4BUYA

Crystal structure of human tankyrase 2 in complex with 5-methyl-5-(4-(4-oxo-3,4-dihydroquinazolin-2-yl)phenyl)imidazolidine-2,4-dione
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Para-Substituted 2-Phenyl-3,4-Dihydroquinazolin-4-Ones as Potent and Selective Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4buyA00
4L09A 3UH4A 4J1ZA 4R6EA 4UVYA 4UVOA 4RV6A 4W5IA 4L0SA 5ADQA 5LXPA 5AL3A 4ZZZA 4AVWA 4UVNA 3U9HA 1PAXA 4MSGA 4L7OA 4F1QA 5LYHA 4BUWA 4KZLA 4UHGA 4HL5A 4BFPA 4BUIA 4OQAC 4PNQA 5FPGA 4L34A 4J3MA 4LI6A 4OQBC 4PNLA 4UVPA 4BUEA 5ADRA 4PJVA 4BJCA 4BU7A 3C4HA 4UI8A 1UK1A 4PNTA 4HLMA 4X52A 4L7RA 2RF5A 4TKGA 4K4FA 4BU5A 4L7PA 4L32A 3C49A 3MHKA 4UVWA 3BLJA 4L2FA 4U6AA 4L2GA 4GV0A 5AEHA 5AL2A 4L0BA 4HLFA 4BUAA 5FPFA 4L0TA 1A26A 4UFYA 4UVTA 4MSKA 5C5QA 3GJWA 4M7BA 4ZZXA 5AKWA 4BJ9A 4TK5A 3KCZA 4TKFA 4BU6A 1WOKA 4UFUA 4UNDA 5AL4A 4L0VA 4HKNA 4IUEA 4L7LA 3KJDA 4L6ZA 4UI6A 4J22A 4PMLA 4DVIA 4UX4A 4HYFA 3GOYA 4TKIA 4UXBA 4HLGA 2RD6A 4OA7A 3GEYA 3KR8A 4HLKA 4TK0A 3P0QA 4GV7A 4PNSA 4UI4A 4W5SA 4UVVA 2PAWA 4L6SA 3L3LA 5AL1A 4BUTA 4BUVA 3U9YA 4MT9A 4BUYA 4BUUA 4J3LA 2RCWA 5C5RA 4HHZA 3UDDA 3UA9A 5A00A 4W6EA 4TJWA 4L7NA 1UK0A 2PAXA 4PNRA 5ADSA 4XHUA 4J21A 4KRSA 4ZZYA 3SMJA 4BU3A 4L7UA 4UI3A 5C5PA 4LI8A 5ECEA 3L3MA 4K4EA 4L31A 4GV2A 3P0NA 4BU8A 4TORA 3FHBA 4HKKA 4HHYA 4KZQA 3P0PA 4LI7A 5DCZA 5EBTA 4UVXA 4UW1A 3UH2A 4BJBA 4TVJA 4AVUA 5ETYA 3KR7A 4N4TA 4I9IA 4UI7A 4L70A 4UUHA 4UVZA 4GV4A 4BUDA 4BUXA 4R5WA 5AL5A 4PY4A 3CE0A 4UVSA 4OPXC 4TOSA 4UI5A 3PAXA 4PAXA 4UVLA 2PQFA 3W51A 4BUFA 4N4VA 5AKUA 4KZUA 1EFYA 3HKVA 4BU9A 3SMIA 4L0IA 5ADTA 4TJUA 4L10A 4N3RA 4UVUA 3MHJA 1GS0A 4TJYA 4PJTA 4DQYC 4BUSA 3GN7A 4L2KA 4PNNA 5LX6A 4L33A 4HLHA 4PNMA 4HKIA 4F1LA 4BS4A 3SE2A 4F0EA 2X5YA 4HMHA
chains in the Genus database with same CATH superfamily
4L09A 3UH4A 4J1ZA 4R6EA 4UVYA 4UVOA 4RV6A 4W5IA 4L0SA 5ADQA 4DVIA 5LXPA 5AL3A 4ZZZA 4AVWA 1KHFA 4UVNA 3U9HA 1PAXA 4MSGA 1KHGA 4L7OA 4F1QA 5LYHA 4BUWA 4KZLA 5FH2A 4GMWA 2ZCIA 4YW8A 4HL5A 4BFPA 4BUIA 4UHGA 4OQAC 4YW9A 4PNQA 1YVYA 5FPGA 5ETYA 4L34A 2QEYA 4J3MA 4LI6A 4OQBC 4PNLA 4UVPA 4BUEA 5ADRA 4PJVA 4BJCA 4BU7A 3C4HA 4UI8A 4GMZA 1K3CA 1UK1A 4PNTA 4HLMA 4X52A 4L7RA 2RF5A 4TKGA 4K4FA 1YTMA 4BU5A 4L7PA 4L32A 3C49A 3MHKA 4UVWA 3BLJA 2RK7A 4L2FA 4U6AA 4L2GA 5FH4A 4GV0A 5AEHA 4WPVA 5AL2A 4L0BA 4HLFA 4BUAA 5FPFA 4L0TA 1A26A 2OLRA 4UFYA 4UVTA 4MSKA 5C5QA 2RKAA 3GJWA 4M7BA 4ZZXA 5AKWA 4AVUA 4WIEA 4TK5A 4BJ9A 3KCZA 4TKFA 2QEWA 4YWBA 4BU6A 1WOKA 4UFUA 4UNDA 5AL4A 4L0VA 4HKNA 4IUEA 4L7LA 2RKEA 3DT2A 3KJDA 1OENA 4L6ZA 4UI6A 1YGGA 4J22A 2PC9A 4PMLA 4UX4A 4HYFA 3GOYA 4TKIA 4UXBA 4HLGA 2RD6A 4OA7A 3GEYA 3KR8A 4HLKA 5FH5A 4TK0A 3P0QA 2PXZX 1K3DA 3MOFA 4GV7A 4PNSA 4UI4A 4W5SA 4UVVA 2PAWA 4L6SA 3L3LA 5AL1A 4BUTA 4BUVA 1AYLA 3U9YA 4MT9A 4BUYA 1KHBA 1II2A 4BUUA 4J3LA 4WIUA 2RCWA 5C5RA 4HHZA 2GMVA 3UDDA 3UA9A 1YLHA 5A00A 4W6EA 4TJWA 4GNOA 4L7NA 1UK0A 2PAXA 3MOHA 4PNRA 4XHUA 5ADSA 4J21A 4KRSA 4ZZYA 4GMUA 3SMJA 5FH0A 4BU3A 4L7UA 4UI3A 5C5PA 4LI8A 5ECEA 5I67A 1NHXA 3L3MA 4K4EA 4L31A 3MOEA 4GV2A 3DT7A 2RK8A 1M51A 3DTBA 3P0NA 4BU8A 4TORA 1KHEA 3FHBA 2QZYA 4HKKA 4HHYA 4KZQA 4WPUA 3P0PA 4LI7A 5DCZA 4RCGA 5EBTA 4UVXA 4UW1A 3UH2A 4BJBA 4TVJA 1OS1A 4GNLA 3KR7A 4GMMA 4I9IA 4N4TA 4L70A 4UI7A 4UUHA 4GV4A 4UVZA 4BUDA 4R5WA 4WOUA 5AL5A 4PY4A 4BUXA 3CE0A 4UVSA 4OPXC 4TOSA 2QF2A 4UI5A 3PAXA 4PAXA 4UVLA 2OLQA 2PQFA 3W51A 4BUFA 4N4VA 4R43A 5AKUA 4KZUA 1EFYA 1XKVA 2PY7X 3HKVA 5FH3A 4BU9A 3DT4A 4L0IA 3SMIA 5ADTA 4TJUA 4L10A 4N3RA 4UVUA 3MHJA 1GS0A 4TJYA 2QF1A 4PJTA 4OX2A 4WPTA 4DQYC 4BUSA 3GN7A 1J3BA 2FAHA 4L2KA 4PNNA 4GNQA 5LX6A 1AQ2A 4HLHA 4L33A 4PNMA 4HKIA 4WL8A 4GNPA 4F1LA 4BS4A 2FAFA 3SE2A 4YWDA 2X5YA 4F0EA 4HMHA 5FH1A 4GNMA 2RKDA
chains in the Genus database with same CATH topology
4L09A 3UH4A 4J1ZA 4R6EA 4UVYA 4UVOA 4RV6A 4W5IA 4L0SA 5ADQA 4DVIA 5LXPA 5AL3A 4ZZZA 4AVWA 1KHFA 4UVNA 3U9HA 1PAXA 4MSGA 1KHGA 4L7OA 4F1QA 5LYHA 4BUWA 4KZLA 5FH2A 4GMWA 2ZCIA 4YW8A 4HL5A 4BFPA 4BUIA 4UHGA 4OQAC 4YW9A 4PNQA 1YVYA 5FPGA 5ETYA 4L34A 2QEYA 4J3MA 4LI6A 4OQBC 4PNLA 4UVPA 4BUEA 5ADRA 4PJVA 4BJCA 4BU7A 3C4HA 4UI8A 4GMZA 1K3CA 1UK1A 4PNTA 4HLMA 4X52A 4L7RA 2RF5A 4TKGA 4K4FA 1YTMA 4BU5A 4L7PA 4L32A 3C49A 3MHKA 4UVWA 3BLJA 2RK7A 4L2FA 4U6AA 4L2GA 5FH4A 4GV0A 5AEHA 4WPVA 5AL2A 4L0BA 4HLFA 4BUAA 5FPFA 4L0TA 1A26A 2OLRA 4UFYA 4UVTA 4MSKA 5C5QA 2RKAA 3GJWA 4M7BA 4ZZXA 5AKWA 4AVUA 4WIEA 4TK5A 4BJ9A 3KCZA 4TKFA 2QEWA 4YWBA 4BU6A 1WOKA 4UFUA 4UNDA 5AL4A 4L0VA 4HKNA 4IUEA 4L7LA 2RKEA 3DT2A 3KJDA 1OENA 4L6ZA 4UI6A 1YGGA 4J22A 2PC9A 4PMLA 4UX4A 4HYFA 3GOYA 4TKIA 4UXBA 4HLGA 2RD6A 4OA7A 3GEYA 3KR8A 4HLKA 5FH5A 4TK0A 3P0QA 2PXZX 1K3DA 3MOFA 4GV7A 4PNSA 4UI4A 4W5SA 4UVVA 2PAWA 4L6SA 3L3LA 5AL1A 4BUTA 4BUVA 1AYLA 3U9YA 4MT9A 4BUYA 1KHBA 1II2A 4BUUA 4J3LA 4WIUA 2RCWA 5C5RA 4HHZA 2GMVA 3UDDA 3UA9A 1YLHA 5A00A 4W6EA 4TJWA 4GNOA 4L7NA 1UK0A 2PAXA 3MOHA 4PNRA 4XHUA 5ADSA 4J21A 4KRSA 4ZZYA 4GMUA 3SMJA 5FH0A 4BU3A 4L7UA 4UI3A 5C5PA 4LI8A 5ECEA 5I67A 1NHXA 3L3MA 4K4EA 4L31A 3MOEA 4GV2A 3DT7A 2RK8A 1M51A 3DTBA 3P0NA 4BU8A 4TORA 1KHEA 3FHBA 2QZYA 4HKKA 4HHYA 4KZQA 4WPUA 3P0PA 4LI7A 5DCZA 4RCGA 5EBTA 4UVXA 4UW1A 3UH2A 4BJBA 4TVJA 1OS1A 4GNLA 3KR7A 4GMMA 4I9IA 4N4TA 4L70A 4UI7A 4UUHA 4GV4A 4UVZA 4BUDA 4R5WA 4WOUA 5AL5A 4PY4A 4BUXA 3CE0A 4UVSA 4OPXC 4TOSA 2QF2A 4UI5A 3PAXA 4PAXA 4UVLA 2OLQA 2PQFA 3W51A 4BUFA 4N4VA 4R43A 5AKUA 4KZUA 1EFYA 1XKVA 2PY7X 3HKVA 5FH3A 4BU9A 3DT4A 4L0IA 3SMIA 5ADTA 4TJUA 4L10A 4N3RA 4UVUA 3MHJA 1GS0A 4TJYA 2QF1A 4PJTA 4OX2A 4WPTA 4DQYC 4BUSA 3GN7A 1J3BA 2FAHA 4L2KA 4PNNA 4GNQA 5LX6A 1AQ2A 4HLHA 4L33A 4PNMA 4HKIA 4WL8A 4GNPA 4F1LA 4BS4A 2FAFA 3SE2A 4YWDA 2X5YA 4F0EA 4HMHA 5FH1A 4GNMA 2RKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L09 A;  3UH4 A;  4J1Z A;  4R6E A;  4UVY A;  4UVO A;  4RV6 A;  4W5I A;  4L0S A;  5ADQ A;  5LXP A;  5AL3 A;  4ZZZ A;  4AVW A;  4UVN A;  3U9H A;  1PAX A;  4MSG A;  4L7O A;  4F1Q A;  5LYH A;  4BUW A;  4KZL A;  4UHG A;  4HL5 A;  4BFP A;  4BUI A;  4OQA C;  4PNQ A;  5FPG A;  4L34 A;  4J3M A;  4LI6 A;  4OQB C;  4PNL A;  4UVP A;  4BUE A;  5ADR A;  4PJV A;  4BJC A;  4BU7 A;  3C4H A;  4UI8 A;  1UK1 A;  4PNT A;  4HLM A;  4X52 A;  4L7R A;  2RF5 A;  4TKG A;  4K4F A;  4BU5 A;  4L7P A;  4L32 A;  3C49 A;  3MHK A;  4UVW A;  3BLJ A;  4L2F A;  4U6A A;  4L2G A;  4GV0 A;  5AEH A;  5AL2 A;  4L0B A;  4HLF A;  4BUA A;  5FPF A;  4L0T A;  1A26 A;  4UFY A;  4UVT A;  4MSK A;  5C5Q A;  3GJW A;  4M7B A;  4ZZX A;  5AKW A;  4BJ9 A;  4TK5 A;  3KCZ A;  4TKF A;  4BU6 A;  1WOK A;  4UFU A;  4UND A;  5AL4 A;  4L0V A;  4HKN A;  4IUE A;  4L7L A;  3KJD A;  4L6Z A;  4UI6 A;  4J22 A;  4PML A;  4DVI A;  4UX4 A;  4HYF A;  3GOY A;  4TKI A;  4UXB A;  4HLG A;  2RD6 A;  4OA7 A;  3GEY A;  3KR8 A;  4HLK A;  4TK0 A;  3P0Q A;  4GV7 A;  4PNS A;  4UI4 A;  4W5S A;  4UVV A;  2PAW A;  4L6S A;  3L3L A;  5AL1 A;  4BUT A;  4BUV A;  3U9Y A;  4MT9 A;  4BUY A;  4BUU A;  4J3L A;  2RCW A;  5C5R A;  4HHZ A;  3UDD A;  3UA9 A;  5A00 A;  4W6E A;  4TJW A;  4L7N A;  1UK0 A;  2PAX A;  4PNR A;  5ADS A;  4XHU A;  4J21 A;  4KRS A;  4ZZY A;  3SMJ A;  4BU3 A;  4L7U A;  4UI3 A;  5C5P A;  4LI8 A;  5ECE A;  3L3M A;  4K4E A;  4L31 A;  4GV2 A;  3P0N A;  4BU8 A;  4TOR A;  3FHB A;  4HKK A;  4HHY A;  4KZQ A;  3P0P A;  4LI7 A;  5DCZ A;  5EBT A;  4UVX A;  4UW1 A;  3UH2 A;  4BJB A;  4TVJ A;  4AVU A;  5ETY A;  3KR7 A;  4N4T A;  4I9I A;  4UI7 A;  4L70 A;  4UUH A;  4UVZ A;  4GV4 A;  4BUD A;  4BUX A;  4R5W A;  5AL5 A;  4PY4 A;  3CE0 A;  4UVS A;  4OPX C;  4TOS A;  4UI5 A;  3PAX A;  4PAX A;  4UVL A;  2PQF A;  3W51 A;  4BUF A;  4N4V A;  5AKU A;  4KZU A;  1EFY A;  3HKV A;  4BU9 A;  3SMI A;  4L0I A;  5ADT A;  4TJU A;  4L10 A;  4N3R A;  4UVU A;  3MHJ A;  1GS0 A;  4TJY A;  4PJT A;  4DQY C;  4BUS A;  3GN7 A;  4L2K A;  4PNN A;  5LX6 A;  4L33 A;  4HLH A;  4PNM A;  4HKI A;  4F1L A;  4BS4 A;  3SE2 A;  4F0E A;  2X5Y A;  4HMH A; 
#chains in the Genus database with same CATH topology
 4L09 A;  3UH4 A;  4J1Z A;  4R6E A;  4UVY A;  4UVO A;  4RV6 A;  4W5I A;  4L0S A;  5ADQ A;  4DVI A;  5LXP A;  5AL3 A;  4ZZZ A;  4AVW A;  1KHF A;  4UVN A;  3U9H A;  1PAX A;  4MSG A;  1KHG A;  4L7O A;  4F1Q A;  5LYH A;  4BUW A;  4KZL A;  5FH2 A;  4GMW A;  2ZCI A;  4YW8 A;  4HL5 A;  4BFP A;  4BUI A;  4UHG A;  4OQA C;  4YW9 A;  4PNQ A;  1YVY A;  5FPG A;  5ETY A;  4L34 A;  2QEY A;  4J3M A;  4LI6 A;  4OQB C;  4PNL A;  4UVP A;  4BUE A;  5ADR A;  4PJV A;  4BJC A;  4BU7 A;  3C4H A;  4UI8 A;  4GMZ A;  1K3C A;  1UK1 A;  4PNT A;  4HLM A;  4X52 A;  4L7R A;  2RF5 A;  4TKG A;  4K4F A;  1YTM A;  4BU5 A;  4L7P A;  4L32 A;  3C49 A;  3MHK A;  4UVW A;  3BLJ A;  2RK7 A;  4L2F A;  4U6A A;  4L2G A;  5FH4 A;  4GV0 A;  5AEH A;  4WPV A;  5AL2 A;  4L0B A;  4HLF A;  4BUA A;  5FPF A;  4L0T A;  1A26 A;  2OLR A;  4UFY A;  4UVT A;  4MSK A;  5C5Q A;  2RKA A;  3GJW A;  4M7B A;  4ZZX A;  5AKW A;  4AVU A;  4WIE A;  4TK5 A;  4BJ9 A;  3KCZ A;  4TKF A;  2QEW A;  4YWB A;  4BU6 A;  1WOK A;  4UFU A;  4UND A;  5AL4 A;  4L0V A;  4HKN A;  4IUE A;  4L7L A;  2RKE A;  3DT2 A;  3KJD A;  1OEN A;  4L6Z A;  4UI6 A;  1YGG A;  4J22 A;  2PC9 A;  4PML A;  4UX4 A;  4HYF A;  3GOY A;  4TKI A;  4UXB A;  4HLG A;  2RD6 A;  4OA7 A;  3GEY A;  3KR8 A;  4HLK A;  5FH5 A;  4TK0 A;  3P0Q A;  2PXZ X;  1K3D A;  3MOF A;  4GV7 A;  4PNS A;  4UI4 A;  4W5S A;  4UVV A;  2PAW A;  4L6S A;  3L3L A;  5AL1 A;  4BUT A;  4BUV A;  1AYL A;  3U9Y A;  4MT9 A;  4BUY A;  1KHB A;  1II2 A;  4BUU A;  4J3L A;  4WIU A;  2RCW A;  5C5R A;  4HHZ A;  2GMV A;  3UDD A;  3UA9 A;  1YLH A;  5A00 A;  4W6E A;  4TJW A;  4GNO A;  4L7N A;  1UK0 A;  2PAX A;  3MOH A;  4PNR A;  4XHU A;  5ADS A;  4J21 A;  4KRS A;  4ZZY A;  4GMU A;  3SMJ A;  5FH0 A;  4BU3 A;  4L7U A;  4UI3 A;  5C5P A;  4LI8 A;  5ECE A;  5I67 A;  1NHX A;  3L3M A;  4K4E A;  4L31 A;  3MOE A;  4GV2 A;  3DT7 A;  2RK8 A;  1M51 A;  3DTB A;  3P0N A;  4BU8 A;  4TOR A;  1KHE A;  3FHB A;  2QZY A;  4HKK A;  4HHY A;  4KZQ A;  4WPU A;  3P0P A;  4LI7 A;  5DCZ A;  4RCG A;  5EBT A;  4UVX A;  4UW1 A;  3UH2 A;  4BJB A;  4TVJ A;  1OS1 A;  4GNL A;  3KR7 A;  4GMM A;  4I9I A;  4N4T A;  4L70 A;  4UI7 A;  4UUH A;  4GV4 A;  4UVZ A;  4BUD A;  4R5W A;  4WOU A;  5AL5 A;  4PY4 A;  4BUX A;  3CE0 A;  4UVS A;  4OPX C;  4TOS A;  2QF2 A;  4UI5 A;  3PAX A;  4PAX A;  4UVL A;  2OLQ A;  2PQF A;  3W51 A;  4BUF A;  4N4V A;  4R43 A;  5AKU A;  4KZU A;  1EFY A;  1XKV A;  2PY7 X;  3HKV A;  5FH3 A;  4BU9 A;  3DT4 A;  4L0I A;  3SMI A;  5ADT A;  4TJU A;  4L10 A;  4N3R A;  4UVU A;  3MHJ A;  1GS0 A;  4TJY A;  2QF1 A;  4PJT A;  4OX2 A;  4WPT A;  4DQY C;  4BUS A;  3GN7 A;  1J3B A;  2FAH A;  4L2K A;  4PNN A;  4GNQ A;  5LX6 A;  1AQ2 A;  4HLH A;  4L33 A;  4PNM A;  4HKI A;  4WL8 A;  4GNP A;  4F1L A;  4BS4 A;  2FAF A;  3SE2 A;  4YWD A;  2X5Y A;  4F0E A;  4HMH A;  5FH1 A;  4GNM A;  2RKD A; 
#chains in the Genus database with same CATH homology
 4L09 A;  3UH4 A;  4J1Z A;  4R6E A;  4UVY A;  4UVO A;  4RV6 A;  4W5I A;  4L0S A;  5ADQ A;  4DVI A;  5LXP A;  5AL3 A;  4ZZZ A;  4AVW A;  1KHF A;  4UVN A;  3U9H A;  1PAX A;  4MSG A;  1KHG A;  4L7O A;  4F1Q A;  5LYH A;  4BUW A;  4KZL A;  5FH2 A;  4GMW A;  2ZCI A;  4YW8 A;  4HL5 A;  4BFP A;  4BUI A;  4UHG A;  4OQA C;  4YW9 A;  4PNQ A;  1YVY A;  5FPG A;  5ETY A;  4L34 A;  2QEY A;  4J3M A;  4LI6 A;  4OQB C;  4PNL A;  4UVP A;  4BUE A;  5ADR A;  4PJV A;  4BJC A;  4BU7 A;  3C4H A;  4UI8 A;  4GMZ A;  1K3C A;  1UK1 A;  4PNT A;  4HLM A;  4X52 A;  4L7R A;  2RF5 A;  4TKG A;  4K4F A;  1YTM A;  4BU5 A;  4L7P A;  4L32 A;  3C49 A;  3MHK A;  4UVW A;  3BLJ A;  2RK7 A;  4L2F A;  4U6A A;  4L2G A;  5FH4 A;  4GV0 A;  5AEH A;  4WPV A;  5AL2 A;  4L0B A;  4HLF A;  4BUA A;  5FPF A;  4L0T A;  1A26 A;  2OLR A;  4UFY A;  4UVT A;  4MSK A;  5C5Q A;  2RKA A;  3GJW A;  4M7B A;  4ZZX A;  5AKW A;  4AVU A;  4WIE A;  4TK5 A;  4BJ9 A;  3KCZ A;  4TKF A;  2QEW A;  4YWB A;  4BU6 A;  1WOK A;  4UFU A;  4UND A;  5AL4 A;  4L0V A;  4HKN A;  4IUE A;  4L7L A;  2RKE A;  3DT2 A;  3KJD A;  1OEN A;  4L6Z A;  4UI6 A;  1YGG A;  4J22 A;  2PC9 A;  4PML A;  4UX4 A;  4HYF A;  3GOY A;  4TKI A;  4UXB A;  4HLG A;  2RD6 A;  4OA7 A;  3GEY A;  3KR8 A;  4HLK A;  5FH5 A;  4TK0 A;  3P0Q A;  2PXZ X;  1K3D A;  3MOF A;  4GV7 A;  4PNS A;  4UI4 A;  4W5S A;  4UVV A;  2PAW A;  4L6S A;  3L3L A;  5AL1 A;  4BUT A;  4BUV A;  1AYL A;  3U9Y A;  4MT9 A;  4BUY A;  1KHB A;  1II2 A;  4BUU A;  4J3L A;  4WIU A;  2RCW A;  5C5R A;  4HHZ A;  2GMV A;  3UDD A;  3UA9 A;  1YLH A;  5A00 A;  4W6E A;  4TJW A;  4GNO A;  4L7N A;  1UK0 A;  2PAX A;  3MOH A;  4PNR A;  4XHU A;  5ADS A;  4J21 A;  4KRS A;  4ZZY A;  4GMU A;  3SMJ A;  5FH0 A;  4BU3 A;  4L7U A;  4UI3 A;  5C5P A;  4LI8 A;  5ECE A;  5I67 A;  1NHX A;  3L3M A;  4K4E A;  4L31 A;  3MOE A;  4GV2 A;  3DT7 A;  2RK8 A;  1M51 A;  3DTB A;  3P0N A;  4BU8 A;  4TOR A;  1KHE A;  3FHB A;  2QZY A;  4HKK A;  4HHY A;  4KZQ A;  4WPU A;  3P0P A;  4LI7 A;  5DCZ A;  4RCG A;  5EBT A;  4UVX A;  4UW1 A;  3UH2 A;  4BJB A;  4TVJ A;  1OS1 A;  4GNL A;  3KR7 A;  4GMM A;  4I9I A;  4N4T A;  4L70 A;  4UI7 A;  4UUH A;  4GV4 A;  4UVZ A;  4BUD A;  4R5W A;  4WOU A;  5AL5 A;  4PY4 A;  4BUX A;  3CE0 A;  4UVS A;  4OPX C;  4TOS A;  2QF2 A;  4UI5 A;  3PAX A;  4PAX A;  4UVL A;  2OLQ A;  2PQF A;  3W51 A;  4BUF A;  4N4V A;  4R43 A;  5AKU A;  4KZU A;  1EFY A;  1XKV A;  2PY7 X;  3HKV A;  5FH3 A;  4BU9 A;  3DT4 A;  4L0I A;  3SMI A;  5ADT A;  4TJU A;  4L10 A;  4N3R A;  4UVU A;  3MHJ A;  1GS0 A;  4TJY A;  2QF1 A;  4PJT A;  4OX2 A;  4WPT A;  4DQY C;  4BUS A;  3GN7 A;  1J3B A;  2FAH A;  4L2K A;  4PNN A;  4GNQ A;  5LX6 A;  1AQ2 A;  4HLH A;  4L33 A;  4PNM A;  4HKI A;  4WL8 A;  4GNP A;  4F1L A;  4BS4 A;  2FAF A;  3SE2 A;  4YWD A;  2X5Y A;  4F0E A;  4HMH A;  5FH1 A;  4GNM A;  2RKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...