4F1QA

Human artd8 (parp14, bal2) - catalytic domain in complex with a16(e)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
183
Chain Sequence
KQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Poly [ADP-ribose] polymerase 14
publication title Discovery of Ligands for ADP-Ribosyltransferases via Docking-Based Virtual Screening.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 183
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4f1qA00
1PAXA 3GOYA 4BFPA 4OQBC 4UFUA 4KZUA 4J1ZA 4HLKA 4BU3A 5ADQA 4BU5A 3CE0A 3PAXA 4GV4A 4PNMA 4HHYA 4HKKA 3KR8A 4TOSA 4L7RA 5C5QA 4UVSA 3UH2A 4UVTA 3KJDA 4UFYA 4W5IA 4PMLA 4BUVA 4HMHA 4UVVA 1GS0A 4RV6A 4UI3A 4UVUA 4L0SA 4X52A 5FPGA 4L0TA 4TKFA 4R6EA 4L31A 4BUTA 4PNNA 2PAWA 4N4VA 5EBTA 4HYFA 3UA9A 5FPFA 4PJTA 4KRSA 4AVUA 4UUHA 4BU6A 4L6ZA 4L32A 4L33A 4LI6A 4L0IA 5AKUA 4BJBA 4F1LA 4F1QA 4BUIA 4U6AA 4PY4A 3C49A 4L2GA 4L7UA 1WOKA 5AKWA 4BUXA 4UI6A 4L7PA 4KZLA 4HLMA 4HKIA 3GJWA 4L7LA 4IUEA 2PAXA 4K4FA 4L7OA 1EFYA 3FHBA 5LYHA 4R5WA 4L70A 4ZZXA 4J3LA 4L0VA 4F0EA 5DCZA 4UNDA 4AVWA 2X5YA 1UK0A 4LI8A 3SE2A 3HKVA 4UVZA 1A26A 4M7BA 5A00A 5AEHA 4BU8A 3KCZA 4UVXA 4TKGA 3GEYA 4UXBA 4L7NA 4BU7A 4OQAC 4GV2A 4BJCA 4PAXA 4PNRA 4BUSA 4BUYA 3C4HA 4I9IA 3UDDA 4BUWA 4BUDA 4TVJA 3BLJA 5LX6A 4MT9A 4HLHA 4HHZA 2RCWA 4HKNA 4UI7A 4L2KA 4W5SA 5AL1A 4BU9A 4BUUA 4BS4A 4UVYA 4PJVA 3W51A 4PNTA 4HLFA 5C5RA 3SMIA 4UI5A 4K4EA 3P0QA 1UK1A 4J22A 4DQYC 4L10A 4UI8A 4UVNA 3MHJA 4UX4A 4TJUA 3P0NA 4BJ9A 4DVIA 4OPXC 5LXPA 4PNQA 2RF5A 4L09A 4UI4A 3SMJA 4HL5A 3U9HA 3U9YA 3MHKA 4ZZYA 4UVPA 4N3RA 4TJWA 4TK5A 4GV7A 4L34A 4XHUA 4TKIA 5ADSA 2PQFA 4W6EA 5AL3A 5ECEA 3GN7A 4UVOA 4L6SA 4PNLA 4UW1A 5ADRA 4BUAA 3UH4A 3KR7A 4TK0A 4TJYA 5ADTA 4PNSA 4J3MA 4GV0A 4L0BA 3P0PA 4UVLA 4J21A 4OA7A 5AL4A 4MSKA 4LI7A 4N4TA 4MSGA 5C5PA 4L2FA 4TORA 4UVWA 5AL5A 4HLGA 5AL2A 4BUEA 4BUFA 2RD6A 4ZZZA 4UHGA 3L3LA 4KZQA 5ETYA 3L3MA
chains in the Genus database with same CATH superfamily
1PAXA 3GOYA 2QZYA 4BFPA 4OQBC 2OLRA 4KZUA 4J1ZA 4HLKA 4UFUA 4BU3A 4BU5A 5ADQA 5FH5A 3CE0A 3PAXA 2RKAA 4GV4A 2GMVA 4HHYA 2PY7X 3KR8A 4HKKA 4L7RA 4PNMA 4UVSA 4UVTA 3KJDA 4UFYA 4W5IA 3UH2A 4PMLA 4BUVA 4HMHA 4UVVA 1GS0A 4RV6A 4UI3A 4UVUA 4RCGA 4L0SA 4X52A 5FPGA 4L0TA 4YW9A 4GMUA 4TKFA 4R6EA 1YVYA 4L31A 2RKEA 4PNNA 4BUTA 2PAWA 4N4VA 5EBTA 4HYFA 3UA9A 5FPFA 3MOEA 4PJTA 2FAFA 4KRSA 4AVUA 1KHGA 4UUHA 4BU6A 4L6ZA 4L32A 4L33A 4LI6A 4L0IA 4GMZA 5AKUA 2RK7A 4BJBA 4F1LA 4F1QA 4BUIA 4U6AA 1K3DA 5I67A 4WIUA 4PY4A 3C49A 4L2GA 4L7UA 1WOKA 5AKWA 4BUXA 4UI6A 2QEWA 4L7PA 4KZLA 4HLMA 4HKIA 3MOFA 3GJWA 3MOHA 4IUEA 4L7LA 2PAXA 1YTMA 4K4FA 4ZZZA 4L7OA 1EFYA 3FHBA 5LYHA 4R5WA 4L70A 1XKVA 4J3LA 4L0VA 4ZZXA 1YGGA 1OENA 4GMWA 5DCZA 4F0EA 4UNDA 4AVWA 2X5YA 1UK0A 1OS1A 4LI8A 4GNPA 4GNLA 3SE2A 4WL8A 3HKVA 4UVZA 1A26A 4M7BA 4WPTA 5A00A 5AEHA 4BU8A 1AYLA 5FH4A 3KCZA 4UVXA 4TKGA 3GEYA 4UXBA 4L7NA 4BU7A 4OQAC 4GV2A 4GNMA 4PAXA 4BJCA 4PNRA 4BUSA 4BUYA 2PXZX 3C4HA 4I9IA 3UDDA 4BUWA 5FH1A 2PC9A 3DTBA 4BUDA 4TVJA 2OLQA 3DT4A 3BLJA 5LX6A 4MT9A 4HLHA 4HHZA 4WIEA 2RCWA 2RK8A 4HKNA 4OX2A 1KHFA 4L2KA 4UI7A 4W5SA 5AL1A 4BU9A 4BUUA 4BS4A 4UVYA 4PJVA 5FH2A 3W51A 4PNTA 4HLFA 5C5RA 3SMIA 4UI5A 4K4EA 3P0QA 1UK1A 4J22A 4DQYC 1KHEA 4L10A 4UI8A 2FAHA 4GNOA 4UVNA 2QF1A 4YWDA 1II2A 3MHJA 4UX4A 4TJUA 3DT7A 3P0NA 4YWBA 4BJ9A 4DVIA 4OPXC 5LXPA 4PNQA 2RF5A 4L09A 4UI4A 4WPVA 3SMJA 4HL5A 4WPUA 3U9HA 3U9YA 2QEYA 3MHKA 4ZZYA 4UVPA 4N3RA 4TJWA 1J3BA 4TK5A 4GV7A 4L34A 4XHUA 4TKIA 5ADSA 2PQFA 3DT2A 4W6EA 5AL3A 3GN7A 5ECEA 4UVOA 2RKDA 4L6SA 4PNLA 4UW1A 5ADRA 4BUAA 3UH4A 3KR7A 4TK0A 5C5QA 4TJYA 4TOSA 2QF2A 5ADTA 1K3CA 4J3MA 4GV0A 4L0BA 3P0PA 4PNSA 4UVLA 1NHXA 4YW8A 4J21A 4OA7A 5AL4A 4GMMA 2ZCIA 4MSKA 4LI7A 4N4TA 4GNQA 4MSGA 5C5PA 4L2FA 5FH3A 1M51A 4TORA 4UVWA 1YLHA 5AL5A 4HLGA 5FH0A 1AQ2A 5AL2A 4WOUA 4BUEA 4R43A 2RD6A 1KHBA 4BUFA 4UHGA 3L3LA 4KZQA 5ETYA 3L3MA
chains in the Genus database with same CATH topology
1PAXA 3GOYA 2QZYA 4BFPA 4OQBC 2OLRA 4KZUA 4J1ZA 4HLKA 4UFUA 4BU3A 4BU5A 5ADQA 5FH5A 3CE0A 3PAXA 2RKAA 4GV4A 2GMVA 4HHYA 2PY7X 3KR8A 4HKKA 4L7RA 4PNMA 4UVSA 4UVTA 3KJDA 4UFYA 4W5IA 3UH2A 4PMLA 4BUVA 4HMHA 4UVVA 1GS0A 4RV6A 4UI3A 4UVUA 4RCGA 4L0SA 4X52A 5FPGA 4L0TA 4YW9A 4GMUA 4TKFA 4R6EA 1YVYA 4L31A 2RKEA 4PNNA 4BUTA 2PAWA 4N4VA 5EBTA 4HYFA 3UA9A 5FPFA 3MOEA 4PJTA 2FAFA 4KRSA 4AVUA 1KHGA 4UUHA 4BU6A 4L6ZA 4L32A 4L33A 4LI6A 4L0IA 4GMZA 5AKUA 2RK7A 4BJBA 4F1LA 4F1QA 4BUIA 4U6AA 1K3DA 5I67A 4WIUA 4PY4A 3C49A 4L2GA 4L7UA 1WOKA 5AKWA 4BUXA 4UI6A 2QEWA 4L7PA 4KZLA 4HLMA 4HKIA 3MOFA 3GJWA 3MOHA 4IUEA 4L7LA 2PAXA 1YTMA 4K4FA 4ZZZA 4L7OA 1EFYA 3FHBA 5LYHA 4R5WA 4L70A 1XKVA 4J3LA 4L0VA 4ZZXA 1YGGA 1OENA 4GMWA 5DCZA 4F0EA 4UNDA 4AVWA 2X5YA 1UK0A 1OS1A 4LI8A 4GNPA 4GNLA 3SE2A 4WL8A 3HKVA 4UVZA 1A26A 4M7BA 4WPTA 5A00A 5AEHA 4BU8A 1AYLA 5FH4A 3KCZA 4UVXA 4TKGA 3GEYA 4UXBA 4L7NA 4BU7A 4OQAC 4GV2A 4GNMA 4PAXA 4BJCA 4PNRA 4BUSA 4BUYA 2PXZX 3C4HA 4I9IA 3UDDA 4BUWA 5FH1A 2PC9A 3DTBA 4BUDA 4TVJA 2OLQA 3DT4A 3BLJA 5LX6A 4MT9A 4HLHA 4HHZA 4WIEA 2RCWA 2RK8A 4HKNA 4OX2A 1KHFA 4L2KA 4UI7A 4W5SA 5AL1A 4BU9A 4BUUA 4BS4A 4UVYA 4PJVA 5FH2A 3W51A 4PNTA 4HLFA 5C5RA 3SMIA 4UI5A 4K4EA 3P0QA 1UK1A 4J22A 4DQYC 1KHEA 4L10A 4UI8A 2FAHA 4GNOA 4UVNA 2QF1A 4YWDA 1II2A 3MHJA 4UX4A 4TJUA 3DT7A 3P0NA 4YWBA 4BJ9A 4DVIA 4OPXC 5LXPA 4PNQA 2RF5A 4L09A 4UI4A 4WPVA 3SMJA 4HL5A 4WPUA 3U9HA 3U9YA 2QEYA 3MHKA 4ZZYA 4UVPA 4N3RA 4TJWA 1J3BA 4TK5A 4GV7A 4L34A 4XHUA 4TKIA 5ADSA 2PQFA 3DT2A 4W6EA 5AL3A 3GN7A 5ECEA 4UVOA 2RKDA 4L6SA 4PNLA 4UW1A 5ADRA 4BUAA 3UH4A 3KR7A 4TK0A 5C5QA 4TJYA 4TOSA 2QF2A 5ADTA 1K3CA 4J3MA 4GV0A 4L0BA 3P0PA 4PNSA 4UVLA 1NHXA 4YW8A 4J21A 4OA7A 5AL4A 4GMMA 2ZCIA 4MSKA 4LI7A 4N4TA 4GNQA 4MSGA 5C5PA 4L2FA 5FH3A 1M51A 4TORA 4UVWA 1YLHA 5AL5A 4HLGA 5FH0A 1AQ2A 5AL2A 4WOUA 4BUEA 4R43A 2RD6A 1KHBA 4BUFA 4UHGA 3L3LA 4KZQA 5ETYA 3L3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAX A;  3GOY A;  4BFP A;  4OQB C;  4UFU A;  4KZU A;  4J1Z A;  4HLK A;  4BU3 A;  5ADQ A;  4BU5 A;  3CE0 A;  3PAX A;  4GV4 A;  4PNM A;  4HHY A;  4HKK A;  3KR8 A;  4TOS A;  4L7R A;  5C5Q A;  4UVS A;  3UH2 A;  4UVT A;  3KJD A;  4UFY A;  4W5I A;  4PML A;  4BUV A;  4HMH A;  4UVV A;  1GS0 A;  4RV6 A;  4UI3 A;  4UVU A;  4L0S A;  4X52 A;  5FPG A;  4L0T A;  4TKF A;  4R6E A;  4L31 A;  4BUT A;  4PNN A;  2PAW A;  4N4V A;  5EBT A;  4HYF A;  3UA9 A;  5FPF A;  4PJT A;  4KRS A;  4AVU A;  4UUH A;  4BU6 A;  4L6Z A;  4L32 A;  4L33 A;  4LI6 A;  4L0I A;  5AKU A;  4BJB A;  4F1L A;  4F1Q A;  4BUI A;  4U6A A;  4PY4 A;  3C49 A;  4L2G A;  4L7U A;  1WOK A;  5AKW A;  4BUX A;  4UI6 A;  4L7P A;  4KZL A;  4HLM A;  4HKI A;  3GJW A;  4L7L A;  4IUE A;  2PAX A;  4K4F A;  4L7O A;  1EFY A;  3FHB A;  5LYH A;  4R5W A;  4L70 A;  4ZZX A;  4J3L A;  4L0V A;  4F0E A;  5DCZ A;  4UND A;  4AVW A;  2X5Y A;  1UK0 A;  4LI8 A;  3SE2 A;  3HKV A;  4UVZ A;  1A26 A;  4M7B A;  5A00 A;  5AEH A;  4BU8 A;  3KCZ A;  4UVX A;  4TKG A;  3GEY A;  4UXB A;  4L7N A;  4BU7 A;  4OQA C;  4GV2 A;  4BJC A;  4PAX A;  4PNR A;  4BUS A;  4BUY A;  3C4H A;  4I9I A;  3UDD A;  4BUW A;  4BUD A;  4TVJ A;  3BLJ A;  5LX6 A;  4MT9 A;  4HLH A;  4HHZ A;  2RCW A;  4HKN A;  4UI7 A;  4L2K A;  4W5S A;  5AL1 A;  4BU9 A;  4BUU A;  4BS4 A;  4UVY A;  4PJV A;  3W51 A;  4PNT A;  4HLF A;  5C5R A;  3SMI A;  4UI5 A;  4K4E A;  3P0Q A;  1UK1 A;  4J22 A;  4DQY C;  4L10 A;  4UI8 A;  4UVN A;  3MHJ A;  4UX4 A;  4TJU A;  3P0N A;  4BJ9 A;  4DVI A;  4OPX C;  5LXP A;  4PNQ A;  2RF5 A;  4L09 A;  4UI4 A;  3SMJ A;  4HL5 A;  3U9H A;  3U9Y A;  3MHK A;  4ZZY A;  4UVP A;  4N3R A;  4TJW A;  4TK5 A;  4GV7 A;  4L34 A;  4XHU A;  4TKI A;  5ADS A;  2PQF A;  4W6E A;  5AL3 A;  5ECE A;  3GN7 A;  4UVO A;  4L6S A;  4PNL A;  4UW1 A;  5ADR A;  4BUA A;  3UH4 A;  3KR7 A;  4TK0 A;  4TJY A;  5ADT A;  4PNS A;  4J3M A;  4GV0 A;  4L0B A;  3P0P A;  4UVL A;  4J21 A;  4OA7 A;  5AL4 A;  4MSK A;  4LI7 A;  4N4T A;  4MSG A;  5C5P A;  4L2F A;  4TOR A;  4UVW A;  5AL5 A;  4HLG A;  5AL2 A;  4BUE A;  4BUF A;  2RD6 A;  4ZZZ A;  4UHG A;  3L3L A;  4KZQ A;  5ETY A;  3L3M A; 
#chains in the Genus database with same CATH topology
 1PAX A;  3GOY A;  2QZY A;  4BFP A;  4OQB C;  2OLR A;  4KZU A;  4J1Z A;  4HLK A;  4UFU A;  4BU3 A;  4BU5 A;  5ADQ A;  5FH5 A;  3CE0 A;  3PAX A;  2RKA A;  4GV4 A;  2GMV A;  4HHY A;  2PY7 X;  3KR8 A;  4HKK A;  4L7R A;  4PNM A;  4UVS A;  4UVT A;  3KJD A;  4UFY A;  4W5I A;  3UH2 A;  4PML A;  4BUV A;  4HMH A;  4UVV A;  1GS0 A;  4RV6 A;  4UI3 A;  4UVU A;  4RCG A;  4L0S A;  4X52 A;  5FPG A;  4L0T A;  4YW9 A;  4GMU A;  4TKF A;  4R6E A;  1YVY A;  4L31 A;  2RKE A;  4PNN A;  4BUT A;  2PAW A;  4N4V A;  5EBT A;  4HYF A;  3UA9 A;  5FPF A;  3MOE A;  4PJT A;  2FAF A;  4KRS A;  4AVU A;  1KHG A;  4UUH A;  4BU6 A;  4L6Z A;  4L32 A;  4L33 A;  4LI6 A;  4L0I A;  4GMZ A;  5AKU A;  2RK7 A;  4BJB A;  4F1L A;  4F1Q A;  4BUI A;  4U6A A;  1K3D A;  5I67 A;  4WIU A;  4PY4 A;  3C49 A;  4L2G A;  4L7U A;  1WOK A;  5AKW A;  4BUX A;  4UI6 A;  2QEW A;  4L7P A;  4KZL A;  4HLM A;  4HKI A;  3MOF A;  3GJW A;  3MOH A;  4IUE A;  4L7L A;  2PAX A;  1YTM A;  4K4F A;  4ZZZ A;  4L7O A;  1EFY A;  3FHB A;  5LYH A;  4R5W A;  4L70 A;  1XKV A;  4J3L A;  4L0V A;  4ZZX A;  1YGG A;  1OEN A;  4GMW A;  5DCZ A;  4F0E A;  4UND A;  4AVW A;  2X5Y A;  1UK0 A;  1OS1 A;  4LI8 A;  4GNP A;  4GNL A;  3SE2 A;  4WL8 A;  3HKV A;  4UVZ A;  1A26 A;  4M7B A;  4WPT A;  5A00 A;  5AEH A;  4BU8 A;  1AYL A;  5FH4 A;  3KCZ A;  4UVX A;  4TKG A;  3GEY A;  4UXB A;  4L7N A;  4BU7 A;  4OQA C;  4GV2 A;  4GNM A;  4PAX A;  4BJC A;  4PNR A;  4BUS A;  4BUY A;  2PXZ X;  3C4H A;  4I9I A;  3UDD A;  4BUW A;  5FH1 A;  2PC9 A;  3DTB A;  4BUD A;  4TVJ A;  2OLQ A;  3DT4 A;  3BLJ A;  5LX6 A;  4MT9 A;  4HLH A;  4HHZ A;  4WIE A;  2RCW A;  2RK8 A;  4HKN A;  4OX2 A;  1KHF A;  4L2K A;  4UI7 A;  4W5S A;  5AL1 A;  4BU9 A;  4BUU A;  4BS4 A;  4UVY A;  4PJV A;  5FH2 A;  3W51 A;  4PNT A;  4HLF A;  5C5R A;  3SMI A;  4UI5 A;  4K4E A;  3P0Q A;  1UK1 A;  4J22 A;  4DQY C;  1KHE A;  4L10 A;  4UI8 A;  2FAH A;  4GNO A;  4UVN A;  2QF1 A;  4YWD A;  1II2 A;  3MHJ A;  4UX4 A;  4TJU A;  3DT7 A;  3P0N A;  4YWB A;  4BJ9 A;  4DVI A;  4OPX C;  5LXP A;  4PNQ A;  2RF5 A;  4L09 A;  4UI4 A;  4WPV A;  3SMJ A;  4HL5 A;  4WPU A;  3U9H A;  3U9Y A;  2QEY A;  3MHK A;  4ZZY A;  4UVP A;  4N3R A;  4TJW A;  1J3B A;  4TK5 A;  4GV7 A;  4L34 A;  4XHU A;  4TKI A;  5ADS A;  2PQF A;  3DT2 A;  4W6E A;  5AL3 A;  3GN7 A;  5ECE A;  4UVO A;  2RKD A;  4L6S A;  4PNL A;  4UW1 A;  5ADR A;  4BUA A;  3UH4 A;  3KR7 A;  4TK0 A;  5C5Q A;  4TJY A;  4TOS A;  2QF2 A;  5ADT A;  1K3C A;  4J3M A;  4GV0 A;  4L0B A;  3P0P A;  4PNS A;  4UVL A;  1NHX A;  4YW8 A;  4J21 A;  4OA7 A;  5AL4 A;  4GMM A;  2ZCI A;  4MSK A;  4LI7 A;  4N4T A;  4GNQ A;  4MSG A;  5C5P A;  4L2F A;  5FH3 A;  1M51 A;  4TOR A;  4UVW A;  1YLH A;  5AL5 A;  4HLG A;  5FH0 A;  1AQ2 A;  5AL2 A;  4WOU A;  4BUE A;  4R43 A;  2RD6 A;  1KHB A;  4BUF A;  4UHG A;  3L3L A;  4KZQ A;  5ETY A;  3L3M A; 
#chains in the Genus database with same CATH homology
 1PAX A;  3GOY A;  2QZY A;  4BFP A;  4OQB C;  2OLR A;  4KZU A;  4J1Z A;  4HLK A;  4UFU A;  4BU3 A;  4BU5 A;  5ADQ A;  5FH5 A;  3CE0 A;  3PAX A;  2RKA A;  4GV4 A;  2GMV A;  4HHY A;  2PY7 X;  3KR8 A;  4HKK A;  4L7R A;  4PNM A;  4UVS A;  4UVT A;  3KJD A;  4UFY A;  4W5I A;  3UH2 A;  4PML A;  4BUV A;  4HMH A;  4UVV A;  1GS0 A;  4RV6 A;  4UI3 A;  4UVU A;  4RCG A;  4L0S A;  4X52 A;  5FPG A;  4L0T A;  4YW9 A;  4GMU A;  4TKF A;  4R6E A;  1YVY A;  4L31 A;  2RKE A;  4PNN A;  4BUT A;  2PAW A;  4N4V A;  5EBT A;  4HYF A;  3UA9 A;  5FPF A;  3MOE A;  4PJT A;  2FAF A;  4KRS A;  4AVU A;  1KHG A;  4UUH A;  4BU6 A;  4L6Z A;  4L32 A;  4L33 A;  4LI6 A;  4L0I A;  4GMZ A;  5AKU A;  2RK7 A;  4BJB A;  4F1L A;  4F1Q A;  4BUI A;  4U6A A;  1K3D A;  5I67 A;  4WIU A;  4PY4 A;  3C49 A;  4L2G A;  4L7U A;  1WOK A;  5AKW A;  4BUX A;  4UI6 A;  2QEW A;  4L7P A;  4KZL A;  4HLM A;  4HKI A;  3MOF A;  3GJW A;  3MOH A;  4IUE A;  4L7L A;  2PAX A;  1YTM A;  4K4F A;  4ZZZ A;  4L7O A;  1EFY A;  3FHB A;  5LYH A;  4R5W A;  4L70 A;  1XKV A;  4J3L A;  4L0V A;  4ZZX A;  1YGG A;  1OEN A;  4GMW A;  5DCZ A;  4F0E A;  4UND A;  4AVW A;  2X5Y A;  1UK0 A;  1OS1 A;  4LI8 A;  4GNP A;  4GNL A;  3SE2 A;  4WL8 A;  3HKV A;  4UVZ A;  1A26 A;  4M7B A;  4WPT A;  5A00 A;  5AEH A;  4BU8 A;  1AYL A;  5FH4 A;  3KCZ A;  4UVX A;  4TKG A;  3GEY A;  4UXB A;  4L7N A;  4BU7 A;  4OQA C;  4GV2 A;  4GNM A;  4PAX A;  4BJC A;  4PNR A;  4BUS A;  4BUY A;  2PXZ X;  3C4H A;  4I9I A;  3UDD A;  4BUW A;  5FH1 A;  2PC9 A;  3DTB A;  4BUD A;  4TVJ A;  2OLQ A;  3DT4 A;  3BLJ A;  5LX6 A;  4MT9 A;  4HLH A;  4HHZ A;  4WIE A;  2RCW A;  2RK8 A;  4HKN A;  4OX2 A;  1KHF A;  4L2K A;  4UI7 A;  4W5S A;  5AL1 A;  4BU9 A;  4BUU A;  4BS4 A;  4UVY A;  4PJV A;  5FH2 A;  3W51 A;  4PNT A;  4HLF A;  5C5R A;  3SMI A;  4UI5 A;  4K4E A;  3P0Q A;  1UK1 A;  4J22 A;  4DQY C;  1KHE A;  4L10 A;  4UI8 A;  2FAH A;  4GNO A;  4UVN A;  2QF1 A;  4YWD A;  1II2 A;  3MHJ A;  4UX4 A;  4TJU A;  3DT7 A;  3P0N A;  4YWB A;  4BJ9 A;  4DVI A;  4OPX C;  5LXP A;  4PNQ A;  2RF5 A;  4L09 A;  4UI4 A;  4WPV A;  3SMJ A;  4HL5 A;  4WPU A;  3U9H A;  3U9Y A;  2QEY A;  3MHK A;  4ZZY A;  4UVP A;  4N3R A;  4TJW A;  1J3B A;  4TK5 A;  4GV7 A;  4L34 A;  4XHU A;  4TKI A;  5ADS A;  2PQF A;  3DT2 A;  4W6E A;  5AL3 A;  3GN7 A;  5ECE A;  4UVO A;  2RKD A;  4L6S A;  4PNL A;  4UW1 A;  5ADR A;  4BUA A;  3UH4 A;  3KR7 A;  4TK0 A;  5C5Q A;  4TJY A;  4TOS A;  2QF2 A;  5ADT A;  1K3C A;  4J3M A;  4GV0 A;  4L0B A;  3P0P A;  4PNS A;  4UVL A;  1NHX A;  4YW8 A;  4J21 A;  4OA7 A;  5AL4 A;  4GMM A;  2ZCI A;  4MSK A;  4LI7 A;  4N4T A;  4GNQ A;  4MSG A;  5C5P A;  4L2F A;  5FH3 A;  1M51 A;  4TOR A;  4UVW A;  1YLH A;  5AL5 A;  4HLG A;  5FH0 A;  1AQ2 A;  5AL2 A;  4WOU A;  4BUE A;  4R43 A;  2RD6 A;  1KHB A;  4BUF A;  4UHG A;  3L3L A;  4KZQ A;  5ETY A;  3L3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...