4UHGA

Crystal structure of human tankyrase 2 in complex with ta-21
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
210
structure length
208
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TANKYRASE-2
publication title Structure-Activity Relationships of 2-Arylquinazolin-4-Ones as Highly Selective and Potent Inhibitors of the Tankyrases.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 208
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4uhgA00
4RV6A 3P0QA 4UVVA 4BU3A 4HKKA 4L7NA 4BJCA 4UVYA 3PAXA 4UVXA 4L0TA 4TOSA 4HKIA 4I9IA 4L10A 4UFUA 4BUVA 4UVTA 4HLFA 4BUIA 3GEYA 4MSKA 4BUSA 3GN7A 5A00A 4UVSA 4N4TA 4DVIA 4GV7A 3KJDA 4PNMA 3UA9A 4J21A 4BUTA 3UH2A 4PAXA 1EFYA 4BU9A 4AVUA 4BU8A 4KZLA 4GV4A 2RF5A 4J3MA 4TJUA 5FPFA 4L0VA 4N4VA 4HKNA 4HLHA 4BFPA 5ADQA 4L7UA 5ADSA 4TJYA 4HHZA 4L6ZA 5FPGA 4ZZZA 4UFYA 5C5PA 4TVJA 3KR8A 4BUYA 4LI8A 3L3MA 5AEHA 3GJWA 4UVWA 4KZQA 5C5RA 4PNLA 4OQAC 4UW1A 2PAXA 4L2FA 4TORA 4W6EA 5C5QA 5LYHA 3C49A 4L0IA 4TJWA 4N3RA 4BUDA 4PNNA 2PAWA 2RD6A 4PNQA 4L33A 4L7PA 4ZZXA 4L0BA 2RCWA 4F1QA 1UK0A 4HHYA 4PJTA 5ETYA 4K4FA 4BU5A 3KR7A 4R6EA 4MSGA 4UI6A 5ECEA 4LI6A 1UK1A 5AL1A 5EBTA 3L3LA 4PJVA 5ADRA 3FHBA 4LI7A 2X5YA 4U6AA 4DQYC 3P0PA 5AL2A 3CE0A 4J22A 4OQBC 4GV0A 4BUEA 4BUAA 5LXPA 4UI8A 4L7LA 4TKGA 3HKVA 3P0NA 4L7OA 4BU7A 3GOYA 4HYFA 4UI4A 4BUFA 4HLMA 4UVLA 3MHKA 1GS0A 4UVOA 3SMIA 4L0SA 4UVUA 4UHGA 4TKIA 4MT9A 4L2GA 4TKFA 4J1ZA 4L7RA 4R5WA 4L09A 4X52A 4BUXA 4L34A 2PQFA 4UI5A 3U9YA 4PY4A 4PMLA 4GV2A 4W5SA 3W51A 3BLJA 3SE2A 3UDDA 1WOKA 4L2KA 4IUEA 4F0EA 4KRSA 5AKWA 4UI7A 4M7BA 4BU6A 4TK0A 5ADTA 4W5IA 4L31A 4HLGA 1A26A 4KZUA 4UVPA 3UH4A 4AVWA 3MHJA 4PNSA 4PNRA 4L6SA 4UVNA 3U9HA 5AKUA 4UI3A 4L70A 1PAXA 4J3LA 4F1LA 4BJBA 4TK5A 4UXBA 4HLKA 5DCZA 5AL3A 4ZZYA 4HL5A 4BUWA 5AL4A 4UUHA 4UX4A 4XHUA 4OPXC 4BS4A 4OA7A 4UVZA 5LX6A 4BUUA 4HMHA 4L32A 5AL5A 3SMJA 4UNDA 4BJ9A 4PNTA 4K4EA 3C4HA 3KCZA
chains in the Genus database with same CATH superfamily
4RV6A 3P0QA 4UVVA 4BU3A 4HKKA 4L7NA 4BJCA 2QEWA 4UVYA 3PAXA 4UVXA 4L0TA 4TOSA 4HKIA 4I9IA 4L10A 4UFUA 4BUVA 4UVTA 4HLFA 2RKAA 4BUIA 3GEYA 4MSKA 1XKVA 4BUSA 3GN7A 5A00A 4UVSA 4N4TA 4DVIA 4GV7A 3KJDA 4PNMA 3UA9A 4J21A 4BUTA 2GMVA 3UH2A 4PAXA 1EFYA 4BU9A 4AVUA 4BU8A 4KZLA 4GV4A 2RF5A 4J3MA 4TJUA 1KHGA 2OLRA 2PXZX 4YWDA 5FPFA 4L0VA 2PC9A 4N4VA 4HKNA 4HLHA 4BFPA 5ADQA 4L7UA 5ADSA 4TJYA 4HHZA 4L6ZA 4GNMA 5FPGA 4ZZZA 4UFYA 5C5PA 4TVJA 3KR8A 4GNPA 4BUYA 4LI8A 3L3MA 5AEHA 3GJWA 4UVWA 1NHXA 4KZQA 5C5RA 1AQ2A 4PNLA 4OQAC 2FAHA 4UW1A 2PAXA 4L2FA 4TORA 4W6EA 5C5QA 5LYHA 2FAFA 3C49A 1YGGA 4L0IA 4TJWA 4N3RA 1OENA 4YW8A 4BUDA 2QF1A 1AYLA 4PNNA 2PAWA 1YTMA 2RD6A 4L33A 4L7PA 4PNQA 4WOUA 4ZZXA 4L0BA 2RCWA 4WPUA 4F1QA 2QZYA 1UK0A 2ZCIA 4GMUA 4HHYA 4PJTA 5ETYA 4YWBA 4K4FA 4BU5A 3KR7A 4R6EA 1YVYA 2RKDA 4MSGA 5FH0A 4UI6A 5ECEA 4LI6A 2RK8A 1UK1A 5AL1A 2OLQA 1KHBA 3L3LA 4PJVA 5EBTA 5ADRA 3FHBA 4LI7A 2X5YA 4U6AA 4DQYC 4OX2A 3P0PA 5AL2A 3CE0A 4GNLA 4J22A 4OQBC 5FH2A 4GV0A 4BUEA 4BUAA 5LXPA 4UI8A 4L7LA 4TKGA 3HKVA 3P0NA 4L7OA 4BU7A 4RCGA 3GOYA 1J3BA 3DT4A 5FH3A 3MOHA 4HYFA 4R43A 4UI4A 4BUFA 4HLMA 3DT7A 4UVLA 4WL8A 3MHKA 1GS0A 4UVOA 3SMIA 4L0SA 4UVUA 4UHGA 4WIUA 4TKIA 4MT9A 4L2GA 1M51A 4TKFA 4J1ZA 4L7RA 4R5WA 4L09A 4X52A 4BUXA 4L34A 2PQFA 1KHFA 4UI5A 3U9YA 4PY4A 4PMLA 4GV2A 4W5SA 5FH1A 3BLJA 3SE2A 4WIEA 3UDDA 3W51A 1WOKA 4L2KA 4GMZA 4IUEA 4F0EA 4KRSA 5AKWA 5FH5A 4UI7A 4M7BA 3DTBA 4BU6A 4TK0A 5ADTA 4W5IA 3DT2A 4L31A 4HLGA 1A26A 4KZUA 4GMMA 4UVPA 3UH4A 3MOEA 1OS1A 3MHJA 4AVWA 4PNSA 4PNRA 4YW9A 2RK7A 4L6SA 4UVNA 5FH4A 3U9HA 5AKUA 4UI3A 4L70A 1PAXA 2QF2A 2PY7X 3MOFA 4J3LA 4F1LA 2QEYA 4WPTA 5I67A 4BJBA 4TK5A 4GNQA 1K3CA 4UXBA 4HLKA 5DCZA 5AL3A 4ZZYA 4HL5A 4WPVA 4GNOA 4BUWA 5AL4A 1KHEA 4UUHA 4UX4A 4XHUA 4OPXC 1II2A 4BS4A 4OA7A 4UVZA 5LX6A 4BUUA 4GMWA 4HMHA 4L32A 5AL5A 3SMJA 4UNDA 4BJ9A 1K3DA 4PNTA 1YLHA 4K4EA 2RKEA 3C4HA 3KCZA
chains in the Genus database with same CATH topology
4RV6A 3P0QA 4UVVA 4BU3A 4HKKA 4L7NA 4BJCA 2QEWA 4UVYA 3PAXA 4UVXA 4L0TA 4TOSA 4HKIA 4I9IA 4L10A 4UFUA 4BUVA 4UVTA 4HLFA 2RKAA 4BUIA 3GEYA 4MSKA 1XKVA 4BUSA 3GN7A 5A00A 4UVSA 4N4TA 4DVIA 4GV7A 3KJDA 4PNMA 3UA9A 4J21A 4BUTA 2GMVA 3UH2A 4PAXA 1EFYA 4BU9A 4AVUA 4BU8A 4KZLA 4GV4A 2RF5A 4J3MA 4TJUA 1KHGA 2OLRA 2PXZX 4YWDA 5FPFA 4L0VA 2PC9A 4N4VA 4HKNA 4HLHA 4BFPA 5ADQA 4L7UA 5ADSA 4TJYA 4HHZA 4L6ZA 4GNMA 5FPGA 4ZZZA 4UFYA 5C5PA 4TVJA 3KR8A 4GNPA 4BUYA 4LI8A 3L3MA 5AEHA 3GJWA 4UVWA 1NHXA 4KZQA 5C5RA 1AQ2A 4PNLA 4OQAC 2FAHA 4UW1A 2PAXA 4L2FA 4TORA 4W6EA 5C5QA 5LYHA 2FAFA 3C49A 1YGGA 4L0IA 4TJWA 4N3RA 1OENA 4YW8A 4BUDA 2QF1A 1AYLA 4PNNA 2PAWA 1YTMA 2RD6A 4L33A 4L7PA 4PNQA 4WOUA 4ZZXA 4L0BA 2RCWA 4WPUA 4F1QA 2QZYA 1UK0A 2ZCIA 4GMUA 4HHYA 4PJTA 5ETYA 4YWBA 4K4FA 4BU5A 3KR7A 4R6EA 1YVYA 2RKDA 4MSGA 5FH0A 4UI6A 5ECEA 4LI6A 2RK8A 1UK1A 5AL1A 2OLQA 1KHBA 3L3LA 4PJVA 5EBTA 5ADRA 3FHBA 4LI7A 2X5YA 4U6AA 4DQYC 4OX2A 3P0PA 5AL2A 3CE0A 4GNLA 4J22A 4OQBC 5FH2A 4GV0A 4BUEA 4BUAA 5LXPA 4UI8A 4L7LA 4TKGA 3HKVA 3P0NA 4L7OA 4BU7A 4RCGA 3GOYA 1J3BA 3DT4A 5FH3A 3MOHA 4HYFA 4R43A 4UI4A 4BUFA 4HLMA 3DT7A 4UVLA 4WL8A 3MHKA 1GS0A 4UVOA 3SMIA 4L0SA 4UVUA 4UHGA 4WIUA 4TKIA 4MT9A 4L2GA 1M51A 4TKFA 4J1ZA 4L7RA 4R5WA 4L09A 4X52A 4BUXA 4L34A 2PQFA 1KHFA 4UI5A 3U9YA 4PY4A 4PMLA 4GV2A 4W5SA 5FH1A 3BLJA 3SE2A 4WIEA 3UDDA 3W51A 1WOKA 4L2KA 4GMZA 4IUEA 4F0EA 4KRSA 5AKWA 5FH5A 4UI7A 4M7BA 3DTBA 4BU6A 4TK0A 5ADTA 4W5IA 3DT2A 4L31A 4HLGA 1A26A 4KZUA 4GMMA 4UVPA 3UH4A 3MOEA 1OS1A 3MHJA 4AVWA 4PNSA 4PNRA 4YW9A 2RK7A 4L6SA 4UVNA 5FH4A 3U9HA 5AKUA 4UI3A 4L70A 1PAXA 2QF2A 2PY7X 3MOFA 4J3LA 4F1LA 2QEYA 4WPTA 5I67A 4BJBA 4TK5A 4GNQA 1K3CA 4UXBA 4HLKA 5DCZA 5AL3A 4ZZYA 4HL5A 4WPVA 4GNOA 4BUWA 5AL4A 1KHEA 4UUHA 4UX4A 4XHUA 4OPXC 1II2A 4BS4A 4OA7A 4UVZA 5LX6A 4BUUA 4GMWA 4HMHA 4L32A 5AL5A 3SMJA 4UNDA 4BJ9A 1K3DA 4PNTA 1YLHA 4K4EA 2RKEA 3C4HA 3KCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RV6 A;  3P0Q A;  4UVV A;  4BU3 A;  4HKK A;  4L7N A;  4BJC A;  4UVY A;  3PAX A;  4UVX A;  4L0T A;  4TOS A;  4HKI A;  4I9I A;  4L10 A;  4UFU A;  4BUV A;  4UVT A;  4HLF A;  4BUI A;  3GEY A;  4MSK A;  4BUS A;  3GN7 A;  5A00 A;  4UVS A;  4N4T A;  4DVI A;  4GV7 A;  3KJD A;  4PNM A;  3UA9 A;  4J21 A;  4BUT A;  3UH2 A;  4PAX A;  1EFY A;  4BU9 A;  4AVU A;  4BU8 A;  4KZL A;  4GV4 A;  2RF5 A;  4J3M A;  4TJU A;  5FPF A;  4L0V A;  4N4V A;  4HKN A;  4HLH A;  4BFP A;  5ADQ A;  4L7U A;  5ADS A;  4TJY A;  4HHZ A;  4L6Z A;  5FPG A;  4ZZZ A;  4UFY A;  5C5P A;  4TVJ A;  3KR8 A;  4BUY A;  4LI8 A;  3L3M A;  5AEH A;  3GJW A;  4UVW A;  4KZQ A;  5C5R A;  4PNL A;  4OQA C;  4UW1 A;  2PAX A;  4L2F A;  4TOR A;  4W6E A;  5C5Q A;  5LYH A;  3C49 A;  4L0I A;  4TJW A;  4N3R A;  4BUD A;  4PNN A;  2PAW A;  2RD6 A;  4PNQ A;  4L33 A;  4L7P A;  4ZZX A;  4L0B A;  2RCW A;  4F1Q A;  1UK0 A;  4HHY A;  4PJT A;  5ETY A;  4K4F A;  4BU5 A;  3KR7 A;  4R6E A;  4MSG A;  4UI6 A;  5ECE A;  4LI6 A;  1UK1 A;  5AL1 A;  5EBT A;  3L3L A;  4PJV A;  5ADR A;  3FHB A;  4LI7 A;  2X5Y A;  4U6A A;  4DQY C;  3P0P A;  5AL2 A;  3CE0 A;  4J22 A;  4OQB C;  4GV0 A;  4BUE A;  4BUA A;  5LXP A;  4UI8 A;  4L7L A;  4TKG A;  3HKV A;  3P0N A;  4L7O A;  4BU7 A;  3GOY A;  4HYF A;  4UI4 A;  4BUF A;  4HLM A;  4UVL A;  3MHK A;  1GS0 A;  4UVO A;  3SMI A;  4L0S A;  4UVU A;  4UHG A;  4TKI A;  4MT9 A;  4L2G A;  4TKF A;  4J1Z A;  4L7R A;  4R5W A;  4L09 A;  4X52 A;  4BUX A;  4L34 A;  2PQF A;  4UI5 A;  3U9Y A;  4PY4 A;  4PML A;  4GV2 A;  4W5S A;  3W51 A;  3BLJ A;  3SE2 A;  3UDD A;  1WOK A;  4L2K A;  4IUE A;  4F0E A;  4KRS A;  5AKW A;  4UI7 A;  4M7B A;  4BU6 A;  4TK0 A;  5ADT A;  4W5I A;  4L31 A;  4HLG A;  1A26 A;  4KZU A;  4UVP A;  3UH4 A;  4AVW A;  3MHJ A;  4PNS A;  4PNR A;  4L6S A;  4UVN A;  3U9H A;  5AKU A;  4UI3 A;  4L70 A;  1PAX A;  4J3L A;  4F1L A;  4BJB A;  4TK5 A;  4UXB A;  4HLK A;  5DCZ A;  5AL3 A;  4ZZY A;  4HL5 A;  4BUW A;  5AL4 A;  4UUH A;  4UX4 A;  4XHU A;  4OPX C;  4BS4 A;  4OA7 A;  4UVZ A;  5LX6 A;  4BUU A;  4HMH A;  4L32 A;  5AL5 A;  3SMJ A;  4UND A;  4BJ9 A;  4PNT A;  4K4E A;  3C4H A;  3KCZ A; 
#chains in the Genus database with same CATH topology
 4RV6 A;  3P0Q A;  4UVV A;  4BU3 A;  4HKK A;  4L7N A;  4BJC A;  2QEW A;  4UVY A;  3PAX A;  4UVX A;  4L0T A;  4TOS A;  4HKI A;  4I9I A;  4L10 A;  4UFU A;  4BUV A;  4UVT A;  4HLF A;  2RKA A;  4BUI A;  3GEY A;  4MSK A;  1XKV A;  4BUS A;  3GN7 A;  5A00 A;  4UVS A;  4N4T A;  4DVI A;  4GV7 A;  3KJD A;  4PNM A;  3UA9 A;  4J21 A;  4BUT A;  2GMV A;  3UH2 A;  4PAX A;  1EFY A;  4BU9 A;  4AVU A;  4BU8 A;  4KZL A;  4GV4 A;  2RF5 A;  4J3M A;  4TJU A;  1KHG A;  2OLR A;  2PXZ X;  4YWD A;  5FPF A;  4L0V A;  2PC9 A;  4N4V A;  4HKN A;  4HLH A;  4BFP A;  5ADQ A;  4L7U A;  5ADS A;  4TJY A;  4HHZ A;  4L6Z A;  4GNM A;  5FPG A;  4ZZZ A;  4UFY A;  5C5P A;  4TVJ A;  3KR8 A;  4GNP A;  4BUY A;  4LI8 A;  3L3M A;  5AEH A;  3GJW A;  4UVW A;  1NHX A;  4KZQ A;  5C5R A;  1AQ2 A;  4PNL A;  4OQA C;  2FAH A;  4UW1 A;  2PAX A;  4L2F A;  4TOR A;  4W6E A;  5C5Q A;  5LYH A;  2FAF A;  3C49 A;  1YGG A;  4L0I A;  4TJW A;  4N3R A;  1OEN A;  4YW8 A;  4BUD A;  2QF1 A;  1AYL A;  4PNN A;  2PAW A;  1YTM A;  2RD6 A;  4L33 A;  4L7P A;  4PNQ A;  4WOU A;  4ZZX A;  4L0B A;  2RCW A;  4WPU A;  4F1Q A;  2QZY A;  1UK0 A;  2ZCI A;  4GMU A;  4HHY A;  4PJT A;  5ETY A;  4YWB A;  4K4F A;  4BU5 A;  3KR7 A;  4R6E A;  1YVY A;  2RKD A;  4MSG A;  5FH0 A;  4UI6 A;  5ECE A;  4LI6 A;  2RK8 A;  1UK1 A;  5AL1 A;  2OLQ A;  1KHB A;  3L3L A;  4PJV A;  5EBT A;  5ADR A;  3FHB A;  4LI7 A;  2X5Y A;  4U6A A;  4DQY C;  4OX2 A;  3P0P A;  5AL2 A;  3CE0 A;  4GNL A;  4J22 A;  4OQB C;  5FH2 A;  4GV0 A;  4BUE A;  4BUA A;  5LXP A;  4UI8 A;  4L7L A;  4TKG A;  3HKV A;  3P0N A;  4L7O A;  4BU7 A;  4RCG A;  3GOY A;  1J3B A;  3DT4 A;  5FH3 A;  3MOH A;  4HYF A;  4R43 A;  4UI4 A;  4BUF A;  4HLM A;  3DT7 A;  4UVL A;  4WL8 A;  3MHK A;  1GS0 A;  4UVO A;  3SMI A;  4L0S A;  4UVU A;  4UHG A;  4WIU A;  4TKI A;  4MT9 A;  4L2G A;  1M51 A;  4TKF A;  4J1Z A;  4L7R A;  4R5W A;  4L09 A;  4X52 A;  4BUX A;  4L34 A;  2PQF A;  1KHF A;  4UI5 A;  3U9Y A;  4PY4 A;  4PML A;  4GV2 A;  4W5S A;  5FH1 A;  3BLJ A;  3SE2 A;  4WIE A;  3UDD A;  3W51 A;  1WOK A;  4L2K A;  4GMZ A;  4IUE A;  4F0E A;  4KRS A;  5AKW A;  5FH5 A;  4UI7 A;  4M7B A;  3DTB A;  4BU6 A;  4TK0 A;  5ADT A;  4W5I A;  3DT2 A;  4L31 A;  4HLG A;  1A26 A;  4KZU A;  4GMM A;  4UVP A;  3UH4 A;  3MOE A;  1OS1 A;  3MHJ A;  4AVW A;  4PNS A;  4PNR A;  4YW9 A;  2RK7 A;  4L6S A;  4UVN A;  5FH4 A;  3U9H A;  5AKU A;  4UI3 A;  4L70 A;  1PAX A;  2QF2 A;  2PY7 X;  3MOF A;  4J3L A;  4F1L A;  2QEY A;  4WPT A;  5I67 A;  4BJB A;  4TK5 A;  4GNQ A;  1K3C A;  4UXB A;  4HLK A;  5DCZ A;  5AL3 A;  4ZZY A;  4HL5 A;  4WPV A;  4GNO A;  4BUW A;  5AL4 A;  1KHE A;  4UUH A;  4UX4 A;  4XHU A;  4OPX C;  1II2 A;  4BS4 A;  4OA7 A;  4UVZ A;  5LX6 A;  4BUU A;  4GMW A;  4HMH A;  4L32 A;  5AL5 A;  3SMJ A;  4UND A;  4BJ9 A;  1K3D A;  4PNT A;  1YLH A;  4K4E A;  2RKE A;  3C4H A;  3KCZ A; 
#chains in the Genus database with same CATH homology
 4RV6 A;  3P0Q A;  4UVV A;  4BU3 A;  4HKK A;  4L7N A;  4BJC A;  2QEW A;  4UVY A;  3PAX A;  4UVX A;  4L0T A;  4TOS A;  4HKI A;  4I9I A;  4L10 A;  4UFU A;  4BUV A;  4UVT A;  4HLF A;  2RKA A;  4BUI A;  3GEY A;  4MSK A;  1XKV A;  4BUS A;  3GN7 A;  5A00 A;  4UVS A;  4N4T A;  4DVI A;  4GV7 A;  3KJD A;  4PNM A;  3UA9 A;  4J21 A;  4BUT A;  2GMV A;  3UH2 A;  4PAX A;  1EFY A;  4BU9 A;  4AVU A;  4BU8 A;  4KZL A;  4GV4 A;  2RF5 A;  4J3M A;  4TJU A;  1KHG A;  2OLR A;  2PXZ X;  4YWD A;  5FPF A;  4L0V A;  2PC9 A;  4N4V A;  4HKN A;  4HLH A;  4BFP A;  5ADQ A;  4L7U A;  5ADS A;  4TJY A;  4HHZ A;  4L6Z A;  4GNM A;  5FPG A;  4ZZZ A;  4UFY A;  5C5P A;  4TVJ A;  3KR8 A;  4GNP A;  4BUY A;  4LI8 A;  3L3M A;  5AEH A;  3GJW A;  4UVW A;  1NHX A;  4KZQ A;  5C5R A;  1AQ2 A;  4PNL A;  4OQA C;  2FAH A;  4UW1 A;  2PAX A;  4L2F A;  4TOR A;  4W6E A;  5C5Q A;  5LYH A;  2FAF A;  3C49 A;  1YGG A;  4L0I A;  4TJW A;  4N3R A;  1OEN A;  4YW8 A;  4BUD A;  2QF1 A;  1AYL A;  4PNN A;  2PAW A;  1YTM A;  2RD6 A;  4L33 A;  4L7P A;  4PNQ A;  4WOU A;  4ZZX A;  4L0B A;  2RCW A;  4WPU A;  4F1Q A;  2QZY A;  1UK0 A;  2ZCI A;  4GMU A;  4HHY A;  4PJT A;  5ETY A;  4YWB A;  4K4F A;  4BU5 A;  3KR7 A;  4R6E A;  1YVY A;  2RKD A;  4MSG A;  5FH0 A;  4UI6 A;  5ECE A;  4LI6 A;  2RK8 A;  1UK1 A;  5AL1 A;  2OLQ A;  1KHB A;  3L3L A;  4PJV A;  5EBT A;  5ADR A;  3FHB A;  4LI7 A;  2X5Y A;  4U6A A;  4DQY C;  4OX2 A;  3P0P A;  5AL2 A;  3CE0 A;  4GNL A;  4J22 A;  4OQB C;  5FH2 A;  4GV0 A;  4BUE A;  4BUA A;  5LXP A;  4UI8 A;  4L7L A;  4TKG A;  3HKV A;  3P0N A;  4L7O A;  4BU7 A;  4RCG A;  3GOY A;  1J3B A;  3DT4 A;  5FH3 A;  3MOH A;  4HYF A;  4R43 A;  4UI4 A;  4BUF A;  4HLM A;  3DT7 A;  4UVL A;  4WL8 A;  3MHK A;  1GS0 A;  4UVO A;  3SMI A;  4L0S A;  4UVU A;  4UHG A;  4WIU A;  4TKI A;  4MT9 A;  4L2G A;  1M51 A;  4TKF A;  4J1Z A;  4L7R A;  4R5W A;  4L09 A;  4X52 A;  4BUX A;  4L34 A;  2PQF A;  1KHF A;  4UI5 A;  3U9Y A;  4PY4 A;  4PML A;  4GV2 A;  4W5S A;  5FH1 A;  3BLJ A;  3SE2 A;  4WIE A;  3UDD A;  3W51 A;  1WOK A;  4L2K A;  4GMZ A;  4IUE A;  4F0E A;  4KRS A;  5AKW A;  5FH5 A;  4UI7 A;  4M7B A;  3DTB A;  4BU6 A;  4TK0 A;  5ADT A;  4W5I A;  3DT2 A;  4L31 A;  4HLG A;  1A26 A;  4KZU A;  4GMM A;  4UVP A;  3UH4 A;  3MOE A;  1OS1 A;  3MHJ A;  4AVW A;  4PNS A;  4PNR A;  4YW9 A;  2RK7 A;  4L6S A;  4UVN A;  5FH4 A;  3U9H A;  5AKU A;  4UI3 A;  4L70 A;  1PAX A;  2QF2 A;  2PY7 X;  3MOF A;  4J3L A;  4F1L A;  2QEY A;  4WPT A;  5I67 A;  4BJB A;  4TK5 A;  4GNQ A;  1K3C A;  4UXB A;  4HLK A;  5DCZ A;  5AL3 A;  4ZZY A;  4HL5 A;  4WPV A;  4GNO A;  4BUW A;  5AL4 A;  1KHE A;  4UUH A;  4UX4 A;  4XHU A;  4OPX C;  1II2 A;  4BS4 A;  4OA7 A;  4UVZ A;  5LX6 A;  4BUU A;  4GMW A;  4HMH A;  4L32 A;  5AL5 A;  3SMJ A;  4UND A;  4BJ9 A;  1K3D A;  4PNT A;  1YLH A;  4K4E A;  2RKE A;  3C4H A;  3KCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...