The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
25
|
sequence length |
82
|
structure length |
82
|
Chain Sequence |
AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEHLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPDDR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The comparative study on the solution structures of the oxidized bovine microsomal cytochrome b5 and mutant V45H
pubmed doi rcsb |
| molecule tags |
Electron transport
|
| source organism |
Bos taurus
|
| molecule keywords |
Cytochrome b5
|
| total genus |
25
|
| structure length |
82
|
| sequence length |
82
|
| ec nomenclature | |
| pdb deposition date | 2004-02-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00173 | Cyt-b5 | Cytochrome b5-like Heme/Steroid binding domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Flavocytochrome B2; Chain A, domain 1 | Cytochrome b5-like heme/steroid binding domain |
#chains in the Genus database with same CATH superfamily 3X35 A; 1U9M A; 1BFX A; 1AXX A; 1FCB A; 1AW3 A; 1LCO A; 1B5A A; 3LF5 A; 1MJ4 A; 1JEX A; 1U9U A; 1J03 A; 1NX7 A; 1BLV A; 2OZ0 A; 1SH4 A; 2KEO A; 3MUS A; 1F04 A; 2I89 A; 1LTD A; 2I96 A; 1IET A; 1M20 A; 1I87 A; 1CXY A; 1IB7 A; 1LR6 A; 2IBJ A; 1I5U A; 1SOX A; 3NER A; 2AXX A; 3X32 A; 1B5M A; 1B5B A; 1LJ0 A; 1MNY A; 1M2M A; 1ICC A; 1F03 A; 1DO9 A; 3X34 A; 1AWP A; 2M33 A; 4B8N A; 1HKO A; 1EHB A; 3KS0 A; 4HIN A; 1I8C A; 1T0G A; 1LDC A; 4HIL A; 1J0Q A; 3OZZ B; 1ES1 A; 1KBI A; 4X8Y A; 1EUE A; 1LQX A; 3X33 A; 1CYO A; 1IEU A; 1M59 A; 1X3X A; 1M2I A; 1AQA A; #chains in the Genus database with same CATH topology 3X35 A; 1U9M A; 1BFX A; 1AXX A; 1FCB A; 1AW3 A; 1LCO A; 1B5A A; 3LF5 A; 1MJ4 A; 1JEX A; 1U9U A; 1J03 A; 1NX7 A; 1BLV A; 2OZ0 A; 1SH4 A; 2KEO A; 3MUS A; 1F04 A; 2I89 A; 1LTD A; 2I96 A; 1IET A; 1M20 A; 1I87 A; 1CXY A; 1IB7 A; 1LR6 A; 2IBJ A; 1I5U A; 1SOX A; 3NER A; 2AXX A; 3X32 A; 1B5M A; 1B5B A; 1LJ0 A; 1MNY A; 1M2M A; 1ICC A; 1F03 A; 1DO9 A; 3X34 A; 1AWP A; 2M33 A; 4B8N A; 1HKO A; 1EHB A; 3KS0 A; 4HIN A; 1I8C A; 1T0G A; 1LDC A; 4HIL A; 1J0Q A; 3OZZ B; 1ES1 A; 1KBI A; 4X8Y A; 1EUE A; 1LQX A; 3X33 A; 1CYO A; 1IEU A; 1M59 A; 1X3X A; 1M2I A; 1AQA A; #chains in the Genus database with same CATH homology 3X35 A; 1U9M A; 1BFX A; 1AXX A; 1FCB A; 1AW3 A; 1LCO A; 1B5A A; 3LF5 A; 1MJ4 A; 1JEX A; 1U9U A; 1J03 A; 1NX7 A; 1BLV A; 2OZ0 A; 1SH4 A; 2KEO A; 3MUS A; 1F04 A; 2I89 A; 1LTD A; 2I96 A; 1IET A; 1M20 A; 1I87 A; 1CXY A; 1IB7 A; 1LR6 A; 2IBJ A; 1I5U A; 1SOX A; 3NER A; 2AXX A; 3X32 A; 1B5M A; 1B5B A; 1LJ0 A; 1MNY A; 1M2M A; 1ICC A; 1F03 A; 1DO9 A; 3X34 A; 1AWP A; 2M33 A; 4B8N A; 1HKO A; 1EHB A; 3KS0 A; 4HIN A; 1I8C A; 1T0G A; 1LDC A; 4HIL A; 1J0Q A; 3OZZ B; 1ES1 A; 1KBI A; 4X8Y A; 1EUE A; 1LQX A; 3X33 A; 1CYO A; 1IEU A; 1M59 A; 1X3X A; 1M2I A; 1AQA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
