4TK0A

Crystal structure of human tankyrase 2 in complex with dpq.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
199
structure length
199
Chain Sequence
DKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tankyrase-2
publication title Insights into the binding of PARP inhibitors to the catalytic domain of human tankyrase-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4tk0A00
5LX6A 4UW1A 1EFYA 4TVJA 1UK0A 4BUEA 4UI7A 4BU8A 4PJTA 5LYHA 3KR7A 5AL4A 4HHZA 4L7PA 4HLFA 2RD6A 4TORA 4TJUA 4L7RA 4UVLA 4BJCA 4L0SA 3CE0A 4OQAC 4J21A 4KZQA 3SMJA 4R5WA 4PNNA 4N4VA 4I9IA 4HLKA 4MT9A 4UVNA 3GOYA 3P0QA 4HLHA 3L3MA 4PMLA 4GV0A 5C5QA 4UVWA 4BUFA 3C49A 4BUDA 4L7OA 4L6SA 4W5IA 4PJVA 4BU7A 5AKWA 3MHKA 4UVYA 5A00A 4ZZYA 4BJBA 4PNSA 4UVTA 4HMHA 4J3MA 4UXBA 4L70A 4UVVA 4L34A 4F1LA 4BU9A 4BS4A 4PAXA 4UVXA 5AL1A 4F0EA 3P0NA 5ECEA 4IUEA 4LI7A 5ADQA 4L0TA 4MSKA 4W6EA 5C5RA 4GV7A 4HL5A 4HLGA 1WOKA 4HKIA 5AKUA 3GJWA 1UK1A 4J3LA 4J22A 4L0VA 3GN7A 4GV2A 4L7UA 3FHBA 4UUHA 4PNQA 4PY4A 4UVUA 4AVWA 4BUXA 2RCWA 4UI3A 5AL5A 4W5SA 4UI4A 1GS0A 2PAXA 4PNLA 4ZZXA 5DCZA 4UVSA 3SE2A 4BU3A 4LI6A 4L2GA 4HLMA 4HKNA 4UI5A 4TOSA 5FPGA 4BJ9A 4BU5A 4UI6A 4LI8A 4XHUA 5AL2A 4BUUA 4UFYA 4DVIA 4KRSA 4RV6A 4TKIA 4L31A 3MHJA 4L2KA 4BUIA 5ADSA 4BUAA 5LXPA 4TJYA 4PNMA 4L7LA 4TKFA 2PQFA 3KJDA 4L6ZA 5AL3A 4BUWA 4UVOA 4L0BA 3UH2A 4L33A 5C5PA 4OQBC 4F1QA 3UA9A 4BUVA 3GEYA 3SMIA 4L7NA 3U9HA 4TKGA 5ETYA 3UDDA 4TK5A 4TK0A 4PNRA 2PAWA 4L32A 4K4FA 4N3RA 4J1ZA 4UFUA 4BUYA 3KCZA 4DQYC 4L10A 1A26A 3U9YA 4BU6A 5FPFA 1PAXA 3W51A 4N4TA 4X52A 4ZZZA 5ADTA 4HKKA 4UI8A 4UNDA 3L3LA 4KZUA 4KZLA 4BUSA 3HKVA 4BFPA 4HHYA 3C4HA 4L2FA 5EBTA 4BUTA 4UVPA 3PAXA 4TJWA 4AVUA 5ADRA 4L0IA 4OA7A 4R6EA 4MSGA 3BLJA 3P0PA 4PNTA 4U6AA 4UHGA 5AEHA 3KR8A 4UVZA 2X5YA 3UH4A 2RF5A 4L09A 4GV4A 4UX4A 4HYFA 4M7BA 4K4EA 4OPXC
chains in the Genus database with same CATH superfamily
5LX6A 4AVWA 4UW1A 1EFYA 4TVJA 1UK0A 4UUHA 4UI7A 4BUEA 4PJTA 4BU8A 5LYHA 3KR7A 5AL4A 4WIEA 4WOUA 4WPVA 4HHZA 4L7PA 2QZYA 4HLFA 2RD6A 4TORA 4TJUA 1M51A 4L7RA 2FAHA 2QF1A 4UVLA 4BJCA 4L0SA 3CE0A 4OQAC 4GNMA 4J21A 4KZQA 4WL8A 2GMVA 2RK7A 3SMJA 4R5WA 4PNNA 4N4VA 1K3DA 5I67A 4I9IA 4HLKA 4MT9A 4UVNA 3GOYA 3P0QA 4HLHA 3L3MA 4PMLA 1YLHA 4GV0A 5C5QA 4UVWA 4BUFA 3C49A 4BUDA 4L7OA 4L6SA 4W5IA 2QF2A 4PJVA 4BU7A 5AKWA 3MHKA 4UVYA 5A00A 4ZZYA 5FH1A 4BJBA 4PNSA 4M7BA 4UVTA 2RKDA 4HMHA 4J3MA 4UXBA 4L70A 4UVVA 4L34A 4RCGA 4F1LA 4BU9A 2FAFA 4BS4A 4PAXA 4UVXA 5AL1A 4F0EA 3P0NA 5ECEA 4IUEA 4LI7A 3MOHA 1AYLA 5ADQA 4L0TA 4MSKA 4W6EA 5C5RA 2PXZX 4GV7A 1J3BA 4HL5A 4HLGA 4WIUA 1WOKA 2RKEA 4HKIA 5AKUA 3GJWA 1UK1A 4J3LA 4J22A 4L0VA 3GN7A 3DT2A 2QEYA 3FHBA 1K3CA 4GV2A 4L7UA 1KHEA 4PNQA 4PY4A 3DT4A 4UVUA 2RCWA 4YW8A 1II2A 4UI3A 5AL5A 4W5SA 4UI4A 4YWDA 1GS0A 2PAXA 4GMWA 4GNOA 4PNLA 1YVYA 5DCZA 4UVSA 4ZZXA 3SE2A 4BU3A 4LI6A 4L2GA 4GNLA 4HKNA 4HLMA 4UI5A 4TOSA 5FPGA 1OS1A 4BJ9A 4BU5A 4UI6A 4LI8A 4XHUA 5AL2A 4BUUA 4UFYA 4DVIA 4KRSA 4RV6A 1NHXA 4TKIA 4L31A 3MHJA 4L2KA 4YW9A 5FH0A 4BUIA 5ADSA 1KHGA 4BUAA 5LXPA 4TJYA 4PNMA 5FH2A 4L7LA 4TKFA 2PQFA 2OLRA 3KJDA 4L6ZA 5AL3A 4BUWA 1OENA 3MOEA 3MOFA 4L0BA 4UVOA 3UH2A 2QEWA 5FH5A 4L33A 4WPUA 5C5PA 4OQBC 2OLQA 4GNQA 3UA9A 4F1QA 4BUVA 3GEYA 1KHFA 3SMIA 4GNPA 3DTBA 1YTMA 4L7NA 3U9HA 4TKGA 5ETYA 3UDDA 4TK5A 2ZCIA 4PNRA 5FH4A 4TK0A 4K4EA 2PAWA 4L32A 4K4FA 4N3RA 4J1ZA 4UFUA 4WPTA 3KCZA 4BUYA 1A26A 4L10A 3U9YA 4R43A 4BU6A 5FPFA 1PAXA 3W51A 4N4TA 2RK8A 4GMUA 4X52A 4ZZZA 5ADTA 4HKKA 4UI8A 1XKVA 4UNDA 3L3LA 5FH3A 4KZUA 3DT7A 4KZLA 4BUSA 3HKVA 2RKAA 4BFPA 4HHYA 3C4HA 4L2FA 5EBTA 4BUTA 4UVPA 3PAXA 4TJWA 4AVUA 4BUXA 1YGGA 4DQYC 4GMZA 5ADRA 4L0IA 4OA7A 2PY7X 4OX2A 4YWBA 1AQ2A 4R6EA 4MSGA 3BLJA 4U6AA 4PNTA 4UHGA 5AEHA 3KR8A 4UVZA 2X5YA 4GMMA 2RF5A 3UH4A 4L09A 4GV4A 4UX4A 4HYFA 1KHBA 3P0PA 4OPXC 2PC9A
chains in the Genus database with same CATH topology
5LX6A 4AVWA 4UW1A 1EFYA 4TVJA 1UK0A 4UUHA 4UI7A 4BUEA 4PJTA 4BU8A 5LYHA 3KR7A 5AL4A 4WIEA 4WOUA 4WPVA 4HHZA 4L7PA 2QZYA 4HLFA 2RD6A 4TORA 4TJUA 1M51A 4L7RA 2FAHA 2QF1A 4UVLA 4BJCA 4L0SA 3CE0A 4OQAC 4GNMA 4J21A 4KZQA 4WL8A 2GMVA 2RK7A 3SMJA 4R5WA 4PNNA 4N4VA 1K3DA 5I67A 4I9IA 4HLKA 4MT9A 4UVNA 3GOYA 3P0QA 4HLHA 3L3MA 4PMLA 1YLHA 4GV0A 5C5QA 4UVWA 4BUFA 3C49A 4BUDA 4L7OA 4L6SA 4W5IA 2QF2A 4PJVA 4BU7A 5AKWA 3MHKA 4UVYA 5A00A 4ZZYA 5FH1A 4BJBA 4PNSA 4M7BA 4UVTA 2RKDA 4HMHA 4J3MA 4UXBA 4L70A 4UVVA 4L34A 4RCGA 4F1LA 4BU9A 2FAFA 4BS4A 4PAXA 4UVXA 5AL1A 4F0EA 3P0NA 5ECEA 4IUEA 4LI7A 3MOHA 1AYLA 5ADQA 4L0TA 4MSKA 4W6EA 5C5RA 2PXZX 4GV7A 1J3BA 4HL5A 4HLGA 4WIUA 1WOKA 2RKEA 4HKIA 5AKUA 3GJWA 1UK1A 4J3LA 4J22A 4L0VA 3GN7A 3DT2A 2QEYA 3FHBA 1K3CA 4GV2A 4L7UA 1KHEA 4PNQA 4PY4A 3DT4A 4UVUA 2RCWA 4YW8A 1II2A 4UI3A 5AL5A 4W5SA 4UI4A 4YWDA 1GS0A 2PAXA 4GMWA 4GNOA 4PNLA 1YVYA 5DCZA 4UVSA 4ZZXA 3SE2A 4BU3A 4LI6A 4L2GA 4GNLA 4HKNA 4HLMA 4UI5A 4TOSA 5FPGA 1OS1A 4BJ9A 4BU5A 4UI6A 4LI8A 4XHUA 5AL2A 4BUUA 4UFYA 4DVIA 4KRSA 4RV6A 1NHXA 4TKIA 4L31A 3MHJA 4L2KA 4YW9A 5FH0A 4BUIA 5ADSA 1KHGA 4BUAA 5LXPA 4TJYA 4PNMA 5FH2A 4L7LA 4TKFA 2PQFA 2OLRA 3KJDA 4L6ZA 5AL3A 4BUWA 1OENA 3MOEA 3MOFA 4L0BA 4UVOA 3UH2A 2QEWA 5FH5A 4L33A 4WPUA 5C5PA 4OQBC 2OLQA 4GNQA 3UA9A 4F1QA 4BUVA 3GEYA 1KHFA 3SMIA 4GNPA 3DTBA 1YTMA 4L7NA 3U9HA 4TKGA 5ETYA 3UDDA 4TK5A 2ZCIA 4PNRA 5FH4A 4TK0A 4K4EA 2PAWA 4L32A 4K4FA 4N3RA 4J1ZA 4UFUA 4WPTA 3KCZA 4BUYA 1A26A 4L10A 3U9YA 4R43A 4BU6A 5FPFA 1PAXA 3W51A 4N4TA 2RK8A 4GMUA 4X52A 4ZZZA 5ADTA 4HKKA 4UI8A 1XKVA 4UNDA 3L3LA 5FH3A 4KZUA 3DT7A 4KZLA 4BUSA 3HKVA 2RKAA 4BFPA 4HHYA 3C4HA 4L2FA 5EBTA 4BUTA 4UVPA 3PAXA 4TJWA 4AVUA 4BUXA 1YGGA 4DQYC 4GMZA 5ADRA 4L0IA 4OA7A 2PY7X 4OX2A 4YWBA 1AQ2A 4R6EA 4MSGA 3BLJA 4U6AA 4PNTA 4UHGA 5AEHA 3KR8A 4UVZA 2X5YA 4GMMA 2RF5A 3UH4A 4L09A 4GV4A 4UX4A 4HYFA 1KHBA 3P0PA 4OPXC 2PC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LX6 A;  4UW1 A;  1EFY A;  4TVJ A;  1UK0 A;  4BUE A;  4UI7 A;  4BU8 A;  4PJT A;  5LYH A;  3KR7 A;  5AL4 A;  4HHZ A;  4L7P A;  4HLF A;  2RD6 A;  4TOR A;  4TJU A;  4L7R A;  4UVL A;  4BJC A;  4L0S A;  3CE0 A;  4OQA C;  4J21 A;  4KZQ A;  3SMJ A;  4R5W A;  4PNN A;  4N4V A;  4I9I A;  4HLK A;  4MT9 A;  4UVN A;  3GOY A;  3P0Q A;  4HLH A;  3L3M A;  4PML A;  4GV0 A;  5C5Q A;  4UVW A;  4BUF A;  3C49 A;  4BUD A;  4L7O A;  4L6S A;  4W5I A;  4PJV A;  4BU7 A;  5AKW A;  3MHK A;  4UVY A;  5A00 A;  4ZZY A;  4BJB A;  4PNS A;  4UVT A;  4HMH A;  4J3M A;  4UXB A;  4L70 A;  4UVV A;  4L34 A;  4F1L A;  4BU9 A;  4BS4 A;  4PAX A;  4UVX A;  5AL1 A;  4F0E A;  3P0N A;  5ECE A;  4IUE A;  4LI7 A;  5ADQ A;  4L0T A;  4MSK A;  4W6E A;  5C5R A;  4GV7 A;  4HL5 A;  4HLG A;  1WOK A;  4HKI A;  5AKU A;  3GJW A;  1UK1 A;  4J3L A;  4J22 A;  4L0V A;  3GN7 A;  4GV2 A;  4L7U A;  3FHB A;  4UUH A;  4PNQ A;  4PY4 A;  4UVU A;  4AVW A;  4BUX A;  2RCW A;  4UI3 A;  5AL5 A;  4W5S A;  4UI4 A;  1GS0 A;  2PAX A;  4PNL A;  4ZZX A;  5DCZ A;  4UVS A;  3SE2 A;  4BU3 A;  4LI6 A;  4L2G A;  4HLM A;  4HKN A;  4UI5 A;  4TOS A;  5FPG A;  4BJ9 A;  4BU5 A;  4UI6 A;  4LI8 A;  4XHU A;  5AL2 A;  4BUU A;  4UFY A;  4DVI A;  4KRS A;  4RV6 A;  4TKI A;  4L31 A;  3MHJ A;  4L2K A;  4BUI A;  5ADS A;  4BUA A;  5LXP A;  4TJY A;  4PNM A;  4L7L A;  4TKF A;  2PQF A;  3KJD A;  4L6Z A;  5AL3 A;  4BUW A;  4UVO A;  4L0B A;  3UH2 A;  4L33 A;  5C5P A;  4OQB C;  4F1Q A;  3UA9 A;  4BUV A;  3GEY A;  3SMI A;  4L7N A;  3U9H A;  4TKG A;  5ETY A;  3UDD A;  4TK5 A;  4TK0 A;  4PNR A;  2PAW A;  4L32 A;  4K4F A;  4N3R A;  4J1Z A;  4UFU A;  4BUY A;  3KCZ A;  4DQY C;  4L10 A;  1A26 A;  3U9Y A;  4BU6 A;  5FPF A;  1PAX A;  3W51 A;  4N4T A;  4X52 A;  4ZZZ A;  5ADT A;  4HKK A;  4UI8 A;  4UND A;  3L3L A;  4KZU A;  4KZL A;  4BUS A;  3HKV A;  4BFP A;  4HHY A;  3C4H A;  4L2F A;  5EBT A;  4BUT A;  4UVP A;  3PAX A;  4TJW A;  4AVU A;  5ADR A;  4L0I A;  4OA7 A;  4R6E A;  4MSG A;  3BLJ A;  3P0P A;  4PNT A;  4U6A A;  4UHG A;  5AEH A;  3KR8 A;  4UVZ A;  2X5Y A;  3UH4 A;  2RF5 A;  4L09 A;  4GV4 A;  4UX4 A;  4HYF A;  4M7B A;  4K4E A;  4OPX C; 
#chains in the Genus database with same CATH topology
 5LX6 A;  4AVW A;  4UW1 A;  1EFY A;  4TVJ A;  1UK0 A;  4UUH A;  4UI7 A;  4BUE A;  4PJT A;  4BU8 A;  5LYH A;  3KR7 A;  5AL4 A;  4WIE A;  4WOU A;  4WPV A;  4HHZ A;  4L7P A;  2QZY A;  4HLF A;  2RD6 A;  4TOR A;  4TJU A;  1M51 A;  4L7R A;  2FAH A;  2QF1 A;  4UVL A;  4BJC A;  4L0S A;  3CE0 A;  4OQA C;  4GNM A;  4J21 A;  4KZQ A;  4WL8 A;  2GMV A;  2RK7 A;  3SMJ A;  4R5W A;  4PNN A;  4N4V A;  1K3D A;  5I67 A;  4I9I A;  4HLK A;  4MT9 A;  4UVN A;  3GOY A;  3P0Q A;  4HLH A;  3L3M A;  4PML A;  1YLH A;  4GV0 A;  5C5Q A;  4UVW A;  4BUF A;  3C49 A;  4BUD A;  4L7O A;  4L6S A;  4W5I A;  2QF2 A;  4PJV A;  4BU7 A;  5AKW A;  3MHK A;  4UVY A;  5A00 A;  4ZZY A;  5FH1 A;  4BJB A;  4PNS A;  4M7B A;  4UVT A;  2RKD A;  4HMH A;  4J3M A;  4UXB A;  4L70 A;  4UVV A;  4L34 A;  4RCG A;  4F1L A;  4BU9 A;  2FAF A;  4BS4 A;  4PAX A;  4UVX A;  5AL1 A;  4F0E A;  3P0N A;  5ECE A;  4IUE A;  4LI7 A;  3MOH A;  1AYL A;  5ADQ A;  4L0T A;  4MSK A;  4W6E A;  5C5R A;  2PXZ X;  4GV7 A;  1J3B A;  4HL5 A;  4HLG A;  4WIU A;  1WOK A;  2RKE A;  4HKI A;  5AKU A;  3GJW A;  1UK1 A;  4J3L A;  4J22 A;  4L0V A;  3GN7 A;  3DT2 A;  2QEY A;  3FHB A;  1K3C A;  4GV2 A;  4L7U A;  1KHE A;  4PNQ A;  4PY4 A;  3DT4 A;  4UVU A;  2RCW A;  4YW8 A;  1II2 A;  4UI3 A;  5AL5 A;  4W5S A;  4UI4 A;  4YWD A;  1GS0 A;  2PAX A;  4GMW A;  4GNO A;  4PNL A;  1YVY A;  5DCZ A;  4UVS A;  4ZZX A;  3SE2 A;  4BU3 A;  4LI6 A;  4L2G A;  4GNL A;  4HKN A;  4HLM A;  4UI5 A;  4TOS A;  5FPG A;  1OS1 A;  4BJ9 A;  4BU5 A;  4UI6 A;  4LI8 A;  4XHU A;  5AL2 A;  4BUU A;  4UFY A;  4DVI A;  4KRS A;  4RV6 A;  1NHX A;  4TKI A;  4L31 A;  3MHJ A;  4L2K A;  4YW9 A;  5FH0 A;  4BUI A;  5ADS A;  1KHG A;  4BUA A;  5LXP A;  4TJY A;  4PNM A;  5FH2 A;  4L7L A;  4TKF A;  2PQF A;  2OLR A;  3KJD A;  4L6Z A;  5AL3 A;  4BUW A;  1OEN A;  3MOE A;  3MOF A;  4L0B A;  4UVO A;  3UH2 A;  2QEW A;  5FH5 A;  4L33 A;  4WPU A;  5C5P A;  4OQB C;  2OLQ A;  4GNQ A;  3UA9 A;  4F1Q A;  4BUV A;  3GEY A;  1KHF A;  3SMI A;  4GNP A;  3DTB A;  1YTM A;  4L7N A;  3U9H A;  4TKG A;  5ETY A;  3UDD A;  4TK5 A;  2ZCI A;  4PNR A;  5FH4 A;  4TK0 A;  4K4E A;  2PAW A;  4L32 A;  4K4F A;  4N3R A;  4J1Z A;  4UFU A;  4WPT A;  3KCZ A;  4BUY A;  1A26 A;  4L10 A;  3U9Y A;  4R43 A;  4BU6 A;  5FPF A;  1PAX A;  3W51 A;  4N4T A;  2RK8 A;  4GMU A;  4X52 A;  4ZZZ A;  5ADT A;  4HKK A;  4UI8 A;  1XKV A;  4UND A;  3L3L A;  5FH3 A;  4KZU A;  3DT7 A;  4KZL A;  4BUS A;  3HKV A;  2RKA A;  4BFP A;  4HHY A;  3C4H A;  4L2F A;  5EBT A;  4BUT A;  4UVP A;  3PAX A;  4TJW A;  4AVU A;  4BUX A;  1YGG A;  4DQY C;  4GMZ A;  5ADR A;  4L0I A;  4OA7 A;  2PY7 X;  4OX2 A;  4YWB A;  1AQ2 A;  4R6E A;  4MSG A;  3BLJ A;  4U6A A;  4PNT A;  4UHG A;  5AEH A;  3KR8 A;  4UVZ A;  2X5Y A;  4GMM A;  2RF5 A;  3UH4 A;  4L09 A;  4GV4 A;  4UX4 A;  4HYF A;  1KHB A;  3P0P A;  4OPX C;  2PC9 A; 
#chains in the Genus database with same CATH homology
 5LX6 A;  4AVW A;  4UW1 A;  1EFY A;  4TVJ A;  1UK0 A;  4UUH A;  4UI7 A;  4BUE A;  4PJT A;  4BU8 A;  5LYH A;  3KR7 A;  5AL4 A;  4WIE A;  4WOU A;  4WPV A;  4HHZ A;  4L7P A;  2QZY A;  4HLF A;  2RD6 A;  4TOR A;  4TJU A;  1M51 A;  4L7R A;  2FAH A;  2QF1 A;  4UVL A;  4BJC A;  4L0S A;  3CE0 A;  4OQA C;  4GNM A;  4J21 A;  4KZQ A;  4WL8 A;  2GMV A;  2RK7 A;  3SMJ A;  4R5W A;  4PNN A;  4N4V A;  1K3D A;  5I67 A;  4I9I A;  4HLK A;  4MT9 A;  4UVN A;  3GOY A;  3P0Q A;  4HLH A;  3L3M A;  4PML A;  1YLH A;  4GV0 A;  5C5Q A;  4UVW A;  4BUF A;  3C49 A;  4BUD A;  4L7O A;  4L6S A;  4W5I A;  2QF2 A;  4PJV A;  4BU7 A;  5AKW A;  3MHK A;  4UVY A;  5A00 A;  4ZZY A;  5FH1 A;  4BJB A;  4PNS A;  4M7B A;  4UVT A;  2RKD A;  4HMH A;  4J3M A;  4UXB A;  4L70 A;  4UVV A;  4L34 A;  4RCG A;  4F1L A;  4BU9 A;  2FAF A;  4BS4 A;  4PAX A;  4UVX A;  5AL1 A;  4F0E A;  3P0N A;  5ECE A;  4IUE A;  4LI7 A;  3MOH A;  1AYL A;  5ADQ A;  4L0T A;  4MSK A;  4W6E A;  5C5R A;  2PXZ X;  4GV7 A;  1J3B A;  4HL5 A;  4HLG A;  4WIU A;  1WOK A;  2RKE A;  4HKI A;  5AKU A;  3GJW A;  1UK1 A;  4J3L A;  4J22 A;  4L0V A;  3GN7 A;  3DT2 A;  2QEY A;  3FHB A;  1K3C A;  4GV2 A;  4L7U A;  1KHE A;  4PNQ A;  4PY4 A;  3DT4 A;  4UVU A;  2RCW A;  4YW8 A;  1II2 A;  4UI3 A;  5AL5 A;  4W5S A;  4UI4 A;  4YWD A;  1GS0 A;  2PAX A;  4GMW A;  4GNO A;  4PNL A;  1YVY A;  5DCZ A;  4UVS A;  4ZZX A;  3SE2 A;  4BU3 A;  4LI6 A;  4L2G A;  4GNL A;  4HKN A;  4HLM A;  4UI5 A;  4TOS A;  5FPG A;  1OS1 A;  4BJ9 A;  4BU5 A;  4UI6 A;  4LI8 A;  4XHU A;  5AL2 A;  4BUU A;  4UFY A;  4DVI A;  4KRS A;  4RV6 A;  1NHX A;  4TKI A;  4L31 A;  3MHJ A;  4L2K A;  4YW9 A;  5FH0 A;  4BUI A;  5ADS A;  1KHG A;  4BUA A;  5LXP A;  4TJY A;  4PNM A;  5FH2 A;  4L7L A;  4TKF A;  2PQF A;  2OLR A;  3KJD A;  4L6Z A;  5AL3 A;  4BUW A;  1OEN A;  3MOE A;  3MOF A;  4L0B A;  4UVO A;  3UH2 A;  2QEW A;  5FH5 A;  4L33 A;  4WPU A;  5C5P A;  4OQB C;  2OLQ A;  4GNQ A;  3UA9 A;  4F1Q A;  4BUV A;  3GEY A;  1KHF A;  3SMI A;  4GNP A;  3DTB A;  1YTM A;  4L7N A;  3U9H A;  4TKG A;  5ETY A;  3UDD A;  4TK5 A;  2ZCI A;  4PNR A;  5FH4 A;  4TK0 A;  4K4E A;  2PAW A;  4L32 A;  4K4F A;  4N3R A;  4J1Z A;  4UFU A;  4WPT A;  3KCZ A;  4BUY A;  1A26 A;  4L10 A;  3U9Y A;  4R43 A;  4BU6 A;  5FPF A;  1PAX A;  3W51 A;  4N4T A;  2RK8 A;  4GMU A;  4X52 A;  4ZZZ A;  5ADT A;  4HKK A;  4UI8 A;  1XKV A;  4UND A;  3L3L A;  5FH3 A;  4KZU A;  3DT7 A;  4KZL A;  4BUS A;  3HKV A;  2RKA A;  4BFP A;  4HHY A;  3C4H A;  4L2F A;  5EBT A;  4BUT A;  4UVP A;  3PAX A;  4TJW A;  4AVU A;  4BUX A;  1YGG A;  4DQY C;  4GMZ A;  5ADR A;  4L0I A;  4OA7 A;  2PY7 X;  4OX2 A;  4YWB A;  1AQ2 A;  4R6E A;  4MSG A;  3BLJ A;  4U6A A;  4PNT A;  4UHG A;  5AEH A;  3KR8 A;  4UVZ A;  2X5Y A;  4GMM A;  2RF5 A;  3UH4 A;  4L09 A;  4GV4 A;  4UX4 A;  4HYF A;  1KHB A;  3P0P A;  4OPX C;  2PC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...