4UHGA

Crystal structure of human tankyrase 2 in complex with ta-21
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
b'GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Structure-Activity Relationships of 2-Arylquinazolin-4-Ones as Highly Selective and Potent Inhibitors of the Tankyrases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4uhgA00
2RCWA 4BU9A 3MHKA 4L7RA 4PNQA 4L09A 4UNDA 4BS4A 4TKFA 1WOKA 4UHGA 4HLFA 4L32A 4J1ZA 4UI8A 4HL5A 4BU5A 4PNSA 3SMIA 4BUUA 3P0QA 5AL4A 5FPGA 4MT9A 4X52A 4UFYA 4UXBA 5DCZA 4BUTA 3BLJA 4L6ZA 2RD6A 5AL5A 3L3MA 4L7NA 4OQAC 4I9IA 4UVSA 3UDDA 4L6SA 4BUAA 4BJBA 5ETYA 4BUXA 4K4EA 4UVPA 4BJCA 4UI5A 2RF5A 4PNMA 3P0PA 4TK0A 4PY4A 4OPXC 4ZZYA 5ADTA 4BUEA 4UVNA 4F1LA 4L7LA 4RV6A 3C4HA 4K4FA 3GEYA 4HLGA 4J21A 4LI8A 3PAXA 4W5IA 3GJWA 4HKKA 3GOYA 4TJWA 1EFYA 3C49A 5AEHA 3UH4A 4UVLA 4PAXA 4UVUA 4N4VA 4HHZA 4UI7A 4BUYA 5LX6A 3U9YA 3KJDA 4PMLA 4UI4A 4U6AA 4BU7A 1GS0A 1UK0A 4R5WA 5C5RA 4PJTA 4L0SA 5LYHA 4L31A 4TKIA 4UVOA 4TORA 4UW1A 3W51A 3FHBA 4UI3A 4L33A 4BJ9A 4R6EA 4N4TA 4BUWA 3L3LA 4L2GA 5FPFA 5AL2A 3HKVA 5ADSA 4GV2A 3MHJA 4MSGA 4UI6A 3SE2A 4HHYA 4HLKA 4HLHA 4ZZXA 4TKGA 4IUEA 4AVWA 4PNRA 4BU8A 2PQFA 3KR7A 4L0TA 4UVZA 4GV4A 4HYFA 4UFUA 4BU3A 4OA7A 4UVXA 4PNNA 4L7PA 4W6EA 3SMJA 5ADQA 4LI6A 4L7OA 4L0IA 3KR8A 1UK1A 3KCZA 4PJVA 2X5YA 4N3RA 4BUVA 4KZQA 3UA9A 4UVTA 5ADRA 4KRSA 5AKUA 4HKNA 4DQYC 4UX4A 4F0EA 4TJUA 4BUIA 5ECEA 4HKIA 5AKWA 3P0NA 4GV0A 5AL3A 4L2FA 5A00A 5LXPA 4PNLA 3UH2A 4L2KA 4L10A 4HMHA 4J3LA 4L34A 4KZUA 4PNTA 5EBTA 4OQBC 4J3MA 4F1QA 4L0BA 4AVUA 5AL1A 4TJYA 4BUFA 4UVVA 4TK5A 4UVYA 3U9HA 4TVJA 2PAXA 3GN7A 4TOSA 4M7BA 4ZZZA 4W5SA 4L7UA 3CE0A 4UVWA 4DVIA 5C5QA 4L70A 4GV7A 4L0VA 4HLMA 4KZLA 4BUSA 4XHUA 4LI7A 2PAWA 1PAXA 4J22A 4BFPA 1A26A 5C5PA 4UUHA 4MSKA 4BUDA 4BU6A
chains in the Genus database with same CATH superfamily
2RCWA 4BU9A 4YWBA 3MHKA 4L7RA 4PNQA 4L09A 4UNDA 4BS4A 4TKFA 3DT2A 1WOKA 4UHGA 4HLFA 4L32A 1KHBA 4J1ZA 2QF2A 4UI8A 4HL5A 4BU5A 4PNSA 3SMIA 1KHFA 4BUUA 3P0QA 5AL4A 5FPGA 4MT9A 4X52A 4R43A 4UFYA 4YWDA 4UXBA 1YGGA 5DCZA 4BUTA 3BLJA 4L6ZA 2RD6A 5AL5A 3L3MA 2FAFA 4GNLA 4L7NA 4OQAC 4I9IA 4UVSA 3UDDA 4L6SA 4YW8A 4WPTA 2QF1A 4BUAA 4BJBA 4GNPA 5ETYA 4BUXA 4K4EA 4UVPA 2QEWA 4BJCA 4UI5A 2RF5A 4PNMA 3P0PA 4TK0A 4PY4A 4OPXC 4ZZYA 5ADTA 4WPVA 4BUEA 4UVNA 4F1LA 4L7LA 4RV6A 3C4HA 4K4FA 3GEYA 5I67A 3DT4A 4HLGA 4J21A 4LI8A 3PAXA 4W5IA 3GJWA 4HKKA 4GMMA 2RK8A 3GOYA 4TJWA 1EFYA 4RCGA 3C49A 5AEHA 3UH4A 4UVLA 4GMUA 1OS1A 4PAXA 4UVUA 4N4VA 4HHZA 4UI7A 4BUYA 1XKVA 5LX6A 2RKEA 2QZYA 3U9YA 3KJDA 4PMLA 4UI4A 4U6AA 4BU7A 1GS0A 1UK0A 4R5WA 5C5RA 4PJTA 4L0SA 5LYHA 4L31A 4TKIA 4UVOA 4TORA 4UW1A 3W51A 5ADRA 3FHBA 4UI3A 4L33A 4BJ9A 2PY7X 4R6EA 4N4TA 4BUWA 3L3LA 4L2GA 2ZCIA 5FPFA 5FH5A 2OLQA 4GNMA 5AL2A 3HKVA 5ADSA 4GV2A 3MHJA 4MSGA 2RK7A 4UI6A 5FH1A 4HHYA 3SE2A 4HLKA 2PC9A 4HLHA 4ZZXA 4TKGA 4IUEA 4AVWA 4PNRA 4BU8A 2PQFA 3KR7A 5FH3A 4L0TA 4UVZA 5FH4A 4GMWA 4GV4A 4HYFA 4UFUA 1YVYA 4BU3A 4OA7A 4UVXA 4WIEA 4PNNA 4L7PA 4W6EA 4WOUA 3MOFA 3SMJA 4LI6A 4L7OA 5ADQA 1M51A 4L0IA 3KR8A 1UK1A 3KCZA 3DTBA 4PJVA 1AQ2A 2X5YA 1K3CA 4N3RA 4KZQA 3UA9A 4UVTA 4BUVA 4KRSA 5AKUA 1K3DA 4HKNA 4UX4A 4F0EA 4DQYC 4TJUA 4BUIA 5ECEA 4HKIA 2QEYA 4WPUA 5AKWA 3P0NA 4GV0A 2GMVA 5AL3A 4L2FA 5A00A 2RKAA 5LXPA 4PNLA 3UH2A 3MOHA 4L2KA 4L10A 5FH0A 4HMHA 4J3LA 4L34A 4KZUA 4PNTA 5EBTA 4OQBC 4J3MA 4YW9A 4L0BA 4AVUA 5AL1A 1KHGA 4TJYA 1YTMA 4F1QA 4BUFA 1II2A 4TK5A 4UVVA 4UVYA 1NHXA 2RKDA 3U9HA 4TVJA 2PAXA 1KHEA 1OENA 3DT7A 3GN7A 4GNQA 4M7BA 4TOSA 4W5SA 4L7UA 4ZZZA 3CE0A 4WIUA 4UVWA 4DVIA 3MOEA 5C5QA 4OX2A 4GMZA 4L70A 4GV7A 4L0VA 4HLMA 4KZLA 2FAHA 4BUSA 1YLHA 2PXZX 4LI7A 2PAWA 1J3BA 1PAXA 1AYLA 4J22A 4XHUA 4BFPA 1A26A 5C5PA 4UUHA 4MSKA 5FH2A 2OLRA 4WL8A 4GNOA 4BUDA 4BU6A
chains in the Genus database with same CATH topology
2RCWA 4BU9A 4YWBA 3MHKA 4L7RA 4PNQA 4L09A 4UNDA 4BS4A 4TKFA 3DT2A 1WOKA 4UHGA 4HLFA 4L32A 1KHBA 4J1ZA 2QF2A 4UI8A 4HL5A 4BU5A 4PNSA 3SMIA 1KHFA 4BUUA 3P0QA 5AL4A 5FPGA 4MT9A 4X52A 4R43A 4UFYA 4YWDA 4UXBA 1YGGA 5DCZA 4BUTA 3BLJA 4L6ZA 2RD6A 5AL5A 3L3MA 2FAFA 4GNLA 4L7NA 4OQAC 4I9IA 4UVSA 3UDDA 4L6SA 4YW8A 4WPTA 2QF1A 4BUAA 4BJBA 4GNPA 5ETYA 4BUXA 4K4EA 4UVPA 2QEWA 4BJCA 4UI5A 2RF5A 4PNMA 3P0PA 4TK0A 4PY4A 4OPXC 4ZZYA 5ADTA 4WPVA 4BUEA 4UVNA 4F1LA 4L7LA 4RV6A 3C4HA 4K4FA 3GEYA 5I67A 3DT4A 4HLGA 4J21A 4LI8A 3PAXA 4W5IA 3GJWA 4HKKA 4GMMA 2RK8A 3GOYA 4TJWA 1EFYA 4RCGA 3C49A 5AEHA 3UH4A 4UVLA 4GMUA 1OS1A 4PAXA 4UVUA 4N4VA 4HHZA 4UI7A 4BUYA 1XKVA 5LX6A 2RKEA 2QZYA 3U9YA 3KJDA 4PMLA 4UI4A 4U6AA 4BU7A 1GS0A 1UK0A 4R5WA 5C5RA 4PJTA 4L0SA 5LYHA 4L31A 4TKIA 4UVOA 4TORA 4UW1A 3W51A 5ADRA 3FHBA 4UI3A 4L33A 4BJ9A 2PY7X 4R6EA 4N4TA 4BUWA 3L3LA 4L2GA 2ZCIA 5FPFA 5FH5A 2OLQA 4GNMA 5AL2A 3HKVA 5ADSA 4GV2A 3MHJA 4MSGA 2RK7A 4UI6A 5FH1A 4HHYA 3SE2A 4HLKA 2PC9A 4HLHA 4ZZXA 4TKGA 4IUEA 4AVWA 4PNRA 4BU8A 2PQFA 3KR7A 5FH3A 4L0TA 4UVZA 5FH4A 4GMWA 4GV4A 4HYFA 4UFUA 1YVYA 4BU3A 4OA7A 4UVXA 4WIEA 4PNNA 4L7PA 4W6EA 4WOUA 3MOFA 3SMJA 4LI6A 4L7OA 5ADQA 1M51A 4L0IA 3KR8A 1UK1A 3KCZA 3DTBA 4PJVA 1AQ2A 2X5YA 1K3CA 4N3RA 4KZQA 3UA9A 4UVTA 4BUVA 4KRSA 5AKUA 1K3DA 4HKNA 4UX4A 4F0EA 4DQYC 4TJUA 4BUIA 5ECEA 4HKIA 2QEYA 4WPUA 5AKWA 3P0NA 4GV0A 2GMVA 5AL3A 4L2FA 5A00A 2RKAA 5LXPA 4PNLA 3UH2A 3MOHA 4L2KA 4L10A 5FH0A 4HMHA 4J3LA 4L34A 4KZUA 4PNTA 5EBTA 4OQBC 4J3MA 4YW9A 4L0BA 4AVUA 5AL1A 1KHGA 4TJYA 1YTMA 4F1QA 4BUFA 1II2A 4TK5A 4UVVA 4UVYA 1NHXA 2RKDA 3U9HA 4TVJA 2PAXA 1KHEA 1OENA 3DT7A 3GN7A 4GNQA 4M7BA 4TOSA 4W5SA 4L7UA 4ZZZA 3CE0A 4WIUA 4UVWA 4DVIA 3MOEA 5C5QA 4OX2A 4GMZA 4L70A 4GV7A 4L0VA 4HLMA 4KZLA 2FAHA 4BUSA 1YLHA 2PXZX 4LI7A 2PAWA 1J3BA 1PAXA 1AYLA 4J22A 4XHUA 4BFPA 1A26A 5C5PA 4UUHA 4MSKA 5FH2A 2OLRA 4WL8A 4GNOA 4BUDA 4BU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCW A;  4BU9 A;  3MHK A;  4L7R A;  4PNQ A;  4L09 A;  4UND A;  4BS4 A;  4TKF A;  1WOK A;  4UHG A;  4HLF A;  4L32 A;  4J1Z A;  4UI8 A;  4HL5 A;  4BU5 A;  4PNS A;  3SMI A;  4BUU A;  3P0Q A;  5AL4 A;  5FPG A;  4MT9 A;  4X52 A;  4UFY A;  4UXB A;  5DCZ A;  4BUT A;  3BLJ A;  4L6Z A;  2RD6 A;  5AL5 A;  3L3M A;  4L7N A;  4OQA C;  4I9I A;  4UVS A;  3UDD A;  4L6S A;  4BUA A;  4BJB A;  5ETY A;  4BUX A;  4K4E A;  4UVP A;  4BJC A;  4UI5 A;  2RF5 A;  4PNM A;  3P0P A;  4TK0 A;  4PY4 A;  4OPX C;  4ZZY A;  5ADT A;  4BUE A;  4UVN A;  4F1L A;  4L7L A;  4RV6 A;  3C4H A;  4K4F A;  3GEY A;  4HLG A;  4J21 A;  4LI8 A;  3PAX A;  4W5I A;  3GJW A;  4HKK A;  3GOY A;  4TJW A;  1EFY A;  3C49 A;  5AEH A;  3UH4 A;  4UVL A;  4PAX A;  4UVU A;  4N4V A;  4HHZ A;  4UI7 A;  4BUY A;  5LX6 A;  3U9Y A;  3KJD A;  4PML A;  4UI4 A;  4U6A A;  4BU7 A;  1GS0 A;  1UK0 A;  4R5W A;  5C5R A;  4PJT A;  4L0S A;  5LYH A;  4L31 A;  4TKI A;  4UVO A;  4TOR A;  4UW1 A;  3W51 A;  3FHB A;  4UI3 A;  4L33 A;  4BJ9 A;  4R6E A;  4N4T A;  4BUW A;  3L3L A;  4L2G A;  5FPF A;  5AL2 A;  3HKV A;  5ADS A;  4GV2 A;  3MHJ A;  4MSG A;  4UI6 A;  3SE2 A;  4HHY A;  4HLK A;  4HLH A;  4ZZX A;  4TKG A;  4IUE A;  4AVW A;  4PNR A;  4BU8 A;  2PQF A;  3KR7 A;  4L0T A;  4UVZ A;  4GV4 A;  4HYF A;  4UFU A;  4BU3 A;  4OA7 A;  4UVX A;  4PNN A;  4L7P A;  4W6E A;  3SMJ A;  5ADQ A;  4LI6 A;  4L7O A;  4L0I A;  3KR8 A;  1UK1 A;  3KCZ A;  4PJV A;  2X5Y A;  4N3R A;  4BUV A;  4KZQ A;  3UA9 A;  4UVT A;  5ADR A;  4KRS A;  5AKU A;  4HKN A;  4DQY C;  4UX4 A;  4F0E A;  4TJU A;  4BUI A;  5ECE A;  4HKI A;  5AKW A;  3P0N A;  4GV0 A;  5AL3 A;  4L2F A;  5A00 A;  5LXP A;  4PNL A;  3UH2 A;  4L2K A;  4L10 A;  4HMH A;  4J3L A;  4L34 A;  4KZU A;  4PNT A;  5EBT A;  4OQB C;  4J3M A;  4F1Q A;  4L0B A;  4AVU A;  5AL1 A;  4TJY A;  4BUF A;  4UVV A;  4TK5 A;  4UVY A;  3U9H A;  4TVJ A;  2PAX A;  3GN7 A;  4TOS A;  4M7B A;  4ZZZ A;  4W5S A;  4L7U A;  3CE0 A;  4UVW A;  4DVI A;  5C5Q A;  4L70 A;  4GV7 A;  4L0V A;  4HLM A;  4KZL A;  4BUS A;  4XHU A;  4LI7 A;  2PAW A;  1PAX A;  4J22 A;  4BFP A;  1A26 A;  5C5P A;  4UUH A;  4MSK A;  4BUD A;  4BU6 A; 
#chains in the Genus database with same CATH topology
 2RCW A;  4BU9 A;  4YWB A;  3MHK A;  4L7R A;  4PNQ A;  4L09 A;  4UND A;  4BS4 A;  4TKF A;  3DT2 A;  1WOK A;  4UHG A;  4HLF A;  4L32 A;  1KHB A;  4J1Z A;  2QF2 A;  4UI8 A;  4HL5 A;  4BU5 A;  4PNS A;  3SMI A;  1KHF A;  4BUU A;  3P0Q A;  5AL4 A;  5FPG A;  4MT9 A;  4X52 A;  4R43 A;  4UFY A;  4YWD A;  4UXB A;  1YGG A;  5DCZ A;  4BUT A;  3BLJ A;  4L6Z A;  2RD6 A;  5AL5 A;  3L3M A;  2FAF A;  4GNL A;  4L7N A;  4OQA C;  4I9I A;  4UVS A;  3UDD A;  4L6S A;  4YW8 A;  4WPT A;  2QF1 A;  4BUA A;  4BJB A;  4GNP A;  5ETY A;  4BUX A;  4K4E A;  4UVP A;  2QEW A;  4BJC A;  4UI5 A;  2RF5 A;  4PNM A;  3P0P A;  4TK0 A;  4PY4 A;  4OPX C;  4ZZY A;  5ADT A;  4WPV A;  4BUE A;  4UVN A;  4F1L A;  4L7L A;  4RV6 A;  3C4H A;  4K4F A;  3GEY A;  5I67 A;  3DT4 A;  4HLG A;  4J21 A;  4LI8 A;  3PAX A;  4W5I A;  3GJW A;  4HKK A;  4GMM A;  2RK8 A;  3GOY A;  4TJW A;  1EFY A;  4RCG A;  3C49 A;  5AEH A;  3UH4 A;  4UVL A;  4GMU A;  1OS1 A;  4PAX A;  4UVU A;  4N4V A;  4HHZ A;  4UI7 A;  4BUY A;  1XKV A;  5LX6 A;  2RKE A;  2QZY A;  3U9Y A;  3KJD A;  4PML A;  4UI4 A;  4U6A A;  4BU7 A;  1GS0 A;  1UK0 A;  4R5W A;  5C5R A;  4PJT A;  4L0S A;  5LYH A;  4L31 A;  4TKI A;  4UVO A;  4TOR A;  4UW1 A;  3W51 A;  5ADR A;  3FHB A;  4UI3 A;  4L33 A;  4BJ9 A;  2PY7 X;  4R6E A;  4N4T A;  4BUW A;  3L3L A;  4L2G A;  2ZCI A;  5FPF A;  5FH5 A;  2OLQ A;  4GNM A;  5AL2 A;  3HKV A;  5ADS A;  4GV2 A;  3MHJ A;  4MSG A;  2RK7 A;  4UI6 A;  5FH1 A;  4HHY A;  3SE2 A;  4HLK A;  2PC9 A;  4HLH A;  4ZZX A;  4TKG A;  4IUE A;  4AVW A;  4PNR A;  4BU8 A;  2PQF A;  3KR7 A;  5FH3 A;  4L0T A;  4UVZ A;  5FH4 A;  4GMW A;  4GV4 A;  4HYF A;  4UFU A;  1YVY A;  4BU3 A;  4OA7 A;  4UVX A;  4WIE A;  4PNN A;  4L7P A;  4W6E A;  4WOU A;  3MOF A;  3SMJ A;  4LI6 A;  4L7O A;  5ADQ A;  1M51 A;  4L0I A;  3KR8 A;  1UK1 A;  3KCZ A;  3DTB A;  4PJV A;  1AQ2 A;  2X5Y A;  1K3C A;  4N3R A;  4KZQ A;  3UA9 A;  4UVT A;  4BUV A;  4KRS A;  5AKU A;  1K3D A;  4HKN A;  4UX4 A;  4F0E A;  4DQY C;  4TJU A;  4BUI A;  5ECE A;  4HKI A;  2QEY A;  4WPU A;  5AKW A;  3P0N A;  4GV0 A;  2GMV A;  5AL3 A;  4L2F A;  5A00 A;  2RKA A;  5LXP A;  4PNL A;  3UH2 A;  3MOH A;  4L2K A;  4L10 A;  5FH0 A;  4HMH A;  4J3L A;  4L34 A;  4KZU A;  4PNT A;  5EBT A;  4OQB C;  4J3M A;  4YW9 A;  4L0B A;  4AVU A;  5AL1 A;  1KHG A;  4TJY A;  1YTM A;  4F1Q A;  4BUF A;  1II2 A;  4TK5 A;  4UVV A;  4UVY A;  1NHX A;  2RKD A;  3U9H A;  4TVJ A;  2PAX A;  1KHE A;  1OEN A;  3DT7 A;  3GN7 A;  4GNQ A;  4M7B A;  4TOS A;  4W5S A;  4L7U A;  4ZZZ A;  3CE0 A;  4WIU A;  4UVW A;  4DVI A;  3MOE A;  5C5Q A;  4OX2 A;  4GMZ A;  4L70 A;  4GV7 A;  4L0V A;  4HLM A;  4KZL A;  2FAH A;  4BUS A;  1YLH A;  2PXZ X;  4LI7 A;  2PAW A;  1J3B A;  1PAX A;  1AYL A;  4J22 A;  4XHU A;  4BFP A;  1A26 A;  5C5P A;  4UUH A;  4MSK A;  5FH2 A;  2OLR A;  4WL8 A;  4GNO A;  4BUD A;  4BU6 A; 
#chains in the Genus database with same CATH homology
 2RCW A;  4BU9 A;  4YWB A;  3MHK A;  4L7R A;  4PNQ A;  4L09 A;  4UND A;  4BS4 A;  4TKF A;  3DT2 A;  1WOK A;  4UHG A;  4HLF A;  4L32 A;  1KHB A;  4J1Z A;  2QF2 A;  4UI8 A;  4HL5 A;  4BU5 A;  4PNS A;  3SMI A;  1KHF A;  4BUU A;  3P0Q A;  5AL4 A;  5FPG A;  4MT9 A;  4X52 A;  4R43 A;  4UFY A;  4YWD A;  4UXB A;  1YGG A;  5DCZ A;  4BUT A;  3BLJ A;  4L6Z A;  2RD6 A;  5AL5 A;  3L3M A;  2FAF A;  4GNL A;  4L7N A;  4OQA C;  4I9I A;  4UVS A;  3UDD A;  4L6S A;  4YW8 A;  4WPT A;  2QF1 A;  4BUA A;  4BJB A;  4GNP A;  5ETY A;  4BUX A;  4K4E A;  4UVP A;  2QEW A;  4BJC A;  4UI5 A;  2RF5 A;  4PNM A;  3P0P A;  4TK0 A;  4PY4 A;  4OPX C;  4ZZY A;  5ADT A;  4WPV A;  4BUE A;  4UVN A;  4F1L A;  4L7L A;  4RV6 A;  3C4H A;  4K4F A;  3GEY A;  5I67 A;  3DT4 A;  4HLG A;  4J21 A;  4LI8 A;  3PAX A;  4W5I A;  3GJW A;  4HKK A;  4GMM A;  2RK8 A;  3GOY A;  4TJW A;  1EFY A;  4RCG A;  3C49 A;  5AEH A;  3UH4 A;  4UVL A;  4GMU A;  1OS1 A;  4PAX A;  4UVU A;  4N4V A;  4HHZ A;  4UI7 A;  4BUY A;  1XKV A;  5LX6 A;  2RKE A;  2QZY A;  3U9Y A;  3KJD A;  4PML A;  4UI4 A;  4U6A A;  4BU7 A;  1GS0 A;  1UK0 A;  4R5W A;  5C5R A;  4PJT A;  4L0S A;  5LYH A;  4L31 A;  4TKI A;  4UVO A;  4TOR A;  4UW1 A;  3W51 A;  5ADR A;  3FHB A;  4UI3 A;  4L33 A;  4BJ9 A;  2PY7 X;  4R6E A;  4N4T A;  4BUW A;  3L3L A;  4L2G A;  2ZCI A;  5FPF A;  5FH5 A;  2OLQ A;  4GNM A;  5AL2 A;  3HKV A;  5ADS A;  4GV2 A;  3MHJ A;  4MSG A;  2RK7 A;  4UI6 A;  5FH1 A;  4HHY A;  3SE2 A;  4HLK A;  2PC9 A;  4HLH A;  4ZZX A;  4TKG A;  4IUE A;  4AVW A;  4PNR A;  4BU8 A;  2PQF A;  3KR7 A;  5FH3 A;  4L0T A;  4UVZ A;  5FH4 A;  4GMW A;  4GV4 A;  4HYF A;  4UFU A;  1YVY A;  4BU3 A;  4OA7 A;  4UVX A;  4WIE A;  4PNN A;  4L7P A;  4W6E A;  4WOU A;  3MOF A;  3SMJ A;  4LI6 A;  4L7O A;  5ADQ A;  1M51 A;  4L0I A;  3KR8 A;  1UK1 A;  3KCZ A;  3DTB A;  4PJV A;  1AQ2 A;  2X5Y A;  1K3C A;  4N3R A;  4KZQ A;  3UA9 A;  4UVT A;  4BUV A;  4KRS A;  5AKU A;  1K3D A;  4HKN A;  4UX4 A;  4F0E A;  4DQY C;  4TJU A;  4BUI A;  5ECE A;  4HKI A;  2QEY A;  4WPU A;  5AKW A;  3P0N A;  4GV0 A;  2GMV A;  5AL3 A;  4L2F A;  5A00 A;  2RKA A;  5LXP A;  4PNL A;  3UH2 A;  3MOH A;  4L2K A;  4L10 A;  5FH0 A;  4HMH A;  4J3L A;  4L34 A;  4KZU A;  4PNT A;  5EBT A;  4OQB C;  4J3M A;  4YW9 A;  4L0B A;  4AVU A;  5AL1 A;  1KHG A;  4TJY A;  1YTM A;  4F1Q A;  4BUF A;  1II2 A;  4TK5 A;  4UVV A;  4UVY A;  1NHX A;  2RKD A;  3U9H A;  4TVJ A;  2PAX A;  1KHE A;  1OEN A;  3DT7 A;  3GN7 A;  4GNQ A;  4M7B A;  4TOS A;  4W5S A;  4L7U A;  4ZZZ A;  3CE0 A;  4WIU A;  4UVW A;  4DVI A;  3MOE A;  5C5Q A;  4OX2 A;  4GMZ A;  4L70 A;  4GV7 A;  4L0V A;  4HLM A;  4KZL A;  2FAH A;  4BUS A;  1YLH A;  2PXZ X;  4LI7 A;  2PAW A;  1J3B A;  1PAX A;  1AYL A;  4J22 A;  4XHU A;  4BFP A;  1A26 A;  5C5P A;  4UUH A;  4MSK A;  5FH2 A;  2OLR A;  4WL8 A;  4GNO A;  4BUD A;  4BU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...