F1LA 4OPXC 4WPTA 3C4HA 4UFYA 4BS4A 4BUIA 4UVPA 4L6SA 4L34A 4PNTA 4J1ZA 4L7OA 4IUEA 5ADQA 4GNMA 4LI6A 2RF5A 4UVOA 4L0BA 4ZZXA 4L7PA 4TJWA 4GNQA 4PNLA 4BU6A 4HHYA 5LXPA 4KZLA 2RK7A 4OA7A 4WIUA 3BLJA 5FH2A 5ADRA 4HLGA 4GMZA 4L09A 1XKVA 3UDDA 4DVIA 3GN7A 4TJUA 4BU3A 5FH0A 4L7UA 4F1QA 5DCZA 4BUFA 4PY4A 4UI7A 3MOHA 4L0IA 4HMHA 5FH1A 1UK1A 5AL5A 1YGGA 4MSKA 4GMUA 1M51A 3L3MA 3P0QA 4GV7A 2RKEA 5ETYA 3W51A 4OQAC 3DTBA 4W5SA 5AL4A 3U9YA 2PAXA 4WOUA 4GV2A 1KHEA 4BUAA 5LYHA 4J21A 4UNDA 4W6EA 4UI4A 4J3LA 4HYFA 4RV6A 2PC9A 2QF2A 2FAFA 4I9IA 4BUXA 4J3MA 4PNRA 3SMJA 1K3CA 4R43A 4BU5A 4L70A 4F0EA 4RCGA 4PJTA 4N4TA 4ZZZA 4L2GA 4L7NA 4TKGA 4L10A 3U9HA 4WPUA 5FPFA 4DQYC 3KR8A 3DT4A 4BJCA 4KZQA 5AL3A 4K4EA 3HKVA 4WL8A 4MT9A 4W5IA 2PQFA 4AVUA 4BJBA 4UVLA 5FH4A 4UVVA 3GOYA 4L0SA 4GNLA 2RD6A 3MOFA 5I67A 4PNQA 4HLKA 4UVSA 4L33A 4TK5A 4L32A 4L6ZA 4YWDA 2PAWA 3MHKA 4X52A 1AYLA 4GMMA 5AKWA 5EBTA 3CE0A 4PJVA 4BUYA 4PAXA 5ADSA 1YTMA 2PXZX 4TKFA 2QF1A 4L2FA 4R6EA 1J3BA 4UI6A 4YW9A 1PAXA 1YVYA 4UI5A 5AKUA 3L3LA 4YW8A 5FPGA 4PNNA 4UVTA 1GS0A
chains in the Genus database with same CATH topology
1OENA 4HKKA 1AQ2A 3SE2A 4N4VA 4AVWA 1WOKA 5LX6A 4TOSA 3GEYA 5C5RA 1UK0A 4UVWA 4U6AA 4BFPA 4TORA 4YWBA 5C5QA 1EFYA 4TVJA 2X5YA 4L2KA 4UI8A 4GNOA 4UVUA 4UX4A 4BU7A 4BUTA 4TK0A 4UVZA 3KJDA 5C5PA 3UH2A 3P0PA 2RK8A 4HLFA 3PAXA 2OLQA 3KCZA 4M7BA 1KHGA 4MSGA 4HLHA 4K4FA 3SMIA 4BJ9A 4L7LA 1II2A 5A00A 1OS1A 4BUSA 5FH3A 4L0VA 4UHGA 2QEYA 4HLMA 4UW1A 4BU8A 3KR7A 3UA9A 4BUUA 1KHBA 3MHJA 4UVYA 4R5WA 4LI8A 4UUHA 2RKDA 2RKAA 2PY7X 5ADTA 4PMLA 2QZYA 4L0TA 3DT2A 1A26A 3MOEA 4L31A 4OQBC 3C49A 3FHBA 4UXBA 2FAHA 4KRSA 2ZCIA 4HL5A 5AL1A 4UI3A 4BUDA 4ZZYA 2QEWA 4WPVA 4GNPA 1KHFA 2RCWA 3UH4A 3GJWA 4HKNA 4GV4A 2GMVA 4KZUA 3DT7A 1K3DA 1YLHA 4HHZA 4UVNA 4HKIA 5FH5A 1NHXA 4L7RA 4XHUA 4BU9A 4TJYA 2OLRA 3P0NA 4GMWA 4PNSA 5AL2A 4BUEA 4UVXA 4TKIA 5AEHA 5ECEA 4BUWA 4OX2A 4N3RA 4PNMA 4GV0A 4LI7A 4UFUA 4WIEA 4J22A 4BUVA 4F1LA 4OPXC 4WPTA 3C4HA 4UFYA 4BS4A 4BUIA 4UVPA 4L6SA 4L34A 4PNTA 4J1ZA 4L7OA 4IUEA 5ADQA 4GNMA 4LI6A 2RF5A 4UVOA 4L0BA 4ZZXA 4L7PA 4TJWA 4GNQA 4PNLA 4BU6A 4HHYA 5LXPA 4KZLA 2RK7A 4OA7A 4WIUA 3BLJA 5FH2A 5ADRA 4HLGA 4GMZA 4L09A 1XKVA 3UDDA 4DVIA 3GN7A 4TJUA 4BU3A 5FH0A 4L7UA 4F1QA 5DCZA 4BUFA 4PY4A 4UI7A 3MOHA 4L0IA 4HMHA 5FH1A 1UK1A 5AL5A 1YGGA 4MSKA 4GMUA 1M51A 3L3MA 3P0QA 4GV7A 2RKEA 5ETYA 3W51A 4OQAC 3DTBA 4W5SA 5AL4A 3U9YA 2PAXA 4WOUA 4GV2A 1KHEA 4BUAA 5LYHA 4J21A 4UNDA 4W6EA 4UI4A 4J3LA 4HYFA 4RV6A 2PC9A 2QF2A 2FAFA 4I9IA 4BUXA 4J3MA 4PNRA 3SMJA 1K3CA 4R43A 4BU5A 4L70A 4F0EA 4RCGA 4PJTA 4N4TA 4ZZZA 4L2GA 4L7NA 4TKGA 4L10A 3U9HA 4WPUA 5FPFA 4DQYC 3KR8A 3DT4A 4BJCA 4KZQA 5AL3A 4K4EA 3HKVA 4WL8A 4MT9A 4W5IA 2PQFA 4AVUA 4BJBA 4UVLA 5FH4A 4UVVA 3GOYA 4L0SA 4GNLA 2RD6A 3MOFA 5I67A 4PNQA 4HLKA 4UVSA 4L33A 4TK5A 4L32A 4L6ZA 4YWDA 2PAWA 3MHKA 4X52A 1AYLA 4GMMA 5AKWA 5EBTA 3CE0A 4PJVA 4BUYA 4PAXA 5ADSA 1YTMA 2PXZX 4TKFA 2QF1A 4L2FA 4R6EA 1J3BA 4UI6A 4YW9A 1PAXA 1YVYA 4UI5A 5AKUA 3L3LA 4YW8A 5FPGA 4PNNA 4UVTA 1GS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKK A;  3SE2 A;  4N4V A;  4AVW A;  1WOK A;  5LX6 A;  4TOS A;  3GEY A;  5C5R A;  1UK0 A;  4UVW A;  4U6A A;  4BFP A;  4TOR A;  5C5Q A;  1EFY A;  4TVJ A;  2X5Y A;  4L2K A;  4UI8 A;  4UVU A;  4BU7 A;  4UX4 A;  4BUT A;  4TK0 A;  4UVZ A;  3KJD A;  5C5P A;  3UH2 A;  3P0P A;  4HLF A;  4MSG A;  3PAX A;  4M7B A;  3KCZ A;  4X52 A;  4HLH A;  4K4F A;  3SMI A;  4BJ9 A;  4L7L A;  5A00 A;  4BUS A;  4L0V A;  4UHG A;  4HLM A;  4UW1 A;  4BU8 A;  3KR7 A;  3UA9 A;  4BUU A;  3MHJ A;  4UVY A;  4R5W A;  4LI8 A;  4UUH A;  5ADT A;  4PML A;  4L0T A;  4L31 A;  1A26 A;  4OQB C;  3C49 A;  3FHB A;  4UXB A;  4KRS A;  4HL5 A;  5AL1 A;  4UI3 A;  4BUD A;  4ZZY A;  2RCW A;  3UH4 A;  3GJW A;  4HKN A;  4GV4 A;  4KZU A;  4HHZ A;  4UVN A;  4HKI A;  4L7R A;  4XHU A;  4BU9 A;  4TJY A;  3P0N A;  4PNS A;  5AL2 A;  4BUE A;  4UVX A;  4TKI A;  5AEH A;  5ECE A;  4BUW A;  4N3R A;  4PNM A;  4GV0 A;  4LI7 A;  4UFU A;  4BUV A;  4J22 A;  4F1L A;  4OPX C;  3C4H A;  4UFY A;  4BS4 A;  4UVP A;  4L6S A;  4L34 A;  4PNT A;  4J1Z A;  4L7O A;  4IUE A;  5ADQ A;  4LI6 A;  2RF5 A;  4UVO A;  4L0B A;  4ZZX A;  4L7P A;  4TJW A;  4BU6 A;  4PNL A;  4HHY A;  5LXP A;  4KZL A;  4OA7 A;  3BLJ A;  5ADR A;  4HLG A;  4L09 A;  3UDD A;  4DVI A;  3GN7 A;  4TJU A;  4BU3 A;  4F1Q A;  4L7U A;  5DCZ A;  4BUF A;  4PY4 A;  4UI7 A;  4L0I A;  4HMH A;  1UK1 A;  5AL5 A;  4MSK A;  3P0Q A;  3L3M A;  4GV7 A;  5ETY A;  3W51 A;  4OQA C;  4W5S A;  5AL4 A;  3U9Y A;  2PAX A;  4GV2 A;  4BUA A;  5LYH A;  4J21 A;  4UND A;  4W6E A;  4UI4 A;  4J3L A;  4HYF A;  4RV6 A;  4I9I A;  4BUX A;  4J3M A;  4PNR A;  3SMJ A;  4BU5 A;  4F0E A;  4L70 A;  4PJT A;  4N4T A;  4ZZZ A;  4L2G A;  4L7N A;  4TKG A;  4L10 A;  3U9H A;  5FPF A;  4DQY C;  3KR8 A;  4BJC A;  4KZQ A;  5AL3 A;  4K4E A;  3HKV A;  4MT9 A;  4W5I A;  2PQF A;  4AVU A;  4BJB A;  4UVL A;  4UVV A;  3GOY A;  4L0S A;  2RD6 A;  4PNQ A;  4HLK A;  4UVS A;  4L33 A;  4TK5 A;  4L32 A;  4L6Z A;  2PAW A;  3MHK A;  5AKW A;  4BUY A;  5EBT A;  3CE0 A;  4PJV A;  4PAX A;  5ADS A;  4TKF A;  4L2F A;  4R6E A;  4UI6 A;  1PAX A;  4UI5 A;  5AKU A;  3L3L A;  5FPG A;  4BUI A;  4PNN A;  4UVT A;  1GS0 A; 
#chains in the Genus database with same CATH topology
 1OEN A;  4HKK A;  1AQ2 A;  3SE2 A;  4N4V A;  4AVW A;  1WOK A;  5LX6 A;  4TOS A;  3GEY A;  5C5R A;  1UK0 A;  4UVW A;  4U6A A;  4BFP A;  4TOR A;  4YWB A;  5C5Q A;  1EFY A;  4TVJ A;  2X5Y A;  4L2K A;  4UI8 A;  4GNO A;  4UVU A;  4UX4 A;  4BU7 A;  4BUT A;  4TK0 A;  4UVZ A;  3KJD A;  5C5P A;  3UH2 A;  3P0P A;  2RK8 A;  4HLF A;  3PAX A;  2OLQ A;  3KCZ A;  4M7B A;  1KHG A;  4MSG A;  4HLH A;  4K4F A;  3SMI A;  4BJ9 A;  4L7L A;  1II2 A;  5A00 A;  1OS1 A;  4BUS A;  5FH3 A;  4L0V A;  4UHG A;  2QEY A;  4HLM A;  4UW1 A;  4BU8 A;  3KR7 A;  3UA9 A;  4BUU A;  1KHB A;  3MHJ A;  4UVY A;  4R5W A;  4LI8 A;  4UUH A;  2RKD A;  2RKA A;  2PY7 X;  5ADT A;  4PML A;  2QZY A;  4L0T A;  3DT2 A;  1A26 A;  3MOE A;  4L31 A;  4OQB C;  3C49 A;  3FHB A;  4UXB A;  2FAH A;  4KRS A;  2ZCI A;  4HL5 A;  5AL1 A;  4UI3 A;  4BUD A;  4ZZY A;  2QEW A;  4WPV A;  4GNP A;  1KHF A;  2RCW A;  3UH4 A;  3GJW A;  4HKN A;  4GV4 A;  2GMV A;  4KZU A;  3DT7 A;  1K3D A;  1YLH A;  4HHZ A;  4UVN A;  4HKI A;  5FH5 A;  1NHX A;  4L7R A;  4XHU A;  4BU9 A;  4TJY A;  2OLR A;  3P0N A;  4GMW A;  4PNS A;  5AL2 A;  4BUE A;  4UVX A;  4TKI A;  5AEH A;  5ECE A;  4BUW A;  4OX2 A;  4N3R A;  4PNM A;  4GV0 A;  4LI7 A;  4UFU A;  4WIE A;  4J22 A;  4BUV A;  4F1L A;  4OPX C;  4WPT A;  3C4H A;  4UFY A;  4BS4 A;  4BUI A;  4UVP A;  4L6S A;  4L34 A;  4PNT A;  4J1Z A;  4L7O A;  4IUE A;  5ADQ A;  4GNM A;  4LI6 A;  2RF5 A;  4UVO A;  4L0B A;  4ZZX A;  4L7P A;  4TJW A;  4GNQ A;  4PNL A;  4BU6 A;  4HHY A;  5LXP A;  4KZL A;  2RK7 A;  4OA7 A;  4WIU A;  3BLJ A;  5FH2 A;  5ADR A;  4HLG A;  4GMZ A;  4L09 A;  1XKV A;  3UDD A;  4DVI A;  3GN7 A;  4TJU A;  4BU3 A;  5FH0 A;  4L7U A;  4F1Q A;  5DCZ A;  4BUF A;  4PY4 A;  4UI7 A;  3MOH A;  4L0I A;  4HMH A;  5FH1 A;  1UK1 A;  5AL5 A;  1YGG A;  4MSK A;  4GMU A;  1M51 A;  3L3M A;  3P0Q A;  4GV7 A;  2RKE A;  5ETY A;  3W51 A;  4OQA C;  3DTB A;  4W5S A;  5AL4 A;  3U9Y A;  2PAX A;  4WOU A;  4GV2 A;  1KHE A;  4BUA A;  5LYH A;  4J21 A;  4UND A;  4W6E A;  4UI4 A;  4J3L A;  4HYF A;  4RV6 A;  2PC9 A;  2QF2 A;  2FAF A;  4I9I A;  4BUX A;  4J3M A;  4PNR A;  3SMJ A;  1K3C A;  4R43 A;  4BU5 A;  4L70 A;  4F0E A;  4RCG A;  4PJT A;  4N4T A;  4ZZZ A;  4L2G A;  4L7N A;  4TKG A;  4L10 A;  3U9H A;  4WPU A;  5FPF A;  4DQY C;  3KR8 A;  3DT4 A;  4BJC A;  4KZQ A;  5AL3 A;  4K4E A;  3HKV A;  4WL8 A;  4MT9 A;  4W5I A;  2PQF A;  4AVU A;  4BJB A;  4UVL A;  5FH4 A;  4UVV A;  3GOY A;  4L0S A;  4GNL A;  2RD6 A;  3MOF A;  5I67 A;  4PNQ A;  4HLK A;  4UVS A;  4L33 A;  4TK5 A;  4L32 A;  4L6Z A;  4YWD A;  2PAW A;  3MHK A;  4X52 A;  1AYL A;  4GMM A;  5AKW A;  5EBT A;  3CE0 A;  4PJV A;  4BUY A;  4PAX A;  5ADS A;  1YTM A;  2PXZ X;  4TKF A;  2QF1 A;  4L2F A;  4R6E A;  1J3B A;  4UI6 A;  4YW9 A;  1PAX A;  1YVY A;  4UI5 A;  5AKU A;  3L3L A;  4YW8 A;  5FPG A;  4PNN A;  4UVT A;  1GS0 A; 
#chains in the Genus database with same CATH homology
 1OEN A;  4HKK A;  1AQ2 A;  3SE2 A;  4N4V A;  4AVW A;  1WOK A;  5LX6 A;  4TOS A;  3GEY A;  5C5R A;  1UK0 A;  4UVW A;  4U6A A;  4BFP A;  4TOR A;  4YWB A;  5C5Q A;  1EFY A;  4TVJ A;  2X5Y A;  4L2K A;  4UI8 A;  4GNO A;  4UVU A;  4UX4 A;  4BU7 A;  4BUT A;  4TK0 A;  4UVZ A;  3KJD A;  5C5P A;  3UH2 A;  3P0P A;  2RK8 A;  4HLF A;  3PAX A;  2OLQ A;  3KCZ A;  4M7B A;  1KHG A;  4MSG A;  4HLH A;  4K4F A;  3SMI A;  4BJ9 A;  4L7L A;  1II2 A;  5A00 A;  1OS1 A;  4BUS A;  5FH3 A;  4L0V A;  4UHG A;  2QEY A;  4HLM A;  4UW1 A;  4BU8 A;  3KR7 A;  3UA9 A;  4BUU A;  1KHB A;  3MHJ A;  4UVY A;  4R5W A;  4LI8 A;  4UUH A;  2RKD A;  2RKA A;  2PY7 X;  5ADT A;  4PML A;  2QZY A;  4L0T A;  3DT2 A;  1A26 A;  3MOE A;  4L31 A;  4OQB C;  3C49 A;  3FHB A;  4UXB A;  2FAH A;  4KRS A;  2ZCI A;  4HL5 A;  5AL1 A;  4UI3 A;  4BUD A;  4ZZY A;  2QEW A;  4WPV A;  4GNP A;  1KHF A;  2RCW A;  3UH4 A;  3GJW A;  4HKN A;  4GV4 A;  2GMV A;  4KZU A;  3DT7 A;  1K3D A;  1YLH A;  4HHZ A;  4UVN A;  4HKI A;  5FH5 A;  1NHX A;  4L7R A;  4XHU A;  4BU9 A;  4TJY A;  2OLR A;  3P0N A;  4GMW A;  4PNS A;  5AL2 A;  4BUE A;  4UVX A;  4TKI A;  5AEH A;  5ECE A;  4BUW A;  4OX2 A;  4N3R A;  4PNM A;  4GV0 A;  4LI7 A;  4UFU A;  4WIE A;  4J22 A;  4BUV A;  4F1L A;  4OPX C;  4WPT A;  3C4H A;  4UFY A;  4BS4 A;  4BUI A;  4UVP A;  4L6S A;  4L34 A;  4PNT A;  4J1Z A;  4L7O A;  4IUE A;  5ADQ A;  4GNM A;  4LI6 A;  2RF5 A;  4UVO A;  4L0B A;  4ZZX A;  4L7P A;  4TJW A;  4GNQ A;  4PNL A;  4BU6 A;  4HHY A;  5LXP A;  4KZL A;  2RK7 A;  4OA7 A;  4WIU A;  3BLJ A;  5FH2 A;  5ADR A;  4HLG A;  4GMZ A;  4L09 A;  1XKV A;  3UDD A;  4DVI A;  3GN7 A;  4TJU A;  4BU3 A;  5FH0 A;  4L7U A;  4F1Q A;  5DCZ A;  4BUF A;  4PY4 A;  4UI7 A;  3MOH A;  4L0I A;  4HMH A;  5FH1 A;  1UK1 A;  5AL5 A;  1YGG A;  4MSK A;  4GMU A;  1M51 A;  3L3M A;  3P0Q A;  4GV7 A;  2RKE A;  5ETY A;  3W51 A;  4OQA C;  3DTB A;  4W5S A;  5AL4 A;  3U9Y A;  2PAX A;  4WOU A;  4GV2 A;  1KHE A;  4BUA A;  5LYH A;  4J21 A;  4UND A;  4W6E A;  4UI4 A;  4J3L A;  4HYF A;  4RV6 A;  2PC9 A;  2QF2 A;  2FAF A;  4I9I A;  4BUX A;  4J3M A;  4PNR A;  3SMJ A;  1K3C A;  4R43 A;  4BU5 A;  4L70 A;  4F0E A;  4RCG A;  4PJT A;  4N4T A;  4ZZZ A;  4L2G A;  4L7N A;  4TKG A;  4L10 A;  3U9H A;  4WPU A;  5FPF A;  4DQY C;  3KR8 A;  3DT4 A;  4BJC A;  4KZQ A;  5AL3 A;  4K4E A;  3HKV A;  4WL8 A;  4MT9 A;  4W5I A;  2PQF A;  4AVU A;  4BJB A;  4UVL A;  5FH4 A;  4UVV A;  3GOY A;  4L0S A;  4GNL A;  2RD6 A;  3MOF A;  5I67 A;  4PNQ A;  4HLK A;  4UVS A;  4L33 A;  4TK5 A;  4L32 A;  4L6Z A;  4YWD A;  2PAW A;  3MHK A;  4X52 A;  1AYL A;  4GMM A;  5AKW A;  5EBT A;  3CE0 A;  4PJV A;  4BUY A;  4PAX A;  5ADS A;  1YTM A;  2PXZ X;  4TKF A;  2QF1 A;  4L2F A;  4R6E A;  1J3B A;  4UI6 A;  4YW9 A;  1PAX A;  1YVY A;  4UI5 A;  5AKU A;  3L3L A;  4YW8 A;  5FPG A;  4PNN A;  4UVT A;  1GS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...