5LYHA

Human parp14 (artd8), catalytic fragment in complex with inhibitor h10
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
190
structure length
185
Chain Sequence
MKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 14
publication title Small Molecule Microarray Based Discovery of PARP14 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 185
sequence length 190
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 5lyhA00
4TKFA 4HKKA 4UVSA 3CE0A 5AKUA 4UI3A 4UVLA 3U9YA 4OPXC 4PNNA 2PQFA 3SMIA 4BUFA 4K4EA 4UI4A 3U9HA 3L3LA 3MHJA 4GV4A 4UVWA 4HMHA 4ZZYA 1A26A 4PMLA 4HL5A 4TORA 2RCWA 4BU5A 4UFUA 4BU9A 4F1LA 4J1ZA 3P0PA 4GV7A 4PJTA 4L7OA 4L7UA 4UI7A 4IUEA 4TJUA 4U6AA 1GS0A 4L6ZA 3L3MA 3KJDA 4OQBC 4HKIA 4OQAC 3GOYA 4L0IA 4HHYA 4AVUA 5C5PA 4BUWA 4HHZA 4BUXA 1EFYA 4TKGA 5LYHA 4L0TA 4MSGA 4UVPA 1UK0A 4BUSA 4KRSA 4UI8A 4BUAA 4KZQA 5AEHA 4UW1A 5AL4A 1UK1A 3FHBA 4L6SA 4L7NA 5DCZA 4BU8A 4UVUA 3KR7A 4GV0A 4W5IA 4UHGA 3BLJA 4UUHA 4J21A 4L31A 4PNTA 4BU3A 5AKWA 4UVYA 4R5WA 2X5YA 4TVJA 4BU7A 4L2GA 4HKNA 4N4TA 5FPGA 4MT9A 4BUIA 4PNMA 5AL3A 4F0EA 4RV6A 4J22A 4L0VA 2RD6A 3KR8A 4XHUA 3PAXA 4L09A 3GJWA 4J3MA 4HLFA 5ADRA 4BS4A 5C5QA 4LI8A 4PJVA 3GN7A 4L7LA 4LI7A 5FPFA 4TK0A 4L10A 4DQYC 4W6EA 4BJ9A 1WOKA 5A00A 4TK5A 4I9IA 2PAWA 4AVWA 3MHKA 3P0QA 4BUTA 4L2FA 4HLHA 4BJBA 4PNRA 4F1QA 4HLMA 4KZLA 5EBTA 4UXBA 3P0NA 4TJWA 4KZUA 4HLGA 3W51A 5LX6A 4HLKA 5AL1A 4BFPA 4M7BA 4OA7A 4UX4A 4BU6A 3C49A 4L0BA 4PNLA 4ZZZA 3HKVA 4UI6A 4HYFA 4PY4A 4UI5A 4MSKA 4UVNA 4TJYA 5C5RA 4L7PA 4J3LA 3KCZA 5ECEA 5ETYA 4W5SA 4UVOA 4L70A 3SE2A 4R6EA 4UVVA 4BUYA 4UVXA 4UNDA 4GV2A 4PAXA 4UFYA 5ADTA 5AL2A 4L0SA 4BUUA 5ADQA 5AL5A 4L33A 4L34A 4TOSA 2RF5A 4BUVA 3UH4A 4L32A 3UA9A 4DVIA 4N3RA 4TKIA 4BUEA 4BJCA 1PAXA 4UVTA 4UVZA 4PNSA 3C4HA 4L2KA 4L7RA 4ZZXA 4LI6A 4PNQA 3SMJA 4K4FA 2PAXA 4BUDA 3UDDA 4N4VA 5ADSA 5LXPA 3UH2A 4X52A 3GEYA
chains in the Genus database with same CATH superfamily
4TKFA 4HKKA 2PY7X 4UVSA 3CE0A 5AKUA 4UI3A 4UVLA 3U9YA 4OPXC 4PNNA 2PQFA 3SMIA 1II2A 4BUFA 4K4EA 4OX2A 4UI4A 3L3LA 3MHJA 3U9HA 4GV4A 4WOUA 1K3DA 4UVWA 2RKAA 4HMHA 2QEWA 4ZZYA 1A26A 4PMLA 4HL5A 4TORA 2RCWA 4BU5A 4GMZA 4UFUA 4BU9A 4F1LA 1KHFA 4J1ZA 3P0PA 4GV7A 4DVIA 1YLHA 4PJTA 4L7OA 5FH0A 5FH1A 4L7UA 4UI7A 4IUEA 4GNPA 4TJUA 4WIEA 4U6AA 1GS0A 4L6ZA 3L3MA 3KJDA 4OQBC 4HKIA 4OQAC 3GOYA 4HHYA 3DT4A 4L0IA 4AVUA 5C5PA 4BUWA 4HHZA 4BUXA 1EFYA 4TKGA 5LYHA 4L0TA 4MSGA 1KHBA 4UVPA 1UK0A 4YWBA 4BUSA 4GMMA 2GMVA 2RKEA 4KRSA 4UI8A 1XKVA 4BUAA 2RK8A 4KZQA 5AEHA 4UW1A 5AL4A 1UK1A 3FHBA 4L6SA 4L7NA 5DCZA 4BU8A 2RK7A 4UVUA 3KR7A 4GV0A 4W5IA 4R43A 4UHGA 3BLJA 5FH5A 4UUHA 5C5RA 4J21A 4L31A 4PNTA 1OS1A 2PC9A 4BU3A 5AKWA 1AYLA 4UVYA 1KHGA 4R5WA 2X5YA 4TVJA 4BU7A 3MOHA 4L2GA 4HKNA 4N4TA 5FPGA 4RCGA 4MT9A 4BUIA 4PNMA 5AL3A 4F0EA 4RV6A 4WL8A 4J22A 2RD6A 1NHXA 4L0VA 3KR8A 4XHUA 3PAXA 4L09A 3MOEA 1AQ2A 1YGGA 3DT2A 3DTBA 3GJWA 4J3MA 4HLFA 4WPTA 4GMUA 2RKDA 5ADRA 5FH3A 4BS4A 5C5QA 4LI8A 4PJVA 3GN7A 4L7LA 4WIUA 4LI7A 5FPFA 4TK0A 4L10A 4DQYC 4W6EA 4YW9A 1WOKA 4BJ9A 5A00A 4TK5A 4I9IA 2PAWA 4AVWA 3MHKA 2QF1A 3P0QA 4BUTA 1M51A 5FH4A 4L2FA 3MOFA 4HLHA 4BJBA 4PNRA 4WPVA 4HLMA 4KZLA 5EBTA 4F1QA 2OLQA 4UXBA 4YWDA 3P0NA 4TJWA 4KZUA 4HLGA 3W51A 5LX6A 4HLKA 5AL1A 4BFPA 3DT7A 4M7BA 4OA7A 4UX4A 3C49A 4L0BA 4PNLA 4BU6A 3HKVA 2QF2A 4UI6A 4ZZZA 4HYFA 4PY4A 4YW8A 4UI5A 4MSKA 4UVNA 4TJYA 4GNMA 4GMWA 2ZCIA 2QZYA 4L7PA 3KCZA 4J3LA 5ECEA 5ETYA 1KHEA 4W5SA 4GNLA 4L70A 4UVOA 4WPUA 3SE2A 4R6EA 4UVVA 4BUYA 1J3BA 4UVXA 4UNDA 4GV2A 4PAXA 4UFYA 2FAFA 5ADTA 5AL2A 4L0SA 1K3CA 4BUUA 5ADQA 5AL5A 4L33A 4L34A 4TOSA 1YVYA 2RF5A 3UH4A 4L32A 3UA9A 4BUVA 4N3RA 4TKIA 4BUEA 2FAHA 4BJCA 1PAXA 1YTMA 4GNQA 4UVTA 4PNSA 4UVZA 3C4HA 4L2KA 4L7RA 5FH2A 2QEYA 4ZZXA 4LI6A 4PNQA 3SMJA 4K4FA 2PAXA 5I67A 4GNOA 2PXZX 3UDDA 4BUDA 1OENA 2OLRA 4N4VA 5ADSA 5LXPA 3UH2A 4X52A 3GEYA
chains in the Genus database with same CATH topology
4TKFA 4HKKA 2PY7X 4UVSA 3CE0A 5AKUA 4UI3A 4UVLA 3U9YA 4OPXC 4PNNA 2PQFA 3SMIA 1II2A 4BUFA 4K4EA 4OX2A 4UI4A 3L3LA 3MHJA 3U9HA 4GV4A 4WOUA 1K3DA 4UVWA 2RKAA 4HMHA 2QEWA 4ZZYA 1A26A 4PMLA 4HL5A 4TORA 2RCWA 4BU5A 4GMZA 4UFUA 4BU9A 4F1LA 1KHFA 4J1ZA 3P0PA 4GV7A 4DVIA 1YLHA 4PJTA 4L7OA 5FH0A 5FH1A 4L7UA 4UI7A 4IUEA 4GNPA 4TJUA 4WIEA 4U6AA 1GS0A 4L6ZA 3L3MA 3KJDA 4OQBC 4HKIA 4OQAC 3GOYA 4HHYA 3DT4A 4L0IA 4AVUA 5C5PA 4BUWA 4HHZA 4BUXA 1EFYA 4TKGA 5LYHA 4L0TA 4MSGA 1KHBA 4UVPA 1UK0A 4YWBA 4BUSA 4GMMA 2GMVA 2RKEA 4KRSA 4UI8A 1XKVA 4BUAA 2RK8A 4KZQA 5AEHA 4UW1A 5AL4A 1UK1A 3FHBA 4L6SA 4L7NA 5DCZA 4BU8A 2RK7A 4UVUA 3KR7A 4GV0A 4W5IA 4R43A 4UHGA 3BLJA 5FH5A 4UUHA 5C5RA 4J21A 4L31A 4PNTA 1OS1A 2PC9A 4BU3A 5AKWA 1AYLA 4UVYA 1KHGA 4R5WA 2X5YA 4TVJA 4BU7A 3MOHA 4L2GA 4HKNA 4N4TA 5FPGA 4RCGA 4MT9A 4BUIA 4PNMA 5AL3A 4F0EA 4RV6A 4WL8A 4J22A 2RD6A 1NHXA 4L0VA 3KR8A 4XHUA 3PAXA 4L09A 3MOEA 1AQ2A 1YGGA 3DT2A 3DTBA 3GJWA 4J3MA 4HLFA 4WPTA 4GMUA 2RKDA 5ADRA 5FH3A 4BS4A 5C5QA 4LI8A 4PJVA 3GN7A 4L7LA 4WIUA 4LI7A 5FPFA 4TK0A 4L10A 4DQYC 4W6EA 4YW9A 1WOKA 4BJ9A 5A00A 4TK5A 4I9IA 2PAWA 4AVWA 3MHKA 2QF1A 3P0QA 4BUTA 1M51A 5FH4A 4L2FA 3MOFA 4HLHA 4BJBA 4PNRA 4WPVA 4HLMA 4KZLA 5EBTA 4F1QA 2OLQA 4UXBA 4YWDA 3P0NA 4TJWA 4KZUA 4HLGA 3W51A 5LX6A 4HLKA 5AL1A 4BFPA 3DT7A 4M7BA 4OA7A 4UX4A 3C49A 4L0BA 4PNLA 4BU6A 3HKVA 2QF2A 4UI6A 4ZZZA 4HYFA 4PY4A 4YW8A 4UI5A 4MSKA 4UVNA 4TJYA 4GNMA 4GMWA 2ZCIA 2QZYA 4L7PA 3KCZA 4J3LA 5ECEA 5ETYA 1KHEA 4W5SA 4GNLA 4L70A 4UVOA 4WPUA 3SE2A 4R6EA 4UVVA 4BUYA 1J3BA 4UVXA 4UNDA 4GV2A 4PAXA 4UFYA 2FAFA 5ADTA 5AL2A 4L0SA 1K3CA 4BUUA 5ADQA 5AL5A 4L33A 4L34A 4TOSA 1YVYA 2RF5A 3UH4A 4L32A 3UA9A 4BUVA 4N3RA 4TKIA 4BUEA 2FAHA 4BJCA 1PAXA 1YTMA 4GNQA 4UVTA 4PNSA 4UVZA 3C4HA 4L2KA 4L7RA 5FH2A 2QEYA 4ZZXA 4LI6A 4PNQA 3SMJA 4K4FA 2PAXA 5I67A 4GNOA 2PXZX 3UDDA 4BUDA 1OENA 2OLRA 4N4VA 5ADSA 5LXPA 3UH2A 4X52A 3GEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKF A;  4HKK A;  4UVS A;  3CE0 A;  5AKU A;  4UI3 A;  4UVL A;  3U9Y A;  4OPX C;  4PNN A;  2PQF A;  3SMI A;  4BUF A;  4K4E A;  4UI4 A;  3U9H A;  3L3L A;  3MHJ A;  4GV4 A;  4UVW A;  4HMH A;  4ZZY A;  1A26 A;  4PML A;  4HL5 A;  4TOR A;  2RCW A;  4BU5 A;  4UFU A;  4BU9 A;  4F1L A;  4J1Z A;  3P0P A;  4GV7 A;  4PJT A;  4L7O A;  4L7U A;  4UI7 A;  4IUE A;  4TJU A;  4U6A A;  1GS0 A;  4L6Z A;  3L3M A;  3KJD A;  4OQB C;  4HKI A;  4OQA C;  3GOY A;  4L0I A;  4HHY A;  4AVU A;  5C5P A;  4BUW A;  4HHZ A;  4BUX A;  1EFY A;  4TKG A;  5LYH A;  4L0T A;  4MSG A;  4UVP A;  1UK0 A;  4BUS A;  4KRS A;  4UI8 A;  4BUA A;  4KZQ A;  5AEH A;  4UW1 A;  5AL4 A;  1UK1 A;  3FHB A;  4L6S A;  4L7N A;  5DCZ A;  4BU8 A;  4UVU A;  3KR7 A;  4GV0 A;  4W5I A;  4UHG A;  3BLJ A;  4UUH A;  4J21 A;  4L31 A;  4PNT A;  4BU3 A;  5AKW A;  4UVY A;  4R5W A;  2X5Y A;  4TVJ A;  4BU7 A;  4L2G A;  4HKN A;  4N4T A;  5FPG A;  4MT9 A;  4BUI A;  4PNM A;  5AL3 A;  4F0E A;  4RV6 A;  4J22 A;  4L0V A;  2RD6 A;  3KR8 A;  4XHU A;  3PAX A;  4L09 A;  3GJW A;  4J3M A;  4HLF A;  5ADR A;  4BS4 A;  5C5Q A;  4LI8 A;  4PJV A;  3GN7 A;  4L7L A;  4LI7 A;  5FPF A;  4TK0 A;  4L10 A;  4DQY C;  4W6E A;  4BJ9 A;  1WOK A;  5A00 A;  4TK5 A;  4I9I A;  2PAW A;  4AVW A;  3MHK A;  3P0Q A;  4BUT A;  4L2F A;  4HLH A;  4BJB A;  4PNR A;  4F1Q A;  4HLM A;  4KZL A;  5EBT A;  4UXB A;  3P0N A;  4TJW A;  4KZU A;  4HLG A;  3W51 A;  5LX6 A;  4HLK A;  5AL1 A;  4BFP A;  4M7B A;  4OA7 A;  4UX4 A;  4BU6 A;  3C49 A;  4L0B A;  4PNL A;  4ZZZ A;  3HKV A;  4UI6 A;  4HYF A;  4PY4 A;  4UI5 A;  4MSK A;  4UVN A;  4TJY A;  5C5R A;  4L7P A;  4J3L A;  3KCZ A;  5ECE A;  5ETY A;  4W5S A;  4UVO A;  4L70 A;  3SE2 A;  4R6E A;  4UVV A;  4BUY A;  4UVX A;  4UND A;  4GV2 A;  4PAX A;  4UFY A;  5ADT A;  5AL2 A;  4L0S A;  4BUU A;  5ADQ A;  5AL5 A;  4L33 A;  4L34 A;  4TOS A;  2RF5 A;  4BUV A;  3UH4 A;  4L32 A;  3UA9 A;  4DVI A;  4N3R A;  4TKI A;  4BUE A;  4BJC A;  1PAX A;  4UVT A;  4UVZ A;  4PNS A;  3C4H A;  4L2K A;  4L7R A;  4ZZX A;  4LI6 A;  4PNQ A;  3SMJ A;  4K4F A;  2PAX A;  4BUD A;  3UDD A;  4N4V A;  5ADS A;  5LXP A;  3UH2 A;  4X52 A;  3GEY A; 
#chains in the Genus database with same CATH topology
 4TKF A;  4HKK A;  2PY7 X;  4UVS A;  3CE0 A;  5AKU A;  4UI3 A;  4UVL A;  3U9Y A;  4OPX C;  4PNN A;  2PQF A;  3SMI A;  1II2 A;  4BUF A;  4K4E A;  4OX2 A;  4UI4 A;  3L3L A;  3MHJ A;  3U9H A;  4GV4 A;  4WOU A;  1K3D A;  4UVW A;  2RKA A;  4HMH A;  2QEW A;  4ZZY A;  1A26 A;  4PML A;  4HL5 A;  4TOR A;  2RCW A;  4BU5 A;  4GMZ A;  4UFU A;  4BU9 A;  4F1L A;  1KHF A;  4J1Z A;  3P0P A;  4GV7 A;  4DVI A;  1YLH A;  4PJT A;  4L7O A;  5FH0 A;  5FH1 A;  4L7U A;  4UI7 A;  4IUE A;  4GNP A;  4TJU A;  4WIE A;  4U6A A;  1GS0 A;  4L6Z A;  3L3M A;  3KJD A;  4OQB C;  4HKI A;  4OQA C;  3GOY A;  4HHY A;  3DT4 A;  4L0I A;  4AVU A;  5C5P A;  4BUW A;  4HHZ A;  4BUX A;  1EFY A;  4TKG A;  5LYH A;  4L0T A;  4MSG A;  1KHB A;  4UVP A;  1UK0 A;  4YWB A;  4BUS A;  4GMM A;  2GMV A;  2RKE A;  4KRS A;  4UI8 A;  1XKV A;  4BUA A;  2RK8 A;  4KZQ A;  5AEH A;  4UW1 A;  5AL4 A;  1UK1 A;  3FHB A;  4L6S A;  4L7N A;  5DCZ A;  4BU8 A;  2RK7 A;  4UVU A;  3KR7 A;  4GV0 A;  4W5I A;  4R43 A;  4UHG A;  3BLJ A;  5FH5 A;  4UUH A;  5C5R A;  4J21 A;  4L31 A;  4PNT A;  1OS1 A;  2PC9 A;  4BU3 A;  5AKW A;  1AYL A;  4UVY A;  1KHG A;  4R5W A;  2X5Y A;  4TVJ A;  4BU7 A;  3MOH A;  4L2G A;  4HKN A;  4N4T A;  5FPG A;  4RCG A;  4MT9 A;  4BUI A;  4PNM A;  5AL3 A;  4F0E A;  4RV6 A;  4WL8 A;  4J22 A;  2RD6 A;  1NHX A;  4L0V A;  3KR8 A;  4XHU A;  3PAX A;  4L09 A;  3MOE A;  1AQ2 A;  1YGG A;  3DT2 A;  3DTB A;  3GJW A;  4J3M A;  4HLF A;  4WPT A;  4GMU A;  2RKD A;  5ADR A;  5FH3 A;  4BS4 A;  5C5Q A;  4LI8 A;  4PJV A;  3GN7 A;  4L7L A;  4WIU A;  4LI7 A;  5FPF A;  4TK0 A;  4L10 A;  4DQY C;  4W6E A;  4YW9 A;  1WOK A;  4BJ9 A;  5A00 A;  4TK5 A;  4I9I A;  2PAW A;  4AVW A;  3MHK A;  2QF1 A;  3P0Q A;  4BUT A;  1M51 A;  5FH4 A;  4L2F A;  3MOF A;  4HLH A;  4BJB A;  4PNR A;  4WPV A;  4HLM A;  4KZL A;  5EBT A;  4F1Q A;  2OLQ A;  4UXB A;  4YWD A;  3P0N A;  4TJW A;  4KZU A;  4HLG A;  3W51 A;  5LX6 A;  4HLK A;  5AL1 A;  4BFP A;  3DT7 A;  4M7B A;  4OA7 A;  4UX4 A;  3C49 A;  4L0B A;  4PNL A;  4BU6 A;  3HKV A;  2QF2 A;  4UI6 A;  4ZZZ A;  4HYF A;  4PY4 A;  4YW8 A;  4UI5 A;  4MSK A;  4UVN A;  4TJY A;  4GNM A;  4GMW A;  2ZCI A;  2QZY A;  4L7P A;  3KCZ A;  4J3L A;  5ECE A;  5ETY A;  1KHE A;  4W5S A;  4GNL A;  4L70 A;  4UVO A;  4WPU A;  3SE2 A;  4R6E A;  4UVV A;  4BUY A;  1J3B A;  4UVX A;  4UND A;  4GV2 A;  4PAX A;  4UFY A;  2FAF A;  5ADT A;  5AL2 A;  4L0S A;  1K3C A;  4BUU A;  5ADQ A;  5AL5 A;  4L33 A;  4L34 A;  4TOS A;  1YVY A;  2RF5 A;  3UH4 A;  4L32 A;  3UA9 A;  4BUV A;  4N3R A;  4TKI A;  4BUE A;  2FAH A;  4BJC A;  1PAX A;  1YTM A;  4GNQ A;  4UVT A;  4PNS A;  4UVZ A;  3C4H A;  4L2K A;  4L7R A;  5FH2 A;  2QEY A;  4ZZX A;  4LI6 A;  4PNQ A;  3SMJ A;  4K4F A;  2PAX A;  5I67 A;  4GNO A;  2PXZ X;  3UDD A;  4BUD A;  1OEN A;  2OLR A;  4N4V A;  5ADS A;  5LXP A;  3UH2 A;  4X52 A;  3GEY A; 
#chains in the Genus database with same CATH homology
 4TKF A;  4HKK A;  2PY7 X;  4UVS A;  3CE0 A;  5AKU A;  4UI3 A;  4UVL A;  3U9Y A;  4OPX C;  4PNN A;  2PQF A;  3SMI A;  1II2 A;  4BUF A;  4K4E A;  4OX2 A;  4UI4 A;  3L3L A;  3MHJ A;  3U9H A;  4GV4 A;  4WOU A;  1K3D A;  4UVW A;  2RKA A;  4HMH A;  2QEW A;  4ZZY A;  1A26 A;  4PML A;  4HL5 A;  4TOR A;  2RCW A;  4BU5 A;  4GMZ A;  4UFU A;  4BU9 A;  4F1L A;  1KHF A;  4J1Z A;  3P0P A;  4GV7 A;  4DVI A;  1YLH A;  4PJT A;  4L7O A;  5FH0 A;  5FH1 A;  4L7U A;  4UI7 A;  4IUE A;  4GNP A;  4TJU A;  4WIE A;  4U6A A;  1GS0 A;  4L6Z A;  3L3M A;  3KJD A;  4OQB C;  4HKI A;  4OQA C;  3GOY A;  4HHY A;  3DT4 A;  4L0I A;  4AVU A;  5C5P A;  4BUW A;  4HHZ A;  4BUX A;  1EFY A;  4TKG A;  5LYH A;  4L0T A;  4MSG A;  1KHB A;  4UVP A;  1UK0 A;  4YWB A;  4BUS A;  4GMM A;  2GMV A;  2RKE A;  4KRS A;  4UI8 A;  1XKV A;  4BUA A;  2RK8 A;  4KZQ A;  5AEH A;  4UW1 A;  5AL4 A;  1UK1 A;  3FHB A;  4L6S A;  4L7N A;  5DCZ A;  4BU8 A;  2RK7 A;  4UVU A;  3KR7 A;  4GV0 A;  4W5I A;  4R43 A;  4UHG A;  3BLJ A;  5FH5 A;  4UUH A;  5C5R A;  4J21 A;  4L31 A;  4PNT A;  1OS1 A;  2PC9 A;  4BU3 A;  5AKW A;  1AYL A;  4UVY A;  1KHG A;  4R5W A;  2X5Y A;  4TVJ A;  4BU7 A;  3MOH A;  4L2G A;  4HKN A;  4N4T A;  5FPG A;  4RCG A;  4MT9 A;  4BUI A;  4PNM A;  5AL3 A;  4F0E A;  4RV6 A;  4WL8 A;  4J22 A;  2RD6 A;  1NHX A;  4L0V A;  3KR8 A;  4XHU A;  3PAX A;  4L09 A;  3MOE A;  1AQ2 A;  1YGG A;  3DT2 A;  3DTB A;  3GJW A;  4J3M A;  4HLF A;  4WPT A;  4GMU A;  2RKD A;  5ADR A;  5FH3 A;  4BS4 A;  5C5Q A;  4LI8 A;  4PJV A;  3GN7 A;  4L7L A;  4WIU A;  4LI7 A;  5FPF A;  4TK0 A;  4L10 A;  4DQY C;  4W6E A;  4YW9 A;  1WOK A;  4BJ9 A;  5A00 A;  4TK5 A;  4I9I A;  2PAW A;  4AVW A;  3MHK A;  2QF1 A;  3P0Q A;  4BUT A;  1M51 A;  5FH4 A;  4L2F A;  3MOF A;  4HLH A;  4BJB A;  4PNR A;  4WPV A;  4HLM A;  4KZL A;  5EBT A;  4F1Q A;  2OLQ A;  4UXB A;  4YWD A;  3P0N A;  4TJW A;  4KZU A;  4HLG A;  3W51 A;  5LX6 A;  4HLK A;  5AL1 A;  4BFP A;  3DT7 A;  4M7B A;  4OA7 A;  4UX4 A;  3C49 A;  4L0B A;  4PNL A;  4BU6 A;  3HKV A;  2QF2 A;  4UI6 A;  4ZZZ A;  4HYF A;  4PY4 A;  4YW8 A;  4UI5 A;  4MSK A;  4UVN A;  4TJY A;  4GNM A;  4GMW A;  2ZCI A;  2QZY A;  4L7P A;  3KCZ A;  4J3L A;  5ECE A;  5ETY A;  1KHE A;  4W5S A;  4GNL A;  4L70 A;  4UVO A;  4WPU A;  3SE2 A;  4R6E A;  4UVV A;  4BUY A;  1J3B A;  4UVX A;  4UND A;  4GV2 A;  4PAX A;  4UFY A;  2FAF A;  5ADT A;  5AL2 A;  4L0S A;  1K3C A;  4BUU A;  5ADQ A;  5AL5 A;  4L33 A;  4L34 A;  4TOS A;  1YVY A;  2RF5 A;  3UH4 A;  4L32 A;  3UA9 A;  4BUV A;  4N3R A;  4TKI A;  4BUE A;  2FAH A;  4BJC A;  1PAX A;  1YTM A;  4GNQ A;  4UVT A;  4PNS A;  4UVZ A;  3C4H A;  4L2K A;  4L7R A;  5FH2 A;  2QEY A;  4ZZX A;  4LI6 A;  4PNQ A;  3SMJ A;  4K4F A;  2PAX A;  5I67 A;  4GNO A;  2PXZ X;  3UDD A;  4BUD A;  1OEN A;  2OLR A;  4N4V A;  5ADS A;  5LXP A;  3UH2 A;  4X52 A;  3GEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...