The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
41
|
sequence length |
177
|
structure length |
177
|
Chain Sequence |
KRAPSYSNRGMTLEDDLNETNKYYLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQSSTTNYNGIYKGRYIDFEAKETKNKTSFPLQNFHDHQIEHMKQVKAQDGICFVIISAFDQVYFLEADKLFYFWDRKEKNGRKSIRKDELEETAYPISLGYAPRIDYISIIEQLYFS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural insights into dynamics of RecU-HJ complex formation elucidates key role of NTR and stalk region toward formation of reactive state.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Bacillus subtilis
|
molecule keywords |
Holliday junction resolvase RecU
|
total genus |
41
|
structure length |
177
|
sequence length |
177
|
chains with identical sequence |
B, C, D
|
ec nomenclature |
ec
3.1.22.4: Crossover junction endodeoxyribonuclease. |
pdb deposition date | 2015-12-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03838 | RecU | Recombination protein U |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Trna Endonuclease; Chain: A, domain 1 | Trna Endonuclease; Chain: A, domain 1 |
#chains in the Genus database with same CATH superfamily 2OKF A; 2WJ0 A; 1A79 A; 2GW6 A; 1R11 A; 1T0F A; 3DNX A; 3P1Y A; 3AJV A; 3AJV B; 1XMX A; 2WCW A; 4QBO A; 2WIZ A; 1IPI A; 1GEF A; 2EO0 A; 2WIW A; 1RLV A; 1HH1 A; 2INB A; 2OST A; 1OB9 A; 2FCO A; 2CV8 A; 3FOV A; 1Y1O A; 4TKD A; 1R0V A; 1OB8 A; 3IEY A; 1F1Z A; 2GJW A; 1ZP7 A; 3P1Z A; 2VLD A; 4QBN A; 2WCZ A; 3P1Z B; 4TKK A; 1RZN A; 1Y88 A; 2ZYZ A; 4QBL A; 5FDK A; 2ZYZ B; #chains in the Genus database with same CATH topology 2OKF A; 2WJ0 A; 1A79 A; 2GW6 A; 1R11 A; 4G6U A; 1T0F A; 4ZQU A; 3DNX A; 3P1Y A; 4E6Z A; 3AJV A; 3AJV B; 1XMX A; 2WCW A; 4DAP A; 4QBO A; 2WIZ A; 1IPI A; 2BH2 A; 3BT7 A; 1GEF A; 2EO0 A; 2WIW A; 3IF0 X; 1RLV A; 1HH1 A; 2DBS A; 2INB A; 2OST A; 1OB9 A; 4EV1 A; 2FCO A; 2CV8 A; 3FOV A; 2FKH B; 1YNM A; 2JJQ A; 1Y1O A; 4TKD A; 1R0V A; 4DAV A; 2FL3 A; 2IXS A; 1OB8 A; 3IEY A; 2FLC A; 1F1Z A; 2GJW A; 1ZP7 A; 1UWV A; 3IEY B; 3P1Z A; 2Z0R A; 2CZR A; 4DA2 A; 2VLD A; 2FKC A; 4LQE A; 4QBN A; 4G6V A; 2WCZ A; 3P1Z B; 2VS1 A; 2W8M A; 4TKK A; 1RZN A; 1Y88 A; 2ZYZ A; 4QBL A; 5FDK A; 2ZYZ B; #chains in the Genus database with same CATH homology 2OKF A; 2WJ0 A; 1A79 A; 2GW6 A; 1R11 A; 4G6U A; 1T0F A; 4ZQU A; 3DNX A; 3P1Y A; 4E6Z A; 3AJV A; 3AJV B; 1XMX A; 2WCW A; 4DAP A; 4QBO A; 2WIZ A; 1IPI A; 2BH2 A; 3BT7 A; 1GEF A; 2EO0 A; 2WIW A; 3IF0 X; 1RLV A; 1HH1 A; 2DBS A; 2INB A; 2OST A; 1OB9 A; 4EV1 A; 2FCO A; 2CV8 A; 3FOV A; 2FKH B; 1YNM A; 2JJQ A; 1Y1O A; 4TKD A; 1R0V A; 4DAV A; 2FL3 A; 2IXS A; 1OB8 A; 3IEY A; 2FLC A; 1F1Z A; 2GJW A; 1ZP7 A; 1UWV A; 3IEY B; 3P1Z A; 2Z0R A; 2CZR A; 4DA2 A; 2VLD A; 2FKC A; 4LQE A; 4QBN A; 4G6V A; 2WCZ A; 3P1Z B; 2VS1 A; 2W8M A; 4TKK A; 1RZN A; 1Y88 A; 2ZYZ A; 4QBL A; 5FDK A; 2ZYZ B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...