4BUYA

Crystal structure of human tankyrase 2 in complex with 5-methyl-5-(4-(4-oxo-3,4-dihydroquinazolin-2-yl)phenyl)imidazolidine-2,4-dione
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buyA00
4KRSA 4GV4A 4AVWA 4PNQA 4L2GA 4UI5A 4UVVA 4BJBA 4ZZYA 4R6EA 5C5PA 4DVIA 3GEYA 4L0BA 4L32A 4PNTA 4UVUA 4L09A 4BUIA 4L7NA 4BUUA 3GJWA 3KR7A 4HMHA 4I9IA 4L0IA 4AVUA 4DQYC 4TK0A 4LI7A 4PMLA 5AL4A 4TKIA 4TKGA 4J21A 3P0PA 3GOYA 4UI3A 4HLGA 4BUVA 4UX4A 4UVWA 4BU6A 4PY4A 4BUTA 4F1LA 3U9YA 5FPFA 1UK1A 4TK5A 4W5IA 4XHUA 4UVTA 4BUYA 5EBTA 1PAXA 5ADRA 4KZUA 4HL5A 4N4TA 2PAXA 4MSGA 4BUWA 4BU5A 4W6EA 3CE0A 5C5RA 5ADSA 4HLKA 4PNLA 3L3LA 4MSKA 4TOSA 1UK0A 4GV7A 3U9HA 4OA7A 4PNRA 3SMIA 4F1QA 4K4EA 4L70A 4UFYA 5AKWA 5C5QA 4PNSA 1EFYA 4PJVA 4UVOA 4ZZXA 4UI7A 4W5SA 4KZQA 4L7UA 4M7BA 5LX6A 3C49A 3UA9A 4BJ9A 4BU7A 4K4FA 3P0QA 5ADTA 4L6SA 4L7PA 5AKUA 4UHGA 1GS0A 4L7LA 4HHZA 4UI6A 4L2KA 3GN7A 4U6AA 1A26A 4L10A 4X52A 4J3MA 4N3RA 4UVPA 2RD6A 4L33A 4BS4A 4BU3A 5AL5A 4HHYA 4J3LA 2RF5A 4HLMA 4N4VA 4TJWA 4HLHA 5A00A 5ECEA 4HLFA 2PQFA 4MT9A 5LXPA 4TVJA 4PJTA 4J1ZA 4L34A 3KR8A 4UVYA 4BUEA 5LYHA 4R5WA 4L31A 4UXBA 4LI6A 4BUDA 4HKKA 4HKNA 4UFUA 4L7OA 4UVXA 1WOKA 4OPXC 3KJDA 3MHJA 4BU8A 4IUEA 3L3MA 3UDDA 5DCZA 4LI8A 4L0SA 4HYFA 4PNMA 5AL1A 4OQAC 4TJYA 3SMJA 5ADQA 5AL2A 2X5YA 3UH2A 2PAWA 3FHBA 4UVNA 3HKVA 3MHKA 4L0VA 4L7RA 4UNDA 4UW1A 4UVZA 4UVLA 4RV6A 2RCWA 4UVSA 4PNNA 4TJUA 5AL3A 4HKIA 4L2FA 4TORA 4UI8A 3PAXA 4BU9A 4GV0A 3SE2A 4UI4A 4UUHA 4OQBC 3UH4A 4ZZZA 4GV2A 4J22A 5FPGA 4TKFA 4L0TA 5AEHA 5ETYA 4BJCA 4BUFA 3KCZA 4PAXA 3BLJA 4BFPA 3W51A 4BUAA 4F0EA 4BUSA 3P0NA 4BUXA 4KZLA 3C4HA 4L6ZA
chains in the Genus database with same CATH superfamily
4KRSA 1KHEA 4GV4A 1KHBA 4AVWA 4PNQA 4L2GA 4UI5A 4UVVA 4BJBA 4ZZYA 4R6EA 2QF2A 5C5PA 4DVIA 3GEYA 4GMMA 4L0BA 4L32A 4PNTA 4UVUA 4L09A 1NHXA 4BUIA 4L7NA 4BUUA 3GJWA 3MOHA 2OLQA 2RKDA 3KR7A 4GNLA 4HMHA 4I9IA 4L0IA 4AVUA 4BU7A 2GMVA 4DQYC 4WL8A 4LI7A 4PMLA 5AL4A 1M51A 1YLHA 4R43A 4TK0A 2QEWA 4TKIA 4TKGA 4J21A 1K3DA 3GOYA 3P0PA 4HLGA 4UI3A 4BUVA 4UX4A 1YVYA 4UVWA 2PY7X 4PY4A 4BU6A 4BUTA 4F1LA 4RCGA 4WOUA 3U9YA 5FPFA 1YTMA 1UK1A 4TK5A 4W5IA 1OENA 4XHUA 4UVTA 4BUYA 5EBTA 1PAXA 5ADRA 4KZUA 4HL5A 4N4TA 1AQ2A 2PAXA 1XKVA 4MSGA 4BUWA 4BU5A 4W6EA 3CE0A 5C5RA 5ADSA 5FH4A 4HLKA 2PC9A 4PNLA 3L3LA 2RKAA 4MSKA 4TOSA 1UK0A 2ZCIA 4GV7A 3U9HA 4OA7A 4PNRA 4BUXA 3SMIA 4F1QA 5I67A 4K4EA 4L70A 4UFYA 5AKWA 1K3CA 5C5QA 4PNSA 1EFYA 4PJVA 4UVOA 4ZZXA 4UI7A 4W5SA 2FAFA 4KZQA 1AYLA 4L7UA 4M7BA 5FH5A 4GMUA 5LX6A 1YGGA 2RK8A 3C49A 3UA9A 4K4FA 3P0QA 4BJ9A 3MOFA 4L6SA 4L7PA 5ADTA 5AKUA 4YW8A 1GS0A 4UHGA 3DT2A 4L7LA 4HHZA 4UI6A 4L2KA 3GN7A 4U6AA 1A26A 4GMZA 4L10A 4J3MA 4X52A 4WIUA 4N3RA 4UVPA 2RD6A 4L33A 4BS4A 4BU3A 5AL5A 4HHYA 4J3LA 4GNOA 2RF5A 4HLMA 4N4VA 4TJWA 4HLHA 3DTBA 5ECEA 4HLFA 5A00A 2PQFA 4MT9A 4YWDA 5LXPA 4TVJA 4PJTA 4J1ZA 4L34A 3MOEA 3KR8A 4UVYA 4BUEA 5LYHA 4R5WA 4L31A 4UXBA 4LI6A 4BUDA 5FH3A 4HKKA 4HKNA 4UFUA 4L7OA 4UVXA 1WOKA 4OPXC 3MHJA 1J3BA 3KJDA 4BU8A 4IUEA 4GNMA 3L3MA 4YW9A 3UDDA 5DCZA 4LI8A 4L0SA 4HYFA 4PNMA 5AL1A 4OQAC 1KHGA 4TJYA 1II2A 3SMJA 4OX2A 5ADQA 5AL2A 2X5YA 3UH2A 5FH1A 2PAWA 3FHBA 4UVNA 3HKVA 3DT4A 3MHKA 4GNPA 4L0VA 4L7RA 4UNDA 4UVZA 4UW1A 2RKEA 4UVLA 4RV6A 2RCWA 4UVSA 4PNNA 4TJUA 5AL3A 4WPTA 4HKIA 4L2FA 4TORA 4UI8A 3PAXA 4BU9A 2FAHA 4GV0A 4GMWA 4UI4A 2QZYA 5FH2A 4UUHA 3SE2A 4OQBC 5FH0A 3UH4A 3DT7A 1OS1A 2RK7A 4ZZZA 4GV2A 4J22A 4WPUA 2OLRA 4TKFA 4L0TA 5FPGA 5AEHA 4WIEA 5ETYA 2QEYA 4WPVA 4BJCA 4GNQA 4BUFA 1KHFA 3KCZA 4PAXA 3BLJA 4BFPA 3W51A 4BUAA 4F0EA 4BUSA 2PXZX 3P0NA 2QF1A 4KZLA 4YWBA 3C4HA 4L6ZA
chains in the Genus database with same CATH topology
4KRSA 1KHEA 4GV4A 1KHBA 4AVWA 4PNQA 4L2GA 4UI5A 4UVVA 4BJBA 4ZZYA 4R6EA 2QF2A 5C5PA 4DVIA 3GEYA 4GMMA 4L0BA 4L32A 4PNTA 4UVUA 4L09A 1NHXA 4BUIA 4L7NA 4BUUA 3GJWA 3MOHA 2OLQA 2RKDA 3KR7A 4GNLA 4HMHA 4I9IA 4L0IA 4AVUA 4BU7A 2GMVA 4DQYC 4WL8A 4LI7A 4PMLA 5AL4A 1M51A 1YLHA 4R43A 4TK0A 2QEWA 4TKIA 4TKGA 4J21A 1K3DA 3GOYA 3P0PA 4HLGA 4UI3A 4BUVA 4UX4A 1YVYA 4UVWA 2PY7X 4PY4A 4BU6A 4BUTA 4F1LA 4RCGA 4WOUA 3U9YA 5FPFA 1YTMA 1UK1A 4TK5A 4W5IA 1OENA 4XHUA 4UVTA 4BUYA 5EBTA 1PAXA 5ADRA 4KZUA 4HL5A 4N4TA 1AQ2A 2PAXA 1XKVA 4MSGA 4BUWA 4BU5A 4W6EA 3CE0A 5C5RA 5ADSA 5FH4A 4HLKA 2PC9A 4PNLA 3L3LA 2RKAA 4MSKA 4TOSA 1UK0A 2ZCIA 4GV7A 3U9HA 4OA7A 4PNRA 4BUXA 3SMIA 4F1QA 5I67A 4K4EA 4L70A 4UFYA 5AKWA 1K3CA 5C5QA 4PNSA 1EFYA 4PJVA 4UVOA 4ZZXA 4UI7A 4W5SA 2FAFA 4KZQA 1AYLA 4L7UA 4M7BA 5FH5A 4GMUA 5LX6A 1YGGA 2RK8A 3C49A 3UA9A 4K4FA 3P0QA 4BJ9A 3MOFA 4L6SA 4L7PA 5ADTA 5AKUA 4YW8A 1GS0A 4UHGA 3DT2A 4L7LA 4HHZA 4UI6A 4L2KA 3GN7A 4U6AA 1A26A 4GMZA 4L10A 4J3MA 4X52A 4WIUA 4N3RA 4UVPA 2RD6A 4L33A 4BS4A 4BU3A 5AL5A 4HHYA 4J3LA 4GNOA 2RF5A 4HLMA 4N4VA 4TJWA 4HLHA 3DTBA 5ECEA 4HLFA 5A00A 2PQFA 4MT9A 4YWDA 5LXPA 4TVJA 4PJTA 4J1ZA 4L34A 3MOEA 3KR8A 4UVYA 4BUEA 5LYHA 4R5WA 4L31A 4UXBA 4LI6A 4BUDA 5FH3A 4HKKA 4HKNA 4UFUA 4L7OA 4UVXA 1WOKA 4OPXC 3MHJA 1J3BA 3KJDA 4BU8A 4IUEA 4GNMA 3L3MA 4YW9A 3UDDA 5DCZA 4LI8A 4L0SA 4HYFA 4PNMA 5AL1A 4OQAC 1KHGA 4TJYA 1II2A 3SMJA 4OX2A 5ADQA 5AL2A 2X5YA 3UH2A 5FH1A 2PAWA 3FHBA 4UVNA 3HKVA 3DT4A 3MHKA 4GNPA 4L0VA 4L7RA 4UNDA 4UVZA 4UW1A 2RKEA 4UVLA 4RV6A 2RCWA 4UVSA 4PNNA 4TJUA 5AL3A 4WPTA 4HKIA 4L2FA 4TORA 4UI8A 3PAXA 4BU9A 2FAHA 4GV0A 4GMWA 4UI4A 2QZYA 5FH2A 4UUHA 3SE2A 4OQBC 5FH0A 3UH4A 3DT7A 1OS1A 2RK7A 4ZZZA 4GV2A 4J22A 4WPUA 2OLRA 4TKFA 4L0TA 5FPGA 5AEHA 4WIEA 5ETYA 2QEYA 4WPVA 4BJCA 4GNQA 4BUFA 1KHFA 3KCZA 4PAXA 3BLJA 4BFPA 3W51A 4BUAA 4F0EA 4BUSA 2PXZX 3P0NA 2QF1A 4KZLA 4YWBA 3C4HA 4L6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KRS A;  4GV4 A;  4AVW A;  4PNQ A;  4L2G A;  4UI5 A;  4UVV A;  4BJB A;  4ZZY A;  4R6E A;  5C5P A;  4DVI A;  3GEY A;  4L0B A;  4L32 A;  4PNT A;  4UVU A;  4L09 A;  4BUI A;  4L7N A;  4BUU A;  3GJW A;  3KR7 A;  4HMH A;  4I9I A;  4L0I A;  4AVU A;  4DQY C;  4TK0 A;  4LI7 A;  4PML A;  5AL4 A;  4TKI A;  4TKG A;  4J21 A;  3P0P A;  3GOY A;  4UI3 A;  4HLG A;  4BUV A;  4UX4 A;  4UVW A;  4BU6 A;  4PY4 A;  4BUT A;  4F1L A;  3U9Y A;  5FPF A;  1UK1 A;  4TK5 A;  4W5I A;  4XHU A;  4UVT A;  4BUY A;  5EBT A;  1PAX A;  5ADR A;  4KZU A;  4HL5 A;  4N4T A;  2PAX A;  4MSG A;  4BUW A;  4BU5 A;  4W6E A;  3CE0 A;  5C5R A;  5ADS A;  4HLK A;  4PNL A;  3L3L A;  4MSK A;  4TOS A;  1UK0 A;  4GV7 A;  3U9H A;  4OA7 A;  4PNR A;  3SMI A;  4F1Q A;  4K4E A;  4L70 A;  4UFY A;  5AKW A;  5C5Q A;  4PNS A;  1EFY A;  4PJV A;  4UVO A;  4ZZX A;  4UI7 A;  4W5S A;  4KZQ A;  4L7U A;  4M7B A;  5LX6 A;  3C49 A;  3UA9 A;  4BJ9 A;  4BU7 A;  4K4F A;  3P0Q A;  5ADT A;  4L6S A;  4L7P A;  5AKU A;  4UHG A;  1GS0 A;  4L7L A;  4HHZ A;  4UI6 A;  4L2K A;  3GN7 A;  4U6A A;  1A26 A;  4L10 A;  4X52 A;  4J3M A;  4N3R A;  4UVP A;  2RD6 A;  4L33 A;  4BS4 A;  4BU3 A;  5AL5 A;  4HHY A;  4J3L A;  2RF5 A;  4HLM A;  4N4V A;  4TJW A;  4HLH A;  5A00 A;  5ECE A;  4HLF A;  2PQF A;  4MT9 A;  5LXP A;  4TVJ A;  4PJT A;  4J1Z A;  4L34 A;  3KR8 A;  4UVY A;  4BUE A;  5LYH A;  4R5W A;  4L31 A;  4UXB A;  4LI6 A;  4BUD A;  4HKK A;  4HKN A;  4UFU A;  4L7O A;  4UVX A;  1WOK A;  4OPX C;  3KJD A;  3MHJ A;  4BU8 A;  4IUE A;  3L3M A;  3UDD A;  5DCZ A;  4LI8 A;  4L0S A;  4HYF A;  4PNM A;  5AL1 A;  4OQA C;  4TJY A;  3SMJ A;  5ADQ A;  5AL2 A;  2X5Y A;  3UH2 A;  2PAW A;  3FHB A;  4UVN A;  3HKV A;  3MHK A;  4L0V A;  4L7R A;  4UND A;  4UW1 A;  4UVZ A;  4UVL A;  4RV6 A;  2RCW A;  4UVS A;  4PNN A;  4TJU A;  5AL3 A;  4HKI A;  4L2F A;  4TOR A;  4UI8 A;  3PAX A;  4BU9 A;  4GV0 A;  3SE2 A;  4UI4 A;  4UUH A;  4OQB C;  3UH4 A;  4ZZZ A;  4GV2 A;  4J22 A;  5FPG A;  4TKF A;  4L0T A;  5AEH A;  5ETY A;  4BJC A;  4BUF A;  3KCZ A;  4PAX A;  3BLJ A;  4BFP A;  3W51 A;  4BUA A;  4F0E A;  4BUS A;  3P0N A;  4BUX A;  4KZL A;  3C4H A;  4L6Z A; 
#chains in the Genus database with same CATH topology
 4KRS A;  1KHE A;  4GV4 A;  1KHB A;  4AVW A;  4PNQ A;  4L2G A;  4UI5 A;  4UVV A;  4BJB A;  4ZZY A;  4R6E A;  2QF2 A;  5C5P A;  4DVI A;  3GEY A;  4GMM A;  4L0B A;  4L32 A;  4PNT A;  4UVU A;  4L09 A;  1NHX A;  4BUI A;  4L7N A;  4BUU A;  3GJW A;  3MOH A;  2OLQ A;  2RKD A;  3KR7 A;  4GNL A;  4HMH A;  4I9I A;  4L0I A;  4AVU A;  4BU7 A;  2GMV A;  4DQY C;  4WL8 A;  4LI7 A;  4PML A;  5AL4 A;  1M51 A;  1YLH A;  4R43 A;  4TK0 A;  2QEW A;  4TKI A;  4TKG A;  4J21 A;  1K3D A;  3GOY A;  3P0P A;  4HLG A;  4UI3 A;  4BUV A;  4UX4 A;  1YVY A;  4UVW A;  2PY7 X;  4PY4 A;  4BU6 A;  4BUT A;  4F1L A;  4RCG A;  4WOU A;  3U9Y A;  5FPF A;  1YTM A;  1UK1 A;  4TK5 A;  4W5I A;  1OEN A;  4XHU A;  4UVT A;  4BUY A;  5EBT A;  1PAX A;  5ADR A;  4KZU A;  4HL5 A;  4N4T A;  1AQ2 A;  2PAX A;  1XKV A;  4MSG A;  4BUW A;  4BU5 A;  4W6E A;  3CE0 A;  5C5R A;  5ADS A;  5FH4 A;  4HLK A;  2PC9 A;  4PNL A;  3L3L A;  2RKA A;  4MSK A;  4TOS A;  1UK0 A;  2ZCI A;  4GV7 A;  3U9H A;  4OA7 A;  4PNR A;  4BUX A;  3SMI A;  4F1Q A;  5I67 A;  4K4E A;  4L70 A;  4UFY A;  5AKW A;  1K3C A;  5C5Q A;  4PNS A;  1EFY A;  4PJV A;  4UVO A;  4ZZX A;  4UI7 A;  4W5S A;  2FAF A;  4KZQ A;  1AYL A;  4L7U A;  4M7B A;  5FH5 A;  4GMU A;  5LX6 A;  1YGG A;  2RK8 A;  3C49 A;  3UA9 A;  4K4F A;  3P0Q A;  4BJ9 A;  3MOF A;  4L6S A;  4L7P A;  5ADT A;  5AKU A;  4YW8 A;  1GS0 A;  4UHG A;  3DT2 A;  4L7L A;  4HHZ A;  4UI6 A;  4L2K A;  3GN7 A;  4U6A A;  1A26 A;  4GMZ A;  4L10 A;  4J3M A;  4X52 A;  4WIU A;  4N3R A;  4UVP A;  2RD6 A;  4L33 A;  4BS4 A;  4BU3 A;  5AL5 A;  4HHY A;  4J3L A;  4GNO A;  2RF5 A;  4HLM A;  4N4V A;  4TJW A;  4HLH A;  3DTB A;  5ECE A;  4HLF A;  5A00 A;  2PQF A;  4MT9 A;  4YWD A;  5LXP A;  4TVJ A;  4PJT A;  4J1Z A;  4L34 A;  3MOE A;  3KR8 A;  4UVY A;  4BUE A;  5LYH A;  4R5W A;  4L31 A;  4UXB A;  4LI6 A;  4BUD A;  5FH3 A;  4HKK A;  4HKN A;  4UFU A;  4L7O A;  4UVX A;  1WOK A;  4OPX C;  3MHJ A;  1J3B A;  3KJD A;  4BU8 A;  4IUE A;  4GNM A;  3L3M A;  4YW9 A;  3UDD A;  5DCZ A;  4LI8 A;  4L0S A;  4HYF A;  4PNM A;  5AL1 A;  4OQA C;  1KHG A;  4TJY A;  1II2 A;  3SMJ A;  4OX2 A;  5ADQ A;  5AL2 A;  2X5Y A;  3UH2 A;  5FH1 A;  2PAW A;  3FHB A;  4UVN A;  3HKV A;  3DT4 A;  3MHK A;  4GNP A;  4L0V A;  4L7R A;  4UND A;  4UVZ A;  4UW1 A;  2RKE A;  4UVL A;  4RV6 A;  2RCW A;  4UVS A;  4PNN A;  4TJU A;  5AL3 A;  4WPT A;  4HKI A;  4L2F A;  4TOR A;  4UI8 A;  3PAX A;  4BU9 A;  2FAH A;  4GV0 A;  4GMW A;  4UI4 A;  2QZY A;  5FH2 A;  4UUH A;  3SE2 A;  4OQB C;  5FH0 A;  3UH4 A;  3DT7 A;  1OS1 A;  2RK7 A;  4ZZZ A;  4GV2 A;  4J22 A;  4WPU A;  2OLR A;  4TKF A;  4L0T A;  5FPG A;  5AEH A;  4WIE A;  5ETY A;  2QEY A;  4WPV A;  4BJC A;  4GNQ A;  4BUF A;  1KHF A;  3KCZ A;  4PAX A;  3BLJ A;  4BFP A;  3W51 A;  4BUA A;  4F0E A;  4BUS A;  2PXZ X;  3P0N A;  2QF1 A;  4KZL A;  4YWB A;  3C4H A;  4L6Z A; 
#chains in the Genus database with same CATH homology
 4KRS A;  1KHE A;  4GV4 A;  1KHB A;  4AVW A;  4PNQ A;  4L2G A;  4UI5 A;  4UVV A;  4BJB A;  4ZZY A;  4R6E A;  2QF2 A;  5C5P A;  4DVI A;  3GEY A;  4GMM A;  4L0B A;  4L32 A;  4PNT A;  4UVU A;  4L09 A;  1NHX A;  4BUI A;  4L7N A;  4BUU A;  3GJW A;  3MOH A;  2OLQ A;  2RKD A;  3KR7 A;  4GNL A;  4HMH A;  4I9I A;  4L0I A;  4AVU A;  4BU7 A;  2GMV A;  4DQY C;  4WL8 A;  4LI7 A;  4PML A;  5AL4 A;  1M51 A;  1YLH A;  4R43 A;  4TK0 A;  2QEW A;  4TKI A;  4TKG A;  4J21 A;  1K3D A;  3GOY A;  3P0P A;  4HLG A;  4UI3 A;  4BUV A;  4UX4 A;  1YVY A;  4UVW A;  2PY7 X;  4PY4 A;  4BU6 A;  4BUT A;  4F1L A;  4RCG A;  4WOU A;  3U9Y A;  5FPF A;  1YTM A;  1UK1 A;  4TK5 A;  4W5I A;  1OEN A;  4XHU A;  4UVT A;  4BUY A;  5EBT A;  1PAX A;  5ADR A;  4KZU A;  4HL5 A;  4N4T A;  1AQ2 A;  2PAX A;  1XKV A;  4MSG A;  4BUW A;  4BU5 A;  4W6E A;  3CE0 A;  5C5R A;  5ADS A;  5FH4 A;  4HLK A;  2PC9 A;  4PNL A;  3L3L A;  2RKA A;  4MSK A;  4TOS A;  1UK0 A;  2ZCI A;  4GV7 A;  3U9H A;  4OA7 A;  4PNR A;  4BUX A;  3SMI A;  4F1Q A;  5I67 A;  4K4E A;  4L70 A;  4UFY A;  5AKW A;  1K3C A;  5C5Q A;  4PNS A;  1EFY A;  4PJV A;  4UVO A;  4ZZX A;  4UI7 A;  4W5S A;  2FAF A;  4KZQ A;  1AYL A;  4L7U A;  4M7B A;  5FH5 A;  4GMU A;  5LX6 A;  1YGG A;  2RK8 A;  3C49 A;  3UA9 A;  4K4F A;  3P0Q A;  4BJ9 A;  3MOF A;  4L6S A;  4L7P A;  5ADT A;  5AKU A;  4YW8 A;  1GS0 A;  4UHG A;  3DT2 A;  4L7L A;  4HHZ A;  4UI6 A;  4L2K A;  3GN7 A;  4U6A A;  1A26 A;  4GMZ A;  4L10 A;  4J3M A;  4X52 A;  4WIU A;  4N3R A;  4UVP A;  2RD6 A;  4L33 A;  4BS4 A;  4BU3 A;  5AL5 A;  4HHY A;  4J3L A;  4GNO A;  2RF5 A;  4HLM A;  4N4V A;  4TJW A;  4HLH A;  3DTB A;  5ECE A;  4HLF A;  5A00 A;  2PQF A;  4MT9 A;  4YWD A;  5LXP A;  4TVJ A;  4PJT A;  4J1Z A;  4L34 A;  3MOE A;  3KR8 A;  4UVY A;  4BUE A;  5LYH A;  4R5W A;  4L31 A;  4UXB A;  4LI6 A;  4BUD A;  5FH3 A;  4HKK A;  4HKN A;  4UFU A;  4L7O A;  4UVX A;  1WOK A;  4OPX C;  3MHJ A;  1J3B A;  3KJD A;  4BU8 A;  4IUE A;  4GNM A;  3L3M A;  4YW9 A;  3UDD A;  5DCZ A;  4LI8 A;  4L0S A;  4HYF A;  4PNM A;  5AL1 A;  4OQA C;  1KHG A;  4TJY A;  1II2 A;  3SMJ A;  4OX2 A;  5ADQ A;  5AL2 A;  2X5Y A;  3UH2 A;  5FH1 A;  2PAW A;  3FHB A;  4UVN A;  3HKV A;  3DT4 A;  3MHK A;  4GNP A;  4L0V A;  4L7R A;  4UND A;  4UVZ A;  4UW1 A;  2RKE A;  4UVL A;  4RV6 A;  2RCW A;  4UVS A;  4PNN A;  4TJU A;  5AL3 A;  4WPT A;  4HKI A;  4L2F A;  4TOR A;  4UI8 A;  3PAX A;  4BU9 A;  2FAH A;  4GV0 A;  4GMW A;  4UI4 A;  2QZY A;  5FH2 A;  4UUH A;  3SE2 A;  4OQB C;  5FH0 A;  3UH4 A;  3DT7 A;  1OS1 A;  2RK7 A;  4ZZZ A;  4GV2 A;  4J22 A;  4WPU A;  2OLR A;  4TKF A;  4L0T A;  5FPG A;  5AEH A;  4WIE A;  5ETY A;  2QEY A;  4WPV A;  4BJC A;  4GNQ A;  4BUF A;  1KHF A;  3KCZ A;  4PAX A;  3BLJ A;  4BFP A;  3W51 A;  4BUA A;  4F0E A;  4BUS A;  2PXZ X;  3P0N A;  2QF1 A;  4KZL A;  4YWB A;  3C4H A;  4L6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...