The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
94
|
structure length |
94
|
Chain Sequence |
DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSETL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The origin of differences in the physical properties of the equilibrium forms of cytochrome b5 revealed through high-resolution NMR structures and backbone dynamic analyses.
pubmed doi rcsb |
| molecule tags |
Electron transport
|
| source organism |
Rattus norvegicus
|
| molecule keywords |
FERROCYTOCHROME B5
|
| total genus |
17
|
| structure length |
94
|
| sequence length |
94
|
| ec nomenclature | |
| pdb deposition date | 1998-04-06 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00173 | Cyt-b5 | Cytochrome b5-like Heme/Steroid binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Flavocytochrome B2; Chain A, domain 1 | Cytochrome b5-like heme/steroid binding domain |
#chains in the Genus database with same CATH superfamily 1B5A A; 1T0G A; 1HKO A; 2I96 A; 1BFX A; 1M59 A; 1ICC A; 1U9M A; 1MJ4 A; 1I87 A; 1LDC A; 1LJ0 A; 1B5M A; 1EUE A; 1J0Q A; 1AXX A; 2IBJ A; 1F04 A; 1FCB A; 2OZ0 A; 1BLV A; 4X8Y A; 1AW3 A; 2KEO A; 1F03 A; 1M20 A; 1IEU A; 1ES1 A; 1KBI A; 1JEX A; 3X35 A; 1CYO A; 1X3X A; 1M2I A; 1NX7 A; 3LF5 A; 4HIN A; 3NER A; 3X32 A; 2M33 A; 1I5U A; 1B5B A; 1EHB A; 1SH4 A; 1M2M A; 4B8N A; 1AWP A; 1I8C A; 1IET A; 1U9U A; 1MNY A; 3OZZ B; 1LR6 A; 1DO9 A; 1SOX A; 4HIL A; 1IB7 A; 1LTD A; 1AQA A; 1CXY A; 1LCO A; 3X34 A; 3X33 A; 2I89 A; 3MUS A; 2AXX A; 3KS0 A; 1J03 A; 1LQX A; #chains in the Genus database with same CATH topology 1B5A A; 1T0G A; 1HKO A; 2I96 A; 1BFX A; 1M59 A; 1ICC A; 1U9M A; 1MJ4 A; 1I87 A; 1LDC A; 1LJ0 A; 1B5M A; 1EUE A; 1J0Q A; 1AXX A; 2IBJ A; 1F04 A; 1FCB A; 2OZ0 A; 1BLV A; 4X8Y A; 1AW3 A; 2KEO A; 1F03 A; 1M20 A; 1IEU A; 1ES1 A; 1KBI A; 1JEX A; 3X35 A; 1CYO A; 1X3X A; 1M2I A; 1NX7 A; 3LF5 A; 4HIN A; 3NER A; 3X32 A; 2M33 A; 1I5U A; 1B5B A; 1EHB A; 1SH4 A; 1M2M A; 4B8N A; 1AWP A; 1I8C A; 1IET A; 1U9U A; 1MNY A; 3OZZ B; 1LR6 A; 1DO9 A; 1SOX A; 4HIL A; 1IB7 A; 1LTD A; 1AQA A; 1CXY A; 1LCO A; 3X34 A; 3X33 A; 2I89 A; 3MUS A; 2AXX A; 3KS0 A; 1J03 A; 1LQX A; #chains in the Genus database with same CATH homology 1B5A A; 1T0G A; 1HKO A; 2I96 A; 1BFX A; 1M59 A; 1ICC A; 1U9M A; 1MJ4 A; 1I87 A; 1LDC A; 1LJ0 A; 1B5M A; 1EUE A; 1J0Q A; 1AXX A; 2IBJ A; 1F04 A; 1FCB A; 2OZ0 A; 1BLV A; 4X8Y A; 1AW3 A; 2KEO A; 1F03 A; 1M20 A; 1IEU A; 1ES1 A; 1KBI A; 1JEX A; 3X35 A; 1CYO A; 1X3X A; 1M2I A; 1NX7 A; 3LF5 A; 4HIN A; 3NER A; 3X32 A; 2M33 A; 1I5U A; 1B5B A; 1EHB A; 1SH4 A; 1M2M A; 4B8N A; 1AWP A; 1I8C A; 1IET A; 1U9U A; 1MNY A; 3OZZ B; 1LR6 A; 1DO9 A; 1SOX A; 4HIL A; 1IB7 A; 1LTD A; 1AQA A; 1CXY A; 1LCO A; 3X34 A; 3X33 A; 2I89 A; 3MUS A; 2AXX A; 3KS0 A; 1J03 A; 1LQX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
