4BUXA

Crystal structure of human tankyrase 2 in complex with 3-((4-(4-oxo-3, 4-dihydroquinazolin-2-yl)phenyl)methyl)imidazolidine-2,4-dione
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 208
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buxA00
4L6ZA 4GV7A 4LI8A 4HYFA 4BUSA 4MSGA 3U9YA 3BLJA 4DVIA 4UVOA 4ZZZA 4UVUA 4J21A 2RF5A 4UUHA 4BUXA 4R6EA 4J3LA 4OPXC 4UVXA 4PJVA 4BJCA 5AL1A 1UK1A 4N3RA 4J1ZA 4MSKA 4KRSA 1WOKA 4PAXA 5LX6A 4L33A 4PNTA 4TJUA 4GV4A 4UI4A 4HLGA 2RCWA 4L0BA 4PNMA 5C5RA 4UHGA 3CE0A 4L09A 4L0VA 3L3MA 1UK0A 4L32A 4PNQA 4TVJA 4UVWA 4L0TA 4HHYA 3U9HA 5AKUA 4TK0A 4PJTA 4W5SA 5ETYA 4BUIA 5AL3A 4R5WA 4AVUA 4PNSA 4UVYA 4ZZXA 3UDDA 4PNRA 3P0PA 4MT9A 4HHZA 4BUUA 4UNDA 5A00A 4L7PA 3KJDA 2PAXA 4L7UA 4LI6A 3UA9A 5ADQA 3HKVA 5AEHA 4BU3A 5FPGA 5ADTA 4UI3A 4BU7A 4UVTA 4K4FA 4OQBC 3GJWA 4X52A 4GV2A 3GOYA 5LYHA 4I9IA 5ADSA 4L0IA 4BUFA 4F0EA 4BUTA 4PY4A 1EFYA 4HL5A 4BS4A 1PAXA 4BU6A 4BUAA 1GS0A 4TORA 4GV0A 3KR7A 4IUEA 3C4HA 4HLHA 4KZQA 4UVLA 4N4VA 4BUWA 3PAXA 4UW1A 4UI8A 4BUDA 5LXPA 4HLKA 4UVVA 4W5IA 2RD6A 4UFUA 3P0QA 4AVWA 4L2KA 4LI7A 5AL2A 4TK5A 4PNLA 4BUEA 5ADRA 2X5YA 3GEYA 4PMLA 3FHBA 3L3LA 2PAWA 4J22A 4UXBA 5EBTA 4DQYC 3MHKA 2PQFA 5DCZA 4HLFA 3UH4A 4ZZYA 5ECEA 4OQAC 4HMHA 4BUVA 4L0SA 4F1LA 4K4EA 4TOSA 3W51A 4L6SA 4L70A 4L7LA 4M7BA 5AL5A 3UH2A 4PNNA 4TJYA 4UX4A 4KZUA 4J3MA 3KCZA 4UVNA 1A26A 3GN7A 4BU9A 4UI6A 4UI5A 5AKWA 4OA7A 4BJ9A 4KZLA 4F1QA 3SMIA 5AL4A 4U6AA 3MHJA 4HKKA 4L34A 4TKGA 4UI7A 4BU5A 4N4TA 4HKIA 3P0NA 4BU8A 4UVPA 4UVZA 3C49A 4XHUA 4BJBA 5FPFA 4W6EA 5C5PA 3KR8A 4HLMA 4TKFA 4BUYA 4L7OA 4UVSA 4L10A 4L31A 4UFYA 4RV6A 4L7NA 4TKIA 3SE2A 3SMJA 4HKNA 5C5QA 4L7RA 4TJWA 4L2FA 4BFPA 4L2GA
chains in the Genus database with same CATH superfamily
2OLQA 4L6ZA 2QEYA 2FAHA 4GV7A 4LI8A 4HYFA 4BUSA 4MSGA 3U9YA 3BLJA 4DVIA 4UVOA 4ZZZA 1AQ2A 4UVUA 4J21A 2RF5A 4UUHA 4BUXA 4R6EA 2PC9A 4J3LA 4OPXC 4UVXA 4PJVA 1YTMA 2RK7A 4GMUA 4RCGA 4BJCA 5AL1A 1UK1A 4GNQA 4N3RA 2RK8A 4J1ZA 4MSKA 4KRSA 5FH1A 1WOKA 4PAXA 5LX6A 1KHGA 1YGGA 4L33A 4GV4A 4PNTA 4HLGA 2RCWA 4L0BA 4PNMA 3MOFA 4UI4A 3CE0A 5C5RA 4UHGA 5I67A 2OLRA 4WPTA 4L09A 4L0VA 3L3MA 1UK0A 4L32A 4PNQA 4TVJA 2PY7X 4UVWA 4L0TA 4HHYA 3U9HA 5AKUA 4TK0A 2RKAA 4PJTA 4W5SA 5ETYA 4BUIA 1KHBA 3MOEA 4GMWA 4R5WA 5AL3A 4AVUA 4PNSA 1OS1A 2RKEA 4UVYA 4PNRA 3P0PA 4YW8A 4ZZXA 4MT9A 3UDDA 4HHZA 4BUUA 4UNDA 5A00A 4L7PA 3KJDA 2PAXA 4L7UA 4LI6A 3UA9A 5ADQA 3HKVA 5AEHA 4BU3A 5FPGA 5ADTA 4UI3A 4BU7A 4UVTA 4K4FA 1K3DA 1AYLA 1K3CA 4OQBC 3GJWA 1II2A 4GV2A 4R43A 3GOYA 4GNPA 4X52A 4I9IA 5ADSA 4L0IA 4OX2A 4TJUA 4BUFA 4F0EA 5LYHA 4BUTA 4PY4A 1EFYA 4HL5A 4BS4A 4WIEA 1PAXA 4GNLA 1NHXA 4BU6A 4BUAA 1GS0A 4TORA 4GV0A 3KR7A 4IUEA 3C4HA 4HLHA 3DT7A 4KZQA 4UVLA 4N4VA 4BUWA 3PAXA 4UW1A 4UI8A 4BUDA 5LXPA 4HLKA 3MOHA 4UVVA 4W5IA 2RD6A 1M51A 1YLHA 3P0QA 4L2KA 4LI7A 1J3BA 4UFUA 5AL2A 4AVWA 4TK5A 4PNLA 4BUEA 5ADRA 2ZCIA 2X5YA 3GEYA 4WPVA 4PMLA 3FHBA 3L3LA 2PAWA 4GMZA 4J22A 4UXBA 5EBTA 4DQYC 2QF2A 3MHKA 2PQFA 4GNMA 4HLFA 5DCZA 3UH4A 4ZZYA 4YWBA 2QZYA 4GNOA 4WOUA 5ECEA 4OQAC 4YW9A 4HMHA 4BUVA 4L0SA 4YWDA 4F1LA 4K4EA 4TOSA 3W51A 1XKVA 2QEWA 4L6SA 4L70A 4L7LA 4M7BA 5AL5A 3UH2A 4PNNA 4TJYA 4UX4A 4KZUA 4J3MA 3KCZA 4UVNA 3DT4A 4WPUA 1A26A 3GN7A 4BU9A 4UI6A 2GMVA 4UI5A 5AKWA 4OA7A 4GMMA 5FH2A 4BJ9A 4KZLA 4F1QA 1KHFA 2PXZX 5AL4A 3SMIA 4U6AA 5FH0A 3MHJA 5FH5A 4HKKA 4L34A 4TKGA 4UI7A 4BU5A 1YVYA 4N4TA 4HKIA 3P0NA 4BU8A 4UVPA 4UVZA 3C49A 4XHUA 4BJBA 3DT2A 5FPFA 5FH4A 4W6EA 5C5PA 2FAFA 1KHEA 3KR8A 4HLMA 4TKFA 1OENA 4BUYA 4L7OA 4UVSA 3DTBA 4L31A 4L10A 4UFYA 4RV6A 4L7NA 4TKIA 3SE2A 3SMJA 4HKNA 5C5QA 4WIUA 2RKDA 4L7RA 4TJWA 5FH3A 4L2FA 4WL8A 4BFPA 2QF1A 4L2GA
chains in the Genus database with same CATH topology
2OLQA 4L6ZA 2QEYA 2FAHA 4GV7A 4LI8A 4HYFA 4BUSA 4MSGA 3U9YA 3BLJA 4DVIA 4UVOA 4ZZZA 1AQ2A 4UVUA 4J21A 2RF5A 4UUHA 4BUXA 4R6EA 2PC9A 4J3LA 4OPXC 4UVXA 4PJVA 1YTMA 2RK7A 4GMUA 4RCGA 4BJCA 5AL1A 1UK1A 4GNQA 4N3RA 2RK8A 4J1ZA 4MSKA 4KRSA 5FH1A 1WOKA 4PAXA 5LX6A 1KHGA 1YGGA 4L33A 4GV4A 4PNTA 4HLGA 2RCWA 4L0BA 4PNMA 3MOFA 4UI4A 3CE0A 5C5RA 4UHGA 5I67A 2OLRA 4WPTA 4L09A 4L0VA 3L3MA 1UK0A 4L32A 4PNQA 4TVJA 2PY7X 4UVWA 4L0TA 4HHYA 3U9HA 5AKUA 4TK0A 2RKAA 4PJTA 4W5SA 5ETYA 4BUIA 1KHBA 3MOEA 4GMWA 4R5WA 5AL3A 4AVUA 4PNSA 1OS1A 2RKEA 4UVYA 4PNRA 3P0PA 4YW8A 4ZZXA 4MT9A 3UDDA 4HHZA 4BUUA 4UNDA 5A00A 4L7PA 3KJDA 2PAXA 4L7UA 4LI6A 3UA9A 5ADQA 3HKVA 5AEHA 4BU3A 5FPGA 5ADTA 4UI3A 4BU7A 4UVTA 4K4FA 1K3DA 1AYLA 1K3CA 4OQBC 3GJWA 1II2A 4GV2A 4R43A 3GOYA 4GNPA 4X52A 4I9IA 5ADSA 4L0IA 4OX2A 4TJUA 4BUFA 4F0EA 5LYHA 4BUTA 4PY4A 1EFYA 4HL5A 4BS4A 4WIEA 1PAXA 4GNLA 1NHXA 4BU6A 4BUAA 1GS0A 4TORA 4GV0A 3KR7A 4IUEA 3C4HA 4HLHA 3DT7A 4KZQA 4UVLA 4N4VA 4BUWA 3PAXA 4UW1A 4UI8A 4BUDA 5LXPA 4HLKA 3MOHA 4UVVA 4W5IA 2RD6A 1M51A 1YLHA 3P0QA 4L2KA 4LI7A 1J3BA 4UFUA 5AL2A 4AVWA 4TK5A 4PNLA 4BUEA 5ADRA 2ZCIA 2X5YA 3GEYA 4WPVA 4PMLA 3FHBA 3L3LA 2PAWA 4GMZA 4J22A 4UXBA 5EBTA 4DQYC 2QF2A 3MHKA 2PQFA 4GNMA 4HLFA 5DCZA 3UH4A 4ZZYA 4YWBA 2QZYA 4GNOA 4WOUA 5ECEA 4OQAC 4YW9A 4HMHA 4BUVA 4L0SA 4YWDA 4F1LA 4K4EA 4TOSA 3W51A 1XKVA 2QEWA 4L6SA 4L70A 4L7LA 4M7BA 5AL5A 3UH2A 4PNNA 4TJYA 4UX4A 4KZUA 4J3MA 3KCZA 4UVNA 3DT4A 4WPUA 1A26A 3GN7A 4BU9A 4UI6A 2GMVA 4UI5A 5AKWA 4OA7A 4GMMA 5FH2A 4BJ9A 4KZLA 4F1QA 1KHFA 2PXZX 5AL4A 3SMIA 4U6AA 5FH0A 3MHJA 5FH5A 4HKKA 4L34A 4TKGA 4UI7A 4BU5A 1YVYA 4N4TA 4HKIA 3P0NA 4BU8A 4UVPA 4UVZA 3C49A 4XHUA 4BJBA 3DT2A 5FPFA 5FH4A 4W6EA 5C5PA 2FAFA 1KHEA 3KR8A 4HLMA 4TKFA 1OENA 4BUYA 4L7OA 4UVSA 3DTBA 4L31A 4L10A 4UFYA 4RV6A 4L7NA 4TKIA 3SE2A 3SMJA 4HKNA 5C5QA 4WIUA 2RKDA 4L7RA 4TJWA 5FH3A 4L2FA 4WL8A 4BFPA 2QF1A 4L2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6Z A;  4GV7 A;  4LI8 A;  4HYF A;  4BUS A;  4MSG A;  3U9Y A;  3BLJ A;  4DVI A;  4UVO A;  4ZZZ A;  4UVU A;  4J21 A;  2RF5 A;  4UUH A;  4BUX A;  4R6E A;  4J3L A;  4OPX C;  4UVX A;  4PJV A;  4BJC A;  5AL1 A;  1UK1 A;  4N3R A;  4J1Z A;  4MSK A;  4KRS A;  1WOK A;  4PAX A;  5LX6 A;  4L33 A;  4PNT A;  4TJU A;  4GV4 A;  4UI4 A;  4HLG A;  2RCW A;  4L0B A;  4PNM A;  5C5R A;  4UHG A;  3CE0 A;  4L09 A;  4L0V A;  3L3M A;  1UK0 A;  4L32 A;  4PNQ A;  4TVJ A;  4UVW A;  4L0T A;  4HHY A;  3U9H A;  5AKU A;  4TK0 A;  4PJT A;  4W5S A;  5ETY A;  4BUI A;  5AL3 A;  4R5W A;  4AVU A;  4PNS A;  4UVY A;  4ZZX A;  3UDD A;  4PNR A;  3P0P A;  4MT9 A;  4HHZ A;  4BUU A;  4UND A;  5A00 A;  4L7P A;  3KJD A;  2PAX A;  4L7U A;  4LI6 A;  3UA9 A;  5ADQ A;  3HKV A;  5AEH A;  4BU3 A;  5FPG A;  5ADT A;  4UI3 A;  4BU7 A;  4UVT A;  4K4F A;  4OQB C;  3GJW A;  4X52 A;  4GV2 A;  3GOY A;  5LYH A;  4I9I A;  5ADS A;  4L0I A;  4BUF A;  4F0E A;  4BUT A;  4PY4 A;  1EFY A;  4HL5 A;  4BS4 A;  1PAX A;  4BU6 A;  4BUA A;  1GS0 A;  4TOR A;  4GV0 A;  3KR7 A;  4IUE A;  3C4H A;  4HLH A;  4KZQ A;  4UVL A;  4N4V A;  4BUW A;  3PAX A;  4UW1 A;  4UI8 A;  4BUD A;  5LXP A;  4HLK A;  4UVV A;  4W5I A;  2RD6 A;  4UFU A;  3P0Q A;  4AVW A;  4L2K A;  4LI7 A;  5AL2 A;  4TK5 A;  4PNL A;  4BUE A;  5ADR A;  2X5Y A;  3GEY A;  4PML A;  3FHB A;  3L3L A;  2PAW A;  4J22 A;  4UXB A;  5EBT A;  4DQY C;  3MHK A;  2PQF A;  5DCZ A;  4HLF A;  3UH4 A;  4ZZY A;  5ECE A;  4OQA C;  4HMH A;  4BUV A;  4L0S A;  4F1L A;  4K4E A;  4TOS A;  3W51 A;  4L6S A;  4L70 A;  4L7L A;  4M7B A;  5AL5 A;  3UH2 A;  4PNN A;  4TJY A;  4UX4 A;  4KZU A;  4J3M A;  3KCZ A;  4UVN A;  1A26 A;  3GN7 A;  4BU9 A;  4UI6 A;  4UI5 A;  5AKW A;  4OA7 A;  4BJ9 A;  4KZL A;  4F1Q A;  3SMI A;  5AL4 A;  4U6A A;  3MHJ A;  4HKK A;  4L34 A;  4TKG A;  4UI7 A;  4BU5 A;  4N4T A;  4HKI A;  3P0N A;  4BU8 A;  4UVP A;  4UVZ A;  3C49 A;  4XHU A;  4BJB A;  5FPF A;  4W6E A;  5C5P A;  3KR8 A;  4HLM A;  4TKF A;  4BUY A;  4L7O A;  4UVS A;  4L10 A;  4L31 A;  4UFY A;  4RV6 A;  4L7N A;  4TKI A;  3SE2 A;  3SMJ A;  4HKN A;  5C5Q A;  4L7R A;  4TJW A;  4L2F A;  4BFP A;  4L2G A; 
#chains in the Genus database with same CATH topology
 2OLQ A;  4L6Z A;  2QEY A;  2FAH A;  4GV7 A;  4LI8 A;  4HYF A;  4BUS A;  4MSG A;  3U9Y A;  3BLJ A;  4DVI A;  4UVO A;  4ZZZ A;  1AQ2 A;  4UVU A;  4J21 A;  2RF5 A;  4UUH A;  4BUX A;  4R6E A;  2PC9 A;  4J3L A;  4OPX C;  4UVX A;  4PJV A;  1YTM A;  2RK7 A;  4GMU A;  4RCG A;  4BJC A;  5AL1 A;  1UK1 A;  4GNQ A;  4N3R A;  2RK8 A;  4J1Z A;  4MSK A;  4KRS A;  5FH1 A;  1WOK A;  4PAX A;  5LX6 A;  1KHG A;  1YGG A;  4L33 A;  4GV4 A;  4PNT A;  4HLG A;  2RCW A;  4L0B A;  4PNM A;  3MOF A;  4UI4 A;  3CE0 A;  5C5R A;  4UHG A;  5I67 A;  2OLR A;  4WPT A;  4L09 A;  4L0V A;  3L3M A;  1UK0 A;  4L32 A;  4PNQ A;  4TVJ A;  2PY7 X;  4UVW A;  4L0T A;  4HHY A;  3U9H A;  5AKU A;  4TK0 A;  2RKA A;  4PJT A;  4W5S A;  5ETY A;  4BUI A;  1KHB A;  3MOE A;  4GMW A;  4R5W A;  5AL3 A;  4AVU A;  4PNS A;  1OS1 A;  2RKE A;  4UVY A;  4PNR A;  3P0P A;  4YW8 A;  4ZZX A;  4MT9 A;  3UDD A;  4HHZ A;  4BUU A;  4UND A;  5A00 A;  4L7P A;  3KJD A;  2PAX A;  4L7U A;  4LI6 A;  3UA9 A;  5ADQ A;  3HKV A;  5AEH A;  4BU3 A;  5FPG A;  5ADT A;  4UI3 A;  4BU7 A;  4UVT A;  4K4F A;  1K3D A;  1AYL A;  1K3C A;  4OQB C;  3GJW A;  1II2 A;  4GV2 A;  4R43 A;  3GOY A;  4GNP A;  4X52 A;  4I9I A;  5ADS A;  4L0I A;  4OX2 A;  4TJU A;  4BUF A;  4F0E A;  5LYH A;  4BUT A;  4PY4 A;  1EFY A;  4HL5 A;  4BS4 A;  4WIE A;  1PAX A;  4GNL A;  1NHX A;  4BU6 A;  4BUA A;  1GS0 A;  4TOR A;  4GV0 A;  3KR7 A;  4IUE A;  3C4H A;  4HLH A;  3DT7 A;  4KZQ A;  4UVL A;  4N4V A;  4BUW A;  3PAX A;  4UW1 A;  4UI8 A;  4BUD A;  5LXP A;  4HLK A;  3MOH A;  4UVV A;  4W5I A;  2RD6 A;  1M51 A;  1YLH A;  3P0Q A;  4L2K A;  4LI7 A;  1J3B A;  4UFU A;  5AL2 A;  4AVW A;  4TK5 A;  4PNL A;  4BUE A;  5ADR A;  2ZCI A;  2X5Y A;  3GEY A;  4WPV A;  4PML A;  3FHB A;  3L3L A;  2PAW A;  4GMZ A;  4J22 A;  4UXB A;  5EBT A;  4DQY C;  2QF2 A;  3MHK A;  2PQF A;  4GNM A;  4HLF A;  5DCZ A;  3UH4 A;  4ZZY A;  4YWB A;  2QZY A;  4GNO A;  4WOU A;  5ECE A;  4OQA C;  4YW9 A;  4HMH A;  4BUV A;  4L0S A;  4YWD A;  4F1L A;  4K4E A;  4TOS A;  3W51 A;  1XKV A;  2QEW A;  4L6S A;  4L70 A;  4L7L A;  4M7B A;  5AL5 A;  3UH2 A;  4PNN A;  4TJY A;  4UX4 A;  4KZU A;  4J3M A;  3KCZ A;  4UVN A;  3DT4 A;  4WPU A;  1A26 A;  3GN7 A;  4BU9 A;  4UI6 A;  2GMV A;  4UI5 A;  5AKW A;  4OA7 A;  4GMM A;  5FH2 A;  4BJ9 A;  4KZL A;  4F1Q A;  1KHF A;  2PXZ X;  5AL4 A;  3SMI A;  4U6A A;  5FH0 A;  3MHJ A;  5FH5 A;  4HKK A;  4L34 A;  4TKG A;  4UI7 A;  4BU5 A;  1YVY A;  4N4T A;  4HKI A;  3P0N A;  4BU8 A;  4UVP A;  4UVZ A;  3C49 A;  4XHU A;  4BJB A;  3DT2 A;  5FPF A;  5FH4 A;  4W6E A;  5C5P A;  2FAF A;  1KHE A;  3KR8 A;  4HLM A;  4TKF A;  1OEN A;  4BUY A;  4L7O A;  4UVS A;  3DTB A;  4L31 A;  4L10 A;  4UFY A;  4RV6 A;  4L7N A;  4TKI A;  3SE2 A;  3SMJ A;  4HKN A;  5C5Q A;  4WIU A;  2RKD A;  4L7R A;  4TJW A;  5FH3 A;  4L2F A;  4WL8 A;  4BFP A;  2QF1 A;  4L2G A; 
#chains in the Genus database with same CATH homology
 2OLQ A;  4L6Z A;  2QEY A;  2FAH A;  4GV7 A;  4LI8 A;  4HYF A;  4BUS A;  4MSG A;  3U9Y A;  3BLJ A;  4DVI A;  4UVO A;  4ZZZ A;  1AQ2 A;  4UVU A;  4J21 A;  2RF5 A;  4UUH A;  4BUX A;  4R6E A;  2PC9 A;  4J3L A;  4OPX C;  4UVX A;  4PJV A;  1YTM A;  2RK7 A;  4GMU A;  4RCG A;  4BJC A;  5AL1 A;  1UK1 A;  4GNQ A;  4N3R A;  2RK8 A;  4J1Z A;  4MSK A;  4KRS A;  5FH1 A;  1WOK A;  4PAX A;  5LX6 A;  1KHG A;  1YGG A;  4L33 A;  4GV4 A;  4PNT A;  4HLG A;  2RCW A;  4L0B A;  4PNM A;  3MOF A;  4UI4 A;  3CE0 A;  5C5R A;  4UHG A;  5I67 A;  2OLR A;  4WPT A;  4L09 A;  4L0V A;  3L3M A;  1UK0 A;  4L32 A;  4PNQ A;  4TVJ A;  2PY7 X;  4UVW A;  4L0T A;  4HHY A;  3U9H A;  5AKU A;  4TK0 A;  2RKA A;  4PJT A;  4W5S A;  5ETY A;  4BUI A;  1KHB A;  3MOE A;  4GMW A;  4R5W A;  5AL3 A;  4AVU A;  4PNS A;  1OS1 A;  2RKE A;  4UVY A;  4PNR A;  3P0P A;  4YW8 A;  4ZZX A;  4MT9 A;  3UDD A;  4HHZ A;  4BUU A;  4UND A;  5A00 A;  4L7P A;  3KJD A;  2PAX A;  4L7U A;  4LI6 A;  3UA9 A;  5ADQ A;  3HKV A;  5AEH A;  4BU3 A;  5FPG A;  5ADT A;  4UI3 A;  4BU7 A;  4UVT A;  4K4F A;  1K3D A;  1AYL A;  1K3C A;  4OQB C;  3GJW A;  1II2 A;  4GV2 A;  4R43 A;  3GOY A;  4GNP A;  4X52 A;  4I9I A;  5ADS A;  4L0I A;  4OX2 A;  4TJU A;  4BUF A;  4F0E A;  5LYH A;  4BUT A;  4PY4 A;  1EFY A;  4HL5 A;  4BS4 A;  4WIE A;  1PAX A;  4GNL A;  1NHX A;  4BU6 A;  4BUA A;  1GS0 A;  4TOR A;  4GV0 A;  3KR7 A;  4IUE A;  3C4H A;  4HLH A;  3DT7 A;  4KZQ A;  4UVL A;  4N4V A;  4BUW A;  3PAX A;  4UW1 A;  4UI8 A;  4BUD A;  5LXP A;  4HLK A;  3MOH A;  4UVV A;  4W5I A;  2RD6 A;  1M51 A;  1YLH A;  3P0Q A;  4L2K A;  4LI7 A;  1J3B A;  4UFU A;  5AL2 A;  4AVW A;  4TK5 A;  4PNL A;  4BUE A;  5ADR A;  2ZCI A;  2X5Y A;  3GEY A;  4WPV A;  4PML A;  3FHB A;  3L3L A;  2PAW A;  4GMZ A;  4J22 A;  4UXB A;  5EBT A;  4DQY C;  2QF2 A;  3MHK A;  2PQF A;  4GNM A;  4HLF A;  5DCZ A;  3UH4 A;  4ZZY A;  4YWB A;  2QZY A;  4GNO A;  4WOU A;  5ECE A;  4OQA C;  4YW9 A;  4HMH A;  4BUV A;  4L0S A;  4YWD A;  4F1L A;  4K4E A;  4TOS A;  3W51 A;  1XKV A;  2QEW A;  4L6S A;  4L70 A;  4L7L A;  4M7B A;  5AL5 A;  3UH2 A;  4PNN A;  4TJY A;  4UX4 A;  4KZU A;  4J3M A;  3KCZ A;  4UVN A;  3DT4 A;  4WPU A;  1A26 A;  3GN7 A;  4BU9 A;  4UI6 A;  2GMV A;  4UI5 A;  5AKW A;  4OA7 A;  4GMM A;  5FH2 A;  4BJ9 A;  4KZL A;  4F1Q A;  1KHF A;  2PXZ X;  5AL4 A;  3SMI A;  4U6A A;  5FH0 A;  3MHJ A;  5FH5 A;  4HKK A;  4L34 A;  4TKG A;  4UI7 A;  4BU5 A;  1YVY A;  4N4T A;  4HKI A;  3P0N A;  4BU8 A;  4UVP A;  4UVZ A;  3C49 A;  4XHU A;  4BJB A;  3DT2 A;  5FPF A;  5FH4 A;  4W6E A;  5C5P A;  2FAF A;  1KHE A;  3KR8 A;  4HLM A;  4TKF A;  1OEN A;  4BUY A;  4L7O A;  4UVS A;  3DTB A;  4L31 A;  4L10 A;  4UFY A;  4RV6 A;  4L7N A;  4TKI A;  3SE2 A;  3SMJ A;  4HKN A;  5C5Q A;  4WIU A;  2RKD A;  4L7R A;  4TJW A;  5FH3 A;  4L2F A;  4WL8 A;  4BFP A;  2QF1 A;  4L2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...