4TK0A

Crystal structure of human tankyrase 2 in complex with dpq.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
199
structure length
199
Chain Sequence
b'DKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Insights into the binding of PARP inhibitors to the catalytic domain of human tankyrase-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 64
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4tk0A00
5AKWA 4F1QA 4UVPA 4PNMA 4TKFA 4UX4A 2RD6A 3CE0A 3KCZA 4UFUA 4L0IA 4L0BA 4UI6A 4OQAC 4UVTA 4W6EA 3UDDA 4L0TA 4BUFA 3KR7A 4IUEA 3SE2A 3U9YA 4J3MA 4X52A 4UVXA 1EFYA 5AL4A 4J3LA 4BUTA 4UVNA 4L70A 4L7OA 3GEYA 4TJWA 4OPXC 3P0NA 4J21A 4PNQA 4HHZA 4UNDA 4L6ZA 4TK5A 3SMJA 3UH4A 4HL5A 5AKUA 4UHGA 5LX6A 4PNTA 5C5PA 4L7RA 4AVUA 1UK0A 4N4TA 4R5WA 4MT9A 5C5RA 3MHKA 1WOKA 4KRSA 4UI7A 5FPFA 4BFPA 5LYHA 4UVYA 4TJYA 2PQFA 4DVIA 4GV7A 4TKGA 5LXPA 4L33A 4L2GA 4N4VA 4R6EA 4ZZXA 4BUDA 5ADTA 4L2FA 4N3RA 4KZUA 3UH2A 3KR8A 4BU5A 4XHUA 3L3LA 4MSGA 4L7UA 4K4FA 4F0EA 4HLMA 3KJDA 3GN7A 4W5IA 4HLGA 4PNSA 4I9IA 4PJTA 4UVVA 1PAXA 4UFYA 3P0PA 2RF5A 4PMLA 5AL1A 4L7LA 4HHYA 4L09A 4BU8A 4J1ZA 3C4HA 4TK0A 4GV0A 5ADRA 4PY4A 4PAXA 4UVZA 4UVWA 4BUEA 4LI7A 4BJ9A 4BJBA 4UVSA 4L2KA 4J22A 4RV6A 4L0VA 4BUYA 4HLKA 5EBTA 4PNRA 4L31A 4BUXA 3MHJA 4OA7A 5ADSA 4M7BA 4HKKA 3FHBA 4TKIA 5AL5A 1UK1A 5AL3A 4L7NA 4UI5A 4HKIA 4LI8A 4BUUA 4BUSA 4ZZZA 4BUAA 4GV4A 4MSKA 4BU3A 4HKNA 4ZZYA 4L6SA 1A26A 4KZQA 4BU6A 4TJUA 4HMHA 5DCZA 4HLHA 5C5QA 4UVOA 4UI8A 4UW1A 2X5YA 5AEHA 4GV2A 4BUIA 3W51A 4L32A 4F1LA 4BS4A 4W5SA 5ETYA 4UXBA 4HLFA 4UI4A 4UVUA 3U9HA 4L34A 3HKVA 4BU7A 5AL2A 3L3MA 4TORA 4AVWA 4OQBC 2RCWA 4PJVA 3BLJA 4LI6A 4DQYC 4UI3A 4U6AA 4UVLA 4TVJA 4BJCA 5A00A 2PAWA 5ADQA 3GOYA 4HYFA 3C49A 5FPGA 3GJWA 4TOSA 4BU9A 3UA9A 4PNLA 4K4EA 4PNNA 1GS0A 3PAXA 4BUWA 3P0QA 4L0SA 4BUVA 4UUHA 3SMIA 2PAXA 4L10A 5ECEA 4KZLA 4L7PA
chains in the Genus database with same CATH superfamily
5AKWA 4F1QA 4UVPA 1OS1A 4PNMA 1M51A 4TKFA 4UX4A 1YVYA 1NHXA 2RD6A 2QEYA 3CE0A 3KCZA 4UFUA 1AYLA 4L0IA 4L0BA 4UI6A 4OQAC 4UVTA 4W6EA 3UDDA 4L0TA 4BUFA 3KR7A 4IUEA 2RKEA 3SE2A 4GMZA 3U9YA 4J3MA 4X52A 3DT4A 4UVXA 1EFYA 5AL4A 5FH2A 5FH3A 4J3LA 4BUTA 4UVNA 4YW8A 4F0EA 4L70A 4L7OA 3GEYA 4TJWA 4OPXC 3P0NA 4J21A 4PNQA 2QEWA 4HHZA 4L6ZA 4TK5A 4UNDA 3SMJA 4HL5A 5AKUA 3UH4A 4BUEA 4UHGA 5LX6A 4PNTA 5C5PA 2RKAA 4L7RA 4AVUA 1UK0A 1YLHA 4N4TA 4R5WA 4MT9A 5C5RA 3MHKA 5FH5A 1WOKA 1XKVA 4KRSA 4UI7A 2PY7X 2OLRA 4BFPA 5FPFA 5LYHA 4UVYA 4TJYA 2PQFA 4GMMA 4DVIA 4GV7A 4TKGA 4GNQA 5LXPA 4OX2A 4L33A 4L2GA 4N4VA 4R6EA 2PC9A 1KHFA 4ZZXA 4BUDA 5ADTA 4L2FA 4N3RA 4KZUA 3UH2A 2FAHA 3KR8A 4BU5A 4XHUA 4GNPA 1KHEA 3L3LA 4L7UA 4K4FA 2RK8A 4MSGA 1KHBA 3MOEA 4GMUA 4HLMA 3KJDA 5FH1A 4YWDA 3GN7A 4W5IA 4HLGA 4PNSA 3DT7A 5FH4A 4I9IA 1II2A 4PJTA 1PAXA 4UFYA 3P0PA 4UVVA 2RF5A 4PMLA 5AL1A 1YTMA 4HHYA 4L09A 4L7LA 4BU8A 2QF2A 4J1ZA 3C4HA 4TK0A 4GV0A 5ADRA 4PY4A 4YW9A 4PAXA 4GNMA 4UVZA 3DTBA 4UVWA 4LI7A 1J3BA 3MOHA 4UVSA 1K3DA 4L2KA 4J22A 4RV6A 4L0VA 4BJ9A 4BJBA 4BUYA 4HLKA 5EBTA 4PNRA 4L31A 4BUXA 4RCGA 3MHJA 4OA7A 5ADSA 4M7BA 4HKKA 2RKDA 3FHBA 4TKIA 1UK1A 5AL5A 5AL3A 4L7NA 5I67A 4WIEA 4UI5A 4HKIA 4LI8A 4BUUA 4BUSA 4ZZZA 4BUAA 4GV4A 4MSKA 2RK7A 4BU3A 4GNOA 4HKNA 4ZZYA 4L6SA 1A26A 4KZQA 4BU6A 4WPTA 2PXZX 4HMHA 4TJUA 2OLQA 4HLHA 2FAFA 4UVOA 5DCZA 1KHGA 4UI8A 4UW1A 5C5QA 2X5YA 5AEHA 4GV2A 4BUIA 3W51A 4L32A 4F1LA 4BS4A 4W5SA 5ETYA 3DT2A 3MOFA 4UXBA 4HLFA 4UI4A 4UVUA 4WL8A 3U9HA 4L34A 1K3CA 3HKVA 4WOUA 4BU7A 5AL2A 4GNLA 3L3MA 4TORA 4AVWA 4OQBC 2RCWA 4PJVA 4WPUA 2QZYA 3BLJA 4LI6A 5FH0A 4DQYC 4UI3A 4U6AA 4UVLA 1YGGA 2QF1A 4TVJA 4BJCA 5A00A 2PAWA 5ADQA 3GOYA 4HYFA 3C49A 5FPGA 3GJWA 4R43A 4TOSA 4BU9A 3UA9A 4PNLA 1AQ2A 4K4EA 4PNNA 1GS0A 3PAXA 4WIUA 4BUWA 2ZCIA 3P0QA 4L0SA 4WPVA 4BUVA 4GMWA 4UUHA 3SMIA 2PAXA 2GMVA 4L10A 4YWBA 5ECEA 1OENA 4KZLA 4L7PA
chains in the Genus database with same CATH topology
5AKWA 4F1QA 4UVPA 1OS1A 4PNMA 1M51A 4TKFA 4UX4A 1YVYA 1NHXA 2RD6A 2QEYA 3CE0A 3KCZA 4UFUA 1AYLA 4L0IA 4L0BA 4UI6A 4OQAC 4UVTA 4W6EA 3UDDA 4L0TA 4BUFA 3KR7A 4IUEA 2RKEA 3SE2A 4GMZA 3U9YA 4J3MA 4X52A 3DT4A 4UVXA 1EFYA 5AL4A 5FH2A 5FH3A 4J3LA 4BUTA 4UVNA 4YW8A 4F0EA 4L70A 4L7OA 3GEYA 4TJWA 4OPXC 3P0NA 4J21A 4PNQA 2QEWA 4HHZA 4L6ZA 4TK5A 4UNDA 3SMJA 4HL5A 5AKUA 3UH4A 4BUEA 4UHGA 5LX6A 4PNTA 5C5PA 2RKAA 4L7RA 4AVUA 1UK0A 1YLHA 4N4TA 4R5WA 4MT9A 5C5RA 3MHKA 5FH5A 1WOKA 1XKVA 4KRSA 4UI7A 2PY7X 2OLRA 4BFPA 5FPFA 5LYHA 4UVYA 4TJYA 2PQFA 4GMMA 4DVIA 4GV7A 4TKGA 4GNQA 5LXPA 4OX2A 4L33A 4L2GA 4N4VA 4R6EA 2PC9A 1KHFA 4ZZXA 4BUDA 5ADTA 4L2FA 4N3RA 4KZUA 3UH2A 2FAHA 3KR8A 4BU5A 4XHUA 4GNPA 1KHEA 3L3LA 4L7UA 4K4FA 2RK8A 4MSGA 1KHBA 3MOEA 4GMUA 4HLMA 3KJDA 5FH1A 4YWDA 3GN7A 4W5IA 4HLGA 4PNSA 3DT7A 5FH4A 4I9IA 1II2A 4PJTA 1PAXA 4UFYA 3P0PA 4UVVA 2RF5A 4PMLA 5AL1A 1YTMA 4HHYA 4L09A 4L7LA 4BU8A 2QF2A 4J1ZA 3C4HA 4TK0A 4GV0A 5ADRA 4PY4A 4YW9A 4PAXA 4GNMA 4UVZA 3DTBA 4UVWA 4LI7A 1J3BA 3MOHA 4UVSA 1K3DA 4L2KA 4J22A 4RV6A 4L0VA 4BJ9A 4BJBA 4BUYA 4HLKA 5EBTA 4PNRA 4L31A 4BUXA 4RCGA 3MHJA 4OA7A 5ADSA 4M7BA 4HKKA 2RKDA 3FHBA 4TKIA 1UK1A 5AL5A 5AL3A 4L7NA 5I67A 4WIEA 4UI5A 4HKIA 4LI8A 4BUUA 4BUSA 4ZZZA 4BUAA 4GV4A 4MSKA 2RK7A 4BU3A 4GNOA 4HKNA 4ZZYA 4L6SA 1A26A 4KZQA 4BU6A 4WPTA 2PXZX 4HMHA 4TJUA 2OLQA 4HLHA 2FAFA 4UVOA 5DCZA 1KHGA 4UI8A 4UW1A 5C5QA 2X5YA 5AEHA 4GV2A 4BUIA 3W51A 4L32A 4F1LA 4BS4A 4W5SA 5ETYA 3DT2A 3MOFA 4UXBA 4HLFA 4UI4A 4UVUA 4WL8A 3U9HA 4L34A 1K3CA 3HKVA 4WOUA 4BU7A 5AL2A 4GNLA 3L3MA 4TORA 4AVWA 4OQBC 2RCWA 4PJVA 4WPUA 2QZYA 3BLJA 4LI6A 5FH0A 4DQYC 4UI3A 4U6AA 4UVLA 1YGGA 2QF1A 4TVJA 4BJCA 5A00A 2PAWA 5ADQA 3GOYA 4HYFA 3C49A 5FPGA 3GJWA 4R43A 4TOSA 4BU9A 3UA9A 4PNLA 1AQ2A 4K4EA 4PNNA 1GS0A 3PAXA 4WIUA 4BUWA 2ZCIA 3P0QA 4L0SA 4WPVA 4BUVA 4GMWA 4UUHA 3SMIA 2PAXA 2GMVA 4L10A 4YWBA 5ECEA 1OENA 4KZLA 4L7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AKW A;  4F1Q A;  4UVP A;  4PNM A;  4TKF A;  4UX4 A;  2RD6 A;  3CE0 A;  3KCZ A;  4UFU A;  4L0I A;  4L0B A;  4UI6 A;  4OQA C;  4UVT A;  4W6E A;  3UDD A;  4L0T A;  4BUF A;  3KR7 A;  4IUE A;  3SE2 A;  3U9Y A;  4J3M A;  4X52 A;  4UVX A;  1EFY A;  5AL4 A;  4J3L A;  4BUT A;  4UVN A;  4L70 A;  4L7O A;  3GEY A;  4TJW A;  4OPX C;  3P0N A;  4J21 A;  4PNQ A;  4HHZ A;  4UND A;  4L6Z A;  4TK5 A;  3SMJ A;  3UH4 A;  4HL5 A;  5AKU A;  4UHG A;  5LX6 A;  4PNT A;  5C5P A;  4L7R A;  4AVU A;  1UK0 A;  4N4T A;  4R5W A;  4MT9 A;  5C5R A;  3MHK A;  1WOK A;  4KRS A;  4UI7 A;  5FPF A;  4BFP A;  5LYH A;  4UVY A;  4TJY A;  2PQF A;  4DVI A;  4GV7 A;  4TKG A;  5LXP A;  4L33 A;  4L2G A;  4N4V A;  4R6E A;  4ZZX A;  4BUD A;  5ADT A;  4L2F A;  4N3R A;  4KZU A;  3UH2 A;  3KR8 A;  4BU5 A;  4XHU A;  3L3L A;  4MSG A;  4L7U A;  4K4F A;  4F0E A;  4HLM A;  3KJD A;  3GN7 A;  4W5I A;  4HLG A;  4PNS A;  4I9I A;  4PJT A;  4UVV A;  1PAX A;  4UFY A;  3P0P A;  2RF5 A;  4PML A;  5AL1 A;  4L7L A;  4HHY A;  4L09 A;  4BU8 A;  4J1Z A;  3C4H A;  4TK0 A;  4GV0 A;  5ADR A;  4PY4 A;  4PAX A;  4UVZ A;  4UVW A;  4BUE A;  4LI7 A;  4BJ9 A;  4BJB A;  4UVS A;  4L2K A;  4J22 A;  4RV6 A;  4L0V A;  4BUY A;  4HLK A;  5EBT A;  4PNR A;  4L31 A;  4BUX A;  3MHJ A;  4OA7 A;  5ADS A;  4M7B A;  4HKK A;  3FHB A;  4TKI A;  5AL5 A;  1UK1 A;  5AL3 A;  4L7N A;  4UI5 A;  4HKI A;  4LI8 A;  4BUU A;  4BUS A;  4ZZZ A;  4BUA A;  4GV4 A;  4MSK A;  4BU3 A;  4HKN A;  4ZZY A;  4L6S A;  1A26 A;  4KZQ A;  4BU6 A;  4TJU A;  4HMH A;  5DCZ A;  4HLH A;  5C5Q A;  4UVO A;  4UI8 A;  4UW1 A;  2X5Y A;  5AEH A;  4GV2 A;  4BUI A;  3W51 A;  4L32 A;  4F1L A;  4BS4 A;  4W5S A;  5ETY A;  4UXB A;  4HLF A;  4UI4 A;  4UVU A;  3U9H A;  4L34 A;  3HKV A;  4BU7 A;  5AL2 A;  3L3M A;  4TOR A;  4AVW A;  4OQB C;  2RCW A;  4PJV A;  3BLJ A;  4LI6 A;  4DQY C;  4UI3 A;  4U6A A;  4UVL A;  4TVJ A;  4BJC A;  5A00 A;  2PAW A;  5ADQ A;  3GOY A;  4HYF A;  3C49 A;  5FPG A;  3GJW A;  4TOS A;  4BU9 A;  3UA9 A;  4PNL A;  4K4E A;  4PNN A;  1GS0 A;  3PAX A;  4BUW A;  3P0Q A;  4L0S A;  4BUV A;  4UUH A;  3SMI A;  2PAX A;  4L10 A;  5ECE A;  4KZL A;  4L7P A; 
#chains in the Genus database with same CATH topology
 5AKW A;  4F1Q A;  4UVP A;  1OS1 A;  4PNM A;  1M51 A;  4TKF A;  4UX4 A;  1YVY A;  1NHX A;  2RD6 A;  2QEY A;  3CE0 A;  3KCZ A;  4UFU A;  1AYL A;  4L0I A;  4L0B A;  4UI6 A;  4OQA C;  4UVT A;  4W6E A;  3UDD A;  4L0T A;  4BUF A;  3KR7 A;  4IUE A;  2RKE A;  3SE2 A;  4GMZ A;  3U9Y A;  4J3M A;  4X52 A;  3DT4 A;  4UVX A;  1EFY A;  5AL4 A;  5FH2 A;  5FH3 A;  4J3L A;  4BUT A;  4UVN A;  4YW8 A;  4F0E A;  4L70 A;  4L7O A;  3GEY A;  4TJW A;  4OPX C;  3P0N A;  4J21 A;  4PNQ A;  2QEW A;  4HHZ A;  4L6Z A;  4TK5 A;  4UND A;  3SMJ A;  4HL5 A;  5AKU A;  3UH4 A;  4BUE A;  4UHG A;  5LX6 A;  4PNT A;  5C5P A;  2RKA A;  4L7R A;  4AVU A;  1UK0 A;  1YLH A;  4N4T A;  4R5W A;  4MT9 A;  5C5R A;  3MHK A;  5FH5 A;  1WOK A;  1XKV A;  4KRS A;  4UI7 A;  2PY7 X;  2OLR A;  4BFP A;  5FPF A;  5LYH A;  4UVY A;  4TJY A;  2PQF A;  4GMM A;  4DVI A;  4GV7 A;  4TKG A;  4GNQ A;  5LXP A;  4OX2 A;  4L33 A;  4L2G A;  4N4V A;  4R6E A;  2PC9 A;  1KHF A;  4ZZX A;  4BUD A;  5ADT A;  4L2F A;  4N3R A;  4KZU A;  3UH2 A;  2FAH A;  3KR8 A;  4BU5 A;  4XHU A;  4GNP A;  1KHE A;  3L3L A;  4L7U A;  4K4F A;  2RK8 A;  4MSG A;  1KHB A;  3MOE A;  4GMU A;  4HLM A;  3KJD A;  5FH1 A;  4YWD A;  3GN7 A;  4W5I A;  4HLG A;  4PNS A;  3DT7 A;  5FH4 A;  4I9I A;  1II2 A;  4PJT A;  1PAX A;  4UFY A;  3P0P A;  4UVV A;  2RF5 A;  4PML A;  5AL1 A;  1YTM A;  4HHY A;  4L09 A;  4L7L A;  4BU8 A;  2QF2 A;  4J1Z A;  3C4H A;  4TK0 A;  4GV0 A;  5ADR A;  4PY4 A;  4YW9 A;  4PAX A;  4GNM A;  4UVZ A;  3DTB A;  4UVW A;  4LI7 A;  1J3B A;  3MOH A;  4UVS A;  1K3D A;  4L2K A;  4J22 A;  4RV6 A;  4L0V A;  4BJ9 A;  4BJB A;  4BUY A;  4HLK A;  5EBT A;  4PNR A;  4L31 A;  4BUX A;  4RCG A;  3MHJ A;  4OA7 A;  5ADS A;  4M7B A;  4HKK A;  2RKD A;  3FHB A;  4TKI A;  1UK1 A;  5AL5 A;  5AL3 A;  4L7N A;  5I67 A;  4WIE A;  4UI5 A;  4HKI A;  4LI8 A;  4BUU A;  4BUS A;  4ZZZ A;  4BUA A;  4GV4 A;  4MSK A;  2RK7 A;  4BU3 A;  4GNO A;  4HKN A;  4ZZY A;  4L6S A;  1A26 A;  4KZQ A;  4BU6 A;  4WPT A;  2PXZ X;  4HMH A;  4TJU A;  2OLQ A;  4HLH A;  2FAF A;  4UVO A;  5DCZ A;  1KHG A;  4UI8 A;  4UW1 A;  5C5Q A;  2X5Y A;  5AEH A;  4GV2 A;  4BUI A;  3W51 A;  4L32 A;  4F1L A;  4BS4 A;  4W5S A;  5ETY A;  3DT2 A;  3MOF A;  4UXB A;  4HLF A;  4UI4 A;  4UVU A;  4WL8 A;  3U9H A;  4L34 A;  1K3C A;  3HKV A;  4WOU A;  4BU7 A;  5AL2 A;  4GNL A;  3L3M A;  4TOR A;  4AVW A;  4OQB C;  2RCW A;  4PJV A;  4WPU A;  2QZY A;  3BLJ A;  4LI6 A;  5FH0 A;  4DQY C;  4UI3 A;  4U6A A;  4UVL A;  1YGG A;  2QF1 A;  4TVJ A;  4BJC A;  5A00 A;  2PAW A;  5ADQ A;  3GOY A;  4HYF A;  3C49 A;  5FPG A;  3GJW A;  4R43 A;  4TOS A;  4BU9 A;  3UA9 A;  4PNL A;  1AQ2 A;  4K4E A;  4PNN A;  1GS0 A;  3PAX A;  4WIU A;  4BUW A;  2ZCI A;  3P0Q A;  4L0S A;  4WPV A;  4BUV A;  4GMW A;  4UUH A;  3SMI A;  2PAX A;  2GMV A;  4L10 A;  4YWB A;  5ECE A;  1OEN A;  4KZL A;  4L7P A; 
#chains in the Genus database with same CATH homology
 5AKW A;  4F1Q A;  4UVP A;  1OS1 A;  4PNM A;  1M51 A;  4TKF A;  4UX4 A;  1YVY A;  1NHX A;  2RD6 A;  2QEY A;  3CE0 A;  3KCZ A;  4UFU A;  1AYL A;  4L0I A;  4L0B A;  4UI6 A;  4OQA C;  4UVT A;  4W6E A;  3UDD A;  4L0T A;  4BUF A;  3KR7 A;  4IUE A;  2RKE A;  3SE2 A;  4GMZ A;  3U9Y A;  4J3M A;  4X52 A;  3DT4 A;  4UVX A;  1EFY A;  5AL4 A;  5FH2 A;  5FH3 A;  4J3L A;  4BUT A;  4UVN A;  4YW8 A;  4F0E A;  4L70 A;  4L7O A;  3GEY A;  4TJW A;  4OPX C;  3P0N A;  4J21 A;  4PNQ A;  2QEW A;  4HHZ A;  4L6Z A;  4TK5 A;  4UND A;  3SMJ A;  4HL5 A;  5AKU A;  3UH4 A;  4BUE A;  4UHG A;  5LX6 A;  4PNT A;  5C5P A;  2RKA A;  4L7R A;  4AVU A;  1UK0 A;  1YLH A;  4N4T A;  4R5W A;  4MT9 A;  5C5R A;  3MHK A;  5FH5 A;  1WOK A;  1XKV A;  4KRS A;  4UI7 A;  2PY7 X;  2OLR A;  4BFP A;  5FPF A;  5LYH A;  4UVY A;  4TJY A;  2PQF A;  4GMM A;  4DVI A;  4GV7 A;  4TKG A;  4GNQ A;  5LXP A;  4OX2 A;  4L33 A;  4L2G A;  4N4V A;  4R6E A;  2PC9 A;  1KHF A;  4ZZX A;  4BUD A;  5ADT A;  4L2F A;  4N3R A;  4KZU A;  3UH2 A;  2FAH A;  3KR8 A;  4BU5 A;  4XHU A;  4GNP A;  1KHE A;  3L3L A;  4L7U A;  4K4F A;  2RK8 A;  4MSG A;  1KHB A;  3MOE A;  4GMU A;  4HLM A;  3KJD A;  5FH1 A;  4YWD A;  3GN7 A;  4W5I A;  4HLG A;  4PNS A;  3DT7 A;  5FH4 A;  4I9I A;  1II2 A;  4PJT A;  1PAX A;  4UFY A;  3P0P A;  4UVV A;  2RF5 A;  4PML A;  5AL1 A;  1YTM A;  4HHY A;  4L09 A;  4L7L A;  4BU8 A;  2QF2 A;  4J1Z A;  3C4H A;  4TK0 A;  4GV0 A;  5ADR A;  4PY4 A;  4YW9 A;  4PAX A;  4GNM A;  4UVZ A;  3DTB A;  4UVW A;  4LI7 A;  1J3B A;  3MOH A;  4UVS A;  1K3D A;  4L2K A;  4J22 A;  4RV6 A;  4L0V A;  4BJ9 A;  4BJB A;  4BUY A;  4HLK A;  5EBT A;  4PNR A;  4L31 A;  4BUX A;  4RCG A;  3MHJ A;  4OA7 A;  5ADS A;  4M7B A;  4HKK A;  2RKD A;  3FHB A;  4TKI A;  1UK1 A;  5AL5 A;  5AL3 A;  4L7N A;  5I67 A;  4WIE A;  4UI5 A;  4HKI A;  4LI8 A;  4BUU A;  4BUS A;  4ZZZ A;  4BUA A;  4GV4 A;  4MSK A;  2RK7 A;  4BU3 A;  4GNO A;  4HKN A;  4ZZY A;  4L6S A;  1A26 A;  4KZQ A;  4BU6 A;  4WPT A;  2PXZ X;  4HMH A;  4TJU A;  2OLQ A;  4HLH A;  2FAF A;  4UVO A;  5DCZ A;  1KHG A;  4UI8 A;  4UW1 A;  5C5Q A;  2X5Y A;  5AEH A;  4GV2 A;  4BUI A;  3W51 A;  4L32 A;  4F1L A;  4BS4 A;  4W5S A;  5ETY A;  3DT2 A;  3MOF A;  4UXB A;  4HLF A;  4UI4 A;  4UVU A;  4WL8 A;  3U9H A;  4L34 A;  1K3C A;  3HKV A;  4WOU A;  4BU7 A;  5AL2 A;  4GNL A;  3L3M A;  4TOR A;  4AVW A;  4OQB C;  2RCW A;  4PJV A;  4WPU A;  2QZY A;  3BLJ A;  4LI6 A;  5FH0 A;  4DQY C;  4UI3 A;  4U6A A;  4UVL A;  1YGG A;  2QF1 A;  4TVJ A;  4BJC A;  5A00 A;  2PAW A;  5ADQ A;  3GOY A;  4HYF A;  3C49 A;  5FPG A;  3GJW A;  4R43 A;  4TOS A;  4BU9 A;  3UA9 A;  4PNL A;  1AQ2 A;  4K4E A;  4PNN A;  1GS0 A;  3PAX A;  4WIU A;  4BUW A;  2ZCI A;  3P0Q A;  4L0S A;  4WPV A;  4BUV A;  4GMW A;  4UUH A;  3SMI A;  2PAX A;  2GMV A;  4L10 A;  4YWB A;  5ECE A;  1OEN A;  4KZL A;  4L7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...