The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
177
|
structure length |
177
|
Chain Sequence |
KRAPSYSNRGMTLEDDLNETNKYYLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQSSTTNYNGIYKGRYIDFEAKETKNKTSFPLQNFHDHQIEHMKQVKAQDGICFVIISAFDQVYFLEADKLFYFWDRKEKNGRKSIRKDELEETAYPISLGYAPRIDYISIIEQLYFS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural insights into dynamics of RecU-HJ complex formation elucidates key role of NTR and stalk region toward formation of reactive state.
pubmed doi rcsb |
| molecule keywords |
Holliday junction resolvase RecU
|
| molecule tags |
Hydrolase
|
| source organism |
Bacillus subtilis
|
| total genus |
41
|
| structure length |
177
|
| sequence length |
177
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
3.1.22.4: Crossover junction endodeoxyribonuclease. |
| pdb deposition date | 2015-12-16 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03838 | RecU | Recombination protein U |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Trna Endonuclease; Chain: A, domain 1 | Trna Endonuclease; Chain: A, domain 1 |
#chains in the Genus database with same CATH superfamily 1F1Z A; 2ZYZ A; 1OB8 A; 1XMX A; 3IEY A; 2WIZ A; 3FOV A; 1Y1O A; 1Y88 A; 1A79 A; 1IPI A; 3AJV B; 1ZP7 A; 2GJW A; 3AJV A; 2GW6 A; 2OST A; 4QBN A; 1OB9 A; 2VLD A; 2OKF A; 1T0F A; 2WCZ A; 3P1Z B; 2CV8 A; 2WCW A; 3P1Z A; 1RZN A; 4QBL A; 2INB A; 2FCO A; 4TKD A; 3P1Y A; 4TKK A; 2WJ0 A; 4QBO A; 3DNX A; 1GEF A; 1HH1 A; 1R11 A; 1RLV A; 1R0V A; 5FDK A; 2WIW A; 2EO0 A; 2ZYZ B; #chains in the Genus database with same CATH topology 1F1Z A; 2ZYZ A; 2FL3 A; 1OB8 A; 1XMX A; 3IEY A; 2WIZ A; 3FOV A; 1Y1O A; 1Y88 A; 3IF0 X; 1A79 A; 2Z0R A; 4DA2 A; 4E6Z A; 1IPI A; 3AJV B; 1ZP7 A; 2GJW A; 3AJV A; 4G6V A; 4LQE A; 2GW6 A; 2IXS A; 1YNM A; 2OST A; 2FKC A; 4QBN A; 1OB9 A; 2VLD A; 2OKF A; 1T0F A; 2VS1 A; 2WCZ A; 2CV8 A; 2JJQ A; 2WCW A; 1RZN A; 3P1Z B; 3P1Z A; 4QBL A; 2INB A; 2FCO A; 4DAP A; 4TKD A; 3P1Y A; 2DBS A; 3BT7 A; 4TKK A; 2FKH B; 2WJ0 A; 4QBO A; 3DNX A; 1GEF A; 1UWV A; 2FLC A; 1HH1 A; 2W8M A; 4ZQU A; 4DAV A; 1R11 A; 4EV1 A; 1RLV A; 1R0V A; 5FDK A; 4G6U A; 2WIW A; 2EO0 A; 2BH2 A; 2ZYZ B; 2CZR A; 3IEY B; #chains in the Genus database with same CATH homology 1F1Z A; 2ZYZ A; 2FL3 A; 1OB8 A; 1XMX A; 3IEY A; 2WIZ A; 3FOV A; 1Y1O A; 1Y88 A; 3IF0 X; 1A79 A; 2Z0R A; 4DA2 A; 4E6Z A; 1IPI A; 3AJV B; 1ZP7 A; 2GJW A; 3AJV A; 4G6V A; 4LQE A; 2GW6 A; 2IXS A; 1YNM A; 2OST A; 2FKC A; 4QBN A; 1OB9 A; 2VLD A; 2OKF A; 1T0F A; 2VS1 A; 2WCZ A; 2CV8 A; 2JJQ A; 2WCW A; 1RZN A; 3P1Z B; 3P1Z A; 4QBL A; 2INB A; 2FCO A; 4DAP A; 4TKD A; 3P1Y A; 2DBS A; 3BT7 A; 4TKK A; 2FKH B; 2WJ0 A; 4QBO A; 3DNX A; 1GEF A; 1UWV A; 2FLC A; 1HH1 A; 2W8M A; 4ZQU A; 4DAV A; 1R11 A; 4EV1 A; 1RLV A; 1R0V A; 5FDK A; 4G6U A; 2WIW A; 2EO0 A; 2BH2 A; 2ZYZ B; 2CZR A; 3IEY B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...