4F0EA

Human adp-ribosyltransferase 7 (artd7/parp15), catalytic domain in complex with sto1102
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
198
structure length
198
Chain Sequence
MNLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVKKRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSAKDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLFVVFFDNQAYPEYLITFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Poly [ADP-ribose] polymerase 15
publication title Discovery of Ligands for ADP-Ribosyltransferases via Docking-Based Virtual Screening.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4f0eA00
4UVSA 5ADTA 4F1QA 5C5PA 4OA7A 4L32A 4UVPA 4UVTA 5AEHA 4HLKA 4BUUA 4L7RA 3GN7A 4PNQA 5ADRA 4BJ9A 4K4FA 2RF5A 4PY4A 5FPGA 4L33A 4BUVA 2PQFA 4M7BA 4DQYC 4MT9A 4KZQA 4L2FA 4L2KA 5LXPA 3GEYA 3L3LA 4L09A 4L6SA 4N3RA 3C49A 4AVWA 4LI8A 5C5QA 4BU9A 4PNSA 4PNNA 3BLJA 4TJWA 4UI6A 5AL3A 4AVUA 4BUDA 3P0NA 4GV7A 4UVXA 3SE2A 4GV2A 4BUAA 2RD6A 3KCZA 5ETYA 5ADSA 4W5SA 4UI5A 4L31A 4BUEA 3MHKA 4I9IA 4MSKA 4J3LA 4U6AA 4UW1A 4UFYA 3U9HA 3HKVA 4BFPA 4BU6A 4DVIA 4ZZZA 5LX6A 4UI3A 4F1LA 4L10A 4UVVA 4L34A 4K4EA 4TOSA 4X52A 3P0QA 4L0BA 4HL5A 4HKKA 4BU5A 4L7LA 4TK5A 5AL2A 4HHZA 4UVNA 4L70A 4TORA 4KZLA 4UVWA 5AKUA 4ZZXA 3SMJA 4UI8A 1EFYA 4PAXA 3UH2A 4L0IA 5EBTA 2PAXA 4UVLA 4J22A 3C4HA 4UX4A 4PJTA 1WOKA 2PAWA 4BJBA 4PNMA 4UVUA 4TJYA 4L6ZA 4IUEA 5DCZA 4UFUA 4OPXC 4MSGA 4UNDA 4UXBA 3GJWA 4UUHA 4HYFA 4BU8A 5A00A 2RCWA 3CE0A 3GOYA 4HKIA 3UA9A 4HLHA 3FHBA 4L0TA 4HLFA 3UH4A 1UK0A 4L0VA 4UVZA 4HHYA 4L0SA 5AKWA 5ECEA 4L7OA 4J3MA 4F0EA 2X5YA 4TK0A 4BUXA 4BUTA 4BUSA 5C5RA 4GV0A 4BUIA 4J1ZA 4N4TA 4TKGA 5AL1A 3KR8A 3MHJA 4UVYA 4L7UA 4TVJA 4KRSA 4GV4A 3PAXA 4OQBC 4BUWA 4ZZYA 4PJVA 4BUYA 5LYHA 4W6EA 5AL4A 4KZUA 4PNRA 4OQAC 3P0PA 4HKNA 1A26A 4PNTA 5AL5A 4UHGA 4UI7A 4R5WA 3SMIA 4LI6A 4BU3A 4TJUA 4BS4A 4L2GA 4PMLA 4RV6A 4BU7A 4UVOA 4W5IA 3UDDA 4HLMA 4TKIA 4UI4A 4BJCA 4HMHA 3L3MA 1GS0A 4HLGA 3KR7A 5FPFA 3KJDA 4LI7A 4R6EA 1UK1A 4N4VA 3W51A 4J21A 4L7NA 4L7PA 4TKFA 5ADQA 4PNLA 4BUFA 4XHUA 3U9YA 1PAXA
chains in the Genus database with same CATH superfamily
4UVSA 1XKVA 3MOHA 5ADTA 4F1QA 5C5PA 2RKDA 4OA7A 4L32A 4UVPA 4UVTA 5AEHA 4HLKA 4BUUA 4L7RA 2QF1A 3GN7A 4PNQA 2QEYA 4RCGA 5ADRA 1KHBA 4BJ9A 1AQ2A 4K4FA 2RF5A 4YW8A 4PY4A 5FPGA 4L33A 4BUVA 2PQFA 4GNMA 4M7BA 1YVYA 4DQYC 1OS1A 4MT9A 4KZQA 4L2FA 4L2KA 5LXPA 3GEYA 4GNPA 4GMWA 2OLRA 2RKAA 3L3LA 4WOUA 4L09A 4L6SA 1K3DA 4N3RA 3C49A 4AVWA 4LI8A 5C5QA 2QEWA 4BU9A 4PNSA 4PNNA 3BLJA 4TJWA 2FAFA 4UI6A 5AL3A 4AVUA 3P0NA 4GV7A 1OENA 4UVXA 4GV2A 4WIUA 3SE2A 2RD6A 4GNQA 3KCZA 5ETYA 4BUAA 5ADSA 4W5SA 4UI5A 4L31A 4BUEA 3MHKA 4I9IA 4MSKA 4J3LA 4U6AA 4UW1A 1M51A 4UFYA 3U9HA 3HKVA 4BFPA 4BU6A 4DVIA 4ZZZA 5LX6A 4WPUA 4UI3A 4F1LA 4YWBA 4L10A 4UVVA 4L34A 4K4EA 2PY7X 4GNLA 3P0QA 4TOSA 4L0BA 4X52A 5FH5A 4HL5A 4HKKA 3DT4A 4L7LA 4BU5A 4TK5A 5FH0A 1KHGA 1NHXA 1YLHA 5AL2A 5FH2A 4HHZA 2PXZX 4GMUA 4L70A 4TORA 4KZLA 4UVWA 4UVNA 4WPVA 5AKUA 4ZZXA 3SMJA 4UI8A 1EFYA 4PAXA 3UH2A 4L0IA 5EBTA 2PAXA 1KHFA 4UVLA 2FAHA 4J22A 3C4HA 4UX4A 2OLQA 4PJTA 1WOKA 1J3BA 3MOFA 3MOEA 2PAWA 4BJBA 4BUDA 4GNOA 4PNMA 4UVUA 4TJYA 4L6ZA 4IUEA 5DCZA 2PC9A 4WPTA 1K3CA 4UFUA 4OPXC 4MSGA 4UNDA 4UXBA 3GJWA 4GMZA 4UUHA 4HYFA 4BU8A 5A00A 2QZYA 2RCWA 3CE0A 3GOYA 4HKIA 3UA9A 4HLHA 3FHBA 4L0TA 5FH1A 4HLFA 3UH4A 1UK0A 4L0VA 4UVZA 4HHYA 3DT2A 4L0SA 5AKWA 2ZCIA 5ECEA 4L7OA 4J3MA 4F0EA 2X5YA 1YTMA 1KHEA 4TK0A 4BUXA 4BUTA 4BUSA 5C5RA 4GV0A 2GMVA 4J1ZA 4BUIA 4N4TA 4TKGA 5AL1A 3KR8A 3MHJA 4UVYA 4L7UA 4R43A 4TVJA 2RK7A 4KRSA 2RKEA 3PAXA 4GV4A 4OX2A 4WL8A 3DTBA 4OQBC 4BUWA 4ZZYA 4PJVA 5FH4A 4BUYA 5LYHA 4GMMA 4WIEA 3DT7A 4W6EA 5AL4A 4KZUA 4PNRA 5FPFA 4OQAC 3P0PA 4HKNA 1A26A 4PNTA 5AL5A 4UHGA 1II2A 4UI7A 5I67A 4R5WA 3SMIA 4LI6A 4BU3A 4TJUA 4BS4A 5FH3A 4L2GA 4PMLA 4RV6A 4BU7A 4UVOA 4W5IA 2RK8A 4HLMA 4TKIA 4UI4A 3UDDA 4BJCA 4HMHA 3L3MA 1GS0A 1AYLA 3KR7A 1YGGA 4HLGA 3KJDA 4YW9A 4LI7A 4R6EA 4YWDA 1UK1A 4N4VA 3W51A 4J21A 4L7NA 2QF2A 4L7PA 4TKFA 5ADQA 4PNLA 4BUFA 4XHUA 3U9YA 1PAXA
chains in the Genus database with same CATH topology
4UVSA 1XKVA 3MOHA 5ADTA 4F1QA 5C5PA 2RKDA 4OA7A 4L32A 4UVPA 4UVTA 5AEHA 4HLKA 4BUUA 4L7RA 2QF1A 3GN7A 4PNQA 2QEYA 4RCGA 5ADRA 1KHBA 4BJ9A 1AQ2A 4K4FA 2RF5A 4YW8A 4PY4A 5FPGA 4L33A 4BUVA 2PQFA 4GNMA 4M7BA 1YVYA 4DQYC 1OS1A 4MT9A 4KZQA 4L2FA 4L2KA 5LXPA 3GEYA 4GNPA 4GMWA 2OLRA 2RKAA 3L3LA 4WOUA 4L09A 4L6SA 1K3DA 4N3RA 3C49A 4AVWA 4LI8A 5C5QA 2QEWA 4BU9A 4PNSA 4PNNA 3BLJA 4TJWA 2FAFA 4UI6A 5AL3A 4AVUA 3P0NA 4GV7A 1OENA 4UVXA 4GV2A 4WIUA 3SE2A 2RD6A 4GNQA 3KCZA 5ETYA 4BUAA 5ADSA 4W5SA 4UI5A 4L31A 4BUEA 3MHKA 4I9IA 4MSKA 4J3LA 4U6AA 4UW1A 1M51A 4UFYA 3U9HA 3HKVA 4BFPA 4BU6A 4DVIA 4ZZZA 5LX6A 4WPUA 4UI3A 4F1LA 4YWBA 4L10A 4UVVA 4L34A 4K4EA 2PY7X 4GNLA 3P0QA 4TOSA 4L0BA 4X52A 5FH5A 4HL5A 4HKKA 3DT4A 4L7LA 4BU5A 4TK5A 5FH0A 1KHGA 1NHXA 1YLHA 5AL2A 5FH2A 4HHZA 2PXZX 4GMUA 4L70A 4TORA 4KZLA 4UVWA 4UVNA 4WPVA 5AKUA 4ZZXA 3SMJA 4UI8A 1EFYA 4PAXA 3UH2A 4L0IA 5EBTA 2PAXA 1KHFA 4UVLA 2FAHA 4J22A 3C4HA 4UX4A 2OLQA 4PJTA 1WOKA 1J3BA 3MOFA 3MOEA 2PAWA 4BJBA 4BUDA 4GNOA 4PNMA 4UVUA 4TJYA 4L6ZA 4IUEA 5DCZA 2PC9A 4WPTA 1K3CA 4UFUA 4OPXC 4MSGA 4UNDA 4UXBA 3GJWA 4GMZA 4UUHA 4HYFA 4BU8A 5A00A 2QZYA 2RCWA 3CE0A 3GOYA 4HKIA 3UA9A 4HLHA 3FHBA 4L0TA 5FH1A 4HLFA 3UH4A 1UK0A 4L0VA 4UVZA 4HHYA 3DT2A 4L0SA 5AKWA 2ZCIA 5ECEA 4L7OA 4J3MA 4F0EA 2X5YA 1YTMA 1KHEA 4TK0A 4BUXA 4BUTA 4BUSA 5C5RA 4GV0A 2GMVA 4J1ZA 4BUIA 4N4TA 4TKGA 5AL1A 3KR8A 3MHJA 4UVYA 4L7UA 4R43A 4TVJA 2RK7A 4KRSA 2RKEA 3PAXA 4GV4A 4OX2A 4WL8A 3DTBA 4OQBC 4BUWA 4ZZYA 4PJVA 5FH4A 4BUYA 5LYHA 4GMMA 4WIEA 3DT7A 4W6EA 5AL4A 4KZUA 4PNRA 5FPFA 4OQAC 3P0PA 4HKNA 1A26A 4PNTA 5AL5A 4UHGA 1II2A 4UI7A 5I67A 4R5WA 3SMIA 4LI6A 4BU3A 4TJUA 4BS4A 5FH3A 4L2GA 4PMLA 4RV6A 4BU7A 4UVOA 4W5IA 2RK8A 4HLMA 4TKIA 4UI4A 3UDDA 4BJCA 4HMHA 3L3MA 1GS0A 1AYLA 3KR7A 1YGGA 4HLGA 3KJDA 4YW9A 4LI7A 4R6EA 4YWDA 1UK1A 4N4VA 3W51A 4J21A 4L7NA 2QF2A 4L7PA 4TKFA 5ADQA 4PNLA 4BUFA 4XHUA 3U9YA 1PAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVS A;  5ADT A;  4F1Q A;  5C5P A;  4OA7 A;  4L32 A;  4UVP A;  4UVT A;  5AEH A;  4HLK A;  4BUU A;  4L7R A;  3GN7 A;  4PNQ A;  5ADR A;  4BJ9 A;  4K4F A;  2RF5 A;  4PY4 A;  5FPG A;  4L33 A;  4BUV A;  2PQF A;  4M7B A;  4DQY C;  4MT9 A;  4KZQ A;  4L2F A;  4L2K A;  5LXP A;  3GEY A;  3L3L A;  4L09 A;  4L6S A;  4N3R A;  3C49 A;  4AVW A;  4LI8 A;  5C5Q A;  4BU9 A;  4PNS A;  4PNN A;  3BLJ A;  4TJW A;  4UI6 A;  5AL3 A;  4AVU A;  4BUD A;  3P0N A;  4GV7 A;  4UVX A;  3SE2 A;  4GV2 A;  4BUA A;  2RD6 A;  3KCZ A;  5ETY A;  5ADS A;  4W5S A;  4UI5 A;  4L31 A;  4BUE A;  3MHK A;  4I9I A;  4MSK A;  4J3L A;  4U6A A;  4UW1 A;  4UFY A;  3U9H A;  3HKV A;  4BFP A;  4BU6 A;  4DVI A;  4ZZZ A;  5LX6 A;  4UI3 A;  4F1L A;  4L10 A;  4UVV A;  4L34 A;  4K4E A;  4TOS A;  4X52 A;  3P0Q A;  4L0B A;  4HL5 A;  4HKK A;  4BU5 A;  4L7L A;  4TK5 A;  5AL2 A;  4HHZ A;  4UVN A;  4L70 A;  4TOR A;  4KZL A;  4UVW A;  5AKU A;  4ZZX A;  3SMJ A;  4UI8 A;  1EFY A;  4PAX A;  3UH2 A;  4L0I A;  5EBT A;  2PAX A;  4UVL A;  4J22 A;  3C4H A;  4UX4 A;  4PJT A;  1WOK A;  2PAW A;  4BJB A;  4PNM A;  4UVU A;  4TJY A;  4L6Z A;  4IUE A;  5DCZ A;  4UFU A;  4OPX C;  4MSG A;  4UND A;  4UXB A;  3GJW A;  4UUH A;  4HYF A;  4BU8 A;  5A00 A;  2RCW A;  3CE0 A;  3GOY A;  4HKI A;  3UA9 A;  4HLH A;  3FHB A;  4L0T A;  4HLF A;  3UH4 A;  1UK0 A;  4L0V A;  4UVZ A;  4HHY A;  4L0S A;  5AKW A;  5ECE A;  4L7O A;  4J3M A;  4F0E A;  2X5Y A;  4TK0 A;  4BUX A;  4BUT A;  4BUS A;  5C5R A;  4GV0 A;  4BUI A;  4J1Z A;  4N4T A;  4TKG A;  5AL1 A;  3KR8 A;  3MHJ A;  4UVY A;  4L7U A;  4TVJ A;  4KRS A;  4GV4 A;  3PAX A;  4OQB C;  4BUW A;  4ZZY A;  4PJV A;  4BUY A;  5LYH A;  4W6E A;  5AL4 A;  4KZU A;  4PNR A;  4OQA C;  3P0P A;  4HKN A;  1A26 A;  4PNT A;  5AL5 A;  4UHG A;  4UI7 A;  4R5W A;  3SMI A;  4LI6 A;  4BU3 A;  4TJU A;  4BS4 A;  4L2G A;  4PML A;  4RV6 A;  4BU7 A;  4UVO A;  4W5I A;  3UDD A;  4HLM A;  4TKI A;  4UI4 A;  4BJC A;  4HMH A;  3L3M A;  1GS0 A;  4HLG A;  3KR7 A;  5FPF A;  3KJD A;  4LI7 A;  4R6E A;  1UK1 A;  4N4V A;  3W51 A;  4J21 A;  4L7N A;  4L7P A;  4TKF A;  5ADQ A;  4PNL A;  4BUF A;  4XHU A;  3U9Y A;  1PAX A; 
#chains in the Genus database with same CATH topology
 4UVS A;  1XKV A;  3MOH A;  5ADT A;  4F1Q A;  5C5P A;  2RKD A;  4OA7 A;  4L32 A;  4UVP A;  4UVT A;  5AEH A;  4HLK A;  4BUU A;  4L7R A;  2QF1 A;  3GN7 A;  4PNQ A;  2QEY A;  4RCG A;  5ADR A;  1KHB A;  4BJ9 A;  1AQ2 A;  4K4F A;  2RF5 A;  4YW8 A;  4PY4 A;  5FPG A;  4L33 A;  4BUV A;  2PQF A;  4GNM A;  4M7B A;  1YVY A;  4DQY C;  1OS1 A;  4MT9 A;  4KZQ A;  4L2F A;  4L2K A;  5LXP A;  3GEY A;  4GNP A;  4GMW A;  2OLR A;  2RKA A;  3L3L A;  4WOU A;  4L09 A;  4L6S A;  1K3D A;  4N3R A;  3C49 A;  4AVW A;  4LI8 A;  5C5Q A;  2QEW A;  4BU9 A;  4PNS A;  4PNN A;  3BLJ A;  4TJW A;  2FAF A;  4UI6 A;  5AL3 A;  4AVU A;  3P0N A;  4GV7 A;  1OEN A;  4UVX A;  4GV2 A;  4WIU A;  3SE2 A;  2RD6 A;  4GNQ A;  3KCZ A;  5ETY A;  4BUA A;  5ADS A;  4W5S A;  4UI5 A;  4L31 A;  4BUE A;  3MHK A;  4I9I A;  4MSK A;  4J3L A;  4U6A A;  4UW1 A;  1M51 A;  4UFY A;  3U9H A;  3HKV A;  4BFP A;  4BU6 A;  4DVI A;  4ZZZ A;  5LX6 A;  4WPU A;  4UI3 A;  4F1L A;  4YWB A;  4L10 A;  4UVV A;  4L34 A;  4K4E A;  2PY7 X;  4GNL A;  3P0Q A;  4TOS A;  4L0B A;  4X52 A;  5FH5 A;  4HL5 A;  4HKK A;  3DT4 A;  4L7L A;  4BU5 A;  4TK5 A;  5FH0 A;  1KHG A;  1NHX A;  1YLH A;  5AL2 A;  5FH2 A;  4HHZ A;  2PXZ X;  4GMU A;  4L70 A;  4TOR A;  4KZL A;  4UVW A;  4UVN A;  4WPV A;  5AKU A;  4ZZX A;  3SMJ A;  4UI8 A;  1EFY A;  4PAX A;  3UH2 A;  4L0I A;  5EBT A;  2PAX A;  1KHF A;  4UVL A;  2FAH A;  4J22 A;  3C4H A;  4UX4 A;  2OLQ A;  4PJT A;  1WOK A;  1J3B A;  3MOF A;  3MOE A;  2PAW A;  4BJB A;  4BUD A;  4GNO A;  4PNM A;  4UVU A;  4TJY A;  4L6Z A;  4IUE A;  5DCZ A;  2PC9 A;  4WPT A;  1K3C A;  4UFU A;  4OPX C;  4MSG A;  4UND A;  4UXB A;  3GJW A;  4GMZ A;  4UUH A;  4HYF A;  4BU8 A;  5A00 A;  2QZY A;  2RCW A;  3CE0 A;  3GOY A;  4HKI A;  3UA9 A;  4HLH A;  3FHB A;  4L0T A;  5FH1 A;  4HLF A;  3UH4 A;  1UK0 A;  4L0V A;  4UVZ A;  4HHY A;  3DT2 A;  4L0S A;  5AKW A;  2ZCI A;  5ECE A;  4L7O A;  4J3M A;  4F0E A;  2X5Y A;  1YTM A;  1KHE A;  4TK0 A;  4BUX A;  4BUT A;  4BUS A;  5C5R A;  4GV0 A;  2GMV A;  4J1Z A;  4BUI A;  4N4T A;  4TKG A;  5AL1 A;  3KR8 A;  3MHJ A;  4UVY A;  4L7U A;  4R43 A;  4TVJ A;  2RK7 A;  4KRS A;  2RKE A;  3PAX A;  4GV4 A;  4OX2 A;  4WL8 A;  3DTB A;  4OQB C;  4BUW A;  4ZZY A;  4PJV A;  5FH4 A;  4BUY A;  5LYH A;  4GMM A;  4WIE A;  3DT7 A;  4W6E A;  5AL4 A;  4KZU A;  4PNR A;  5FPF A;  4OQA C;  3P0P A;  4HKN A;  1A26 A;  4PNT A;  5AL5 A;  4UHG A;  1II2 A;  4UI7 A;  5I67 A;  4R5W A;  3SMI A;  4LI6 A;  4BU3 A;  4TJU A;  4BS4 A;  5FH3 A;  4L2G A;  4PML A;  4RV6 A;  4BU7 A;  4UVO A;  4W5I A;  2RK8 A;  4HLM A;  4TKI A;  4UI4 A;  3UDD A;  4BJC A;  4HMH A;  3L3M A;  1GS0 A;  1AYL A;  3KR7 A;  1YGG A;  4HLG A;  3KJD A;  4YW9 A;  4LI7 A;  4R6E A;  4YWD A;  1UK1 A;  4N4V A;  3W51 A;  4J21 A;  4L7N A;  2QF2 A;  4L7P A;  4TKF A;  5ADQ A;  4PNL A;  4BUF A;  4XHU A;  3U9Y A;  1PAX A; 
#chains in the Genus database with same CATH homology
 4UVS A;  1XKV A;  3MOH A;  5ADT A;  4F1Q A;  5C5P A;  2RKD A;  4OA7 A;  4L32 A;  4UVP A;  4UVT A;  5AEH A;  4HLK A;  4BUU A;  4L7R A;  2QF1 A;  3GN7 A;  4PNQ A;  2QEY A;  4RCG A;  5ADR A;  1KHB A;  4BJ9 A;  1AQ2 A;  4K4F A;  2RF5 A;  4YW8 A;  4PY4 A;  5FPG A;  4L33 A;  4BUV A;  2PQF A;  4GNM A;  4M7B A;  1YVY A;  4DQY C;  1OS1 A;  4MT9 A;  4KZQ A;  4L2F A;  4L2K A;  5LXP A;  3GEY A;  4GNP A;  4GMW A;  2OLR A;  2RKA A;  3L3L A;  4WOU A;  4L09 A;  4L6S A;  1K3D A;  4N3R A;  3C49 A;  4AVW A;  4LI8 A;  5C5Q A;  2QEW A;  4BU9 A;  4PNS A;  4PNN A;  3BLJ A;  4TJW A;  2FAF A;  4UI6 A;  5AL3 A;  4AVU A;  3P0N A;  4GV7 A;  1OEN A;  4UVX A;  4GV2 A;  4WIU A;  3SE2 A;  2RD6 A;  4GNQ A;  3KCZ A;  5ETY A;  4BUA A;  5ADS A;  4W5S A;  4UI5 A;  4L31 A;  4BUE A;  3MHK A;  4I9I A;  4MSK A;  4J3L A;  4U6A A;  4UW1 A;  1M51 A;  4UFY A;  3U9H A;  3HKV A;  4BFP A;  4BU6 A;  4DVI A;  4ZZZ A;  5LX6 A;  4WPU A;  4UI3 A;  4F1L A;  4YWB A;  4L10 A;  4UVV A;  4L34 A;  4K4E A;  2PY7 X;  4GNL A;  3P0Q A;  4TOS A;  4L0B A;  4X52 A;  5FH5 A;  4HL5 A;  4HKK A;  3DT4 A;  4L7L A;  4BU5 A;  4TK5 A;  5FH0 A;  1KHG A;  1NHX A;  1YLH A;  5AL2 A;  5FH2 A;  4HHZ A;  2PXZ X;  4GMU A;  4L70 A;  4TOR A;  4KZL A;  4UVW A;  4UVN A;  4WPV A;  5AKU A;  4ZZX A;  3SMJ A;  4UI8 A;  1EFY A;  4PAX A;  3UH2 A;  4L0I A;  5EBT A;  2PAX A;  1KHF A;  4UVL A;  2FAH A;  4J22 A;  3C4H A;  4UX4 A;  2OLQ A;  4PJT A;  1WOK A;  1J3B A;  3MOF A;  3MOE A;  2PAW A;  4BJB A;  4BUD A;  4GNO A;  4PNM A;  4UVU A;  4TJY A;  4L6Z A;  4IUE A;  5DCZ A;  2PC9 A;  4WPT A;  1K3C A;  4UFU A;  4OPX C;  4MSG A;  4UND A;  4UXB A;  3GJW A;  4GMZ A;  4UUH A;  4HYF A;  4BU8 A;  5A00 A;  2QZY A;  2RCW A;  3CE0 A;  3GOY A;  4HKI A;  3UA9 A;  4HLH A;  3FHB A;  4L0T A;  5FH1 A;  4HLF A;  3UH4 A;  1UK0 A;  4L0V A;  4UVZ A;  4HHY A;  3DT2 A;  4L0S A;  5AKW A;  2ZCI A;  5ECE A;  4L7O A;  4J3M A;  4F0E A;  2X5Y A;  1YTM A;  1KHE A;  4TK0 A;  4BUX A;  4BUT A;  4BUS A;  5C5R A;  4GV0 A;  2GMV A;  4J1Z A;  4BUI A;  4N4T A;  4TKG A;  5AL1 A;  3KR8 A;  3MHJ A;  4UVY A;  4L7U A;  4R43 A;  4TVJ A;  2RK7 A;  4KRS A;  2RKE A;  3PAX A;  4GV4 A;  4OX2 A;  4WL8 A;  3DTB A;  4OQB C;  4BUW A;  4ZZY A;  4PJV A;  5FH4 A;  4BUY A;  5LYH A;  4GMM A;  4WIE A;  3DT7 A;  4W6E A;  5AL4 A;  4KZU A;  4PNR A;  5FPF A;  4OQA C;  3P0P A;  4HKN A;  1A26 A;  4PNT A;  5AL5 A;  4UHG A;  1II2 A;  4UI7 A;  5I67 A;  4R5W A;  3SMI A;  4LI6 A;  4BU3 A;  4TJU A;  4BS4 A;  5FH3 A;  4L2G A;  4PML A;  4RV6 A;  4BU7 A;  4UVO A;  4W5I A;  2RK8 A;  4HLM A;  4TKI A;  4UI4 A;  3UDD A;  4BJC A;  4HMH A;  3L3M A;  1GS0 A;  1AYL A;  3KR7 A;  1YGG A;  4HLG A;  3KJD A;  4YW9 A;  4LI7 A;  4R6E A;  4YWD A;  1UK1 A;  4N4V A;  3W51 A;  4J21 A;  4L7N A;  2QF2 A;  4L7P A;  4TKF A;  5ADQ A;  4PNL A;  4BUF A;  4XHU A;  3U9Y A;  1PAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...