1TRLA

Nmr solution structure of the c-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
b'VVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THERMOLYSIN FRAGMENT 255 - 316
publication title NMR solution structure of the C-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure.
pubmed doi rcsb
source organism Bacillus thermoproteolyticus
molecule tags Hydrolase (metalloprotease)
total genus 24
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature ec 3.4.24.27: Thermolysin.
pdb deposition date 1994-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 1trlA00
5AENA 4MXJE 3TLIA 3LS7A 3B7RL 3T2IE 2TMNE 4XNBA 4ZW8A 5TLIA 4ZW6A 3P7RE 4K89A 4OW3A 4MTWE 4XMZA 6TMNE 1TRLA 8TLIA 5DPFE 3FTWA 4R7LA 2TLXA 3FHEA 5FSJA 1SQMA 1KKKA 3NN7A 1FJWA 1ESPA 3FU5A 4N5PE 5LWDE 4K5NA 4XMTA 3U9WA 4K5MA 1KL6A 4ZW7A 3P7QE 4XN1A 1KEIA 3FUEA 4XMUA 4Q4IA 4XN2A 5L8PE 4XMVA 1LNBE 4N66E 3B7TA 3FTUA 1LNFE 3PUUA 3FUMA 4TNLA 3QGOA 3P7VE 4R5XA 5BPPA 2XQ0A 5TLNA 3FXPA 1QF2A 1FJ3A 3B34A 1FJUA 1U4GA 4H57A 3P7WE 1OS0A 5K7TA 4MWPE 2ZXGA 5FSSA 3FUIA 3T73A 3T8DA 5JVIE 5L3UE 1TLIA 4ZX5A 3FH7A 4XO3A 5DYFA 5L41E 1THLA 3FTVA 4XN9A 4D9WA 2DQ6A 1FJOA 5FWQA 1LNCE 1LNDE 4XNAA 4TMNE 1H19A 1Y3GE 4TLNA 1PE7A 4X2UA 4PU2A 4XN4A 3DO0A 4ZX3A 5DLLA 4QMEA 3CIAA 2WHZA 1PE5A 3KEDA 4MZNE 3EBIA 4MS6A 4XNDA 3FUDA 3CHQA 2XPZA 3CHOA 4QIRA 4XN7A 4XN8A 5DPEE 3FLFA 3T8FA 1KROA 1GXWA 3F28A 4RSYA 3CHPA 1QF1A 4ZW3A 4ZX4A 5HQDA 1NPCA 3MS3A 3MSAA 3FTYA 3P7TE 4QUOA 4XMWA 2DQMA 1KS7A 1BQBA 5JS3E 4K5PA 3FH8A 1FJVA 3FUHA 3B2PA 3EBGA 3FVPA 4TLIA 4GERA 1HS6A 4R5VA 1ZDPE 3T74A 3T8GA 1KJOA 2TLIA 1KTOA 1QF0A 3EIMA 4R5TA 4L2LA 3EBHA 5FSPA 3CHSA 3FU0A 3P7PE 5JXNE 3FORA 4XMXA 2WI0A 3FH5A 4XO4A 2GTQA 3DBKA 3DO2A 3F2PA 3FTSA 3FXSA 5A3YA 2HPTA 4K5LA 4ZW5A 1HYTA 3FUNA 4MKTA 7TLIA 3QJXA 6TLIA 3NQXA 2R59A 5JT9E 4ZQTA 2VJ8A 1LNAE 1Z9GE 4QPEA 3FGDA 1KJPA 4N4EE 2G4ZA 3MSFA 3T2HE 3T2JE 5JSSE 3QH1A 3FUKA 4ZX6A 3B3BA 5DLHA 5TMNE 4DPRA 3DO1A 1KR6A 3T8HA 1TLXA 4RVBA 3FTZA 3T87A 4PVBA 3ZI6A 3FV4A 3CHRA 3FULA 4GAAA 4XN5A 3SSBA 1TMNE 3FCQA 4OI5E 3NQZB 4K5OA 1LNEE 3T8VA 8TLNE 2A7GE 3B2XA 4K90A 3Q43A 3T8CA 3QH5A 7TLNA 3FUJA 5LIFE 1EZMA 3FBOA 3FU3A 4M65A 3B37A 1FJQA 3FTXA 5FXNA 2HPOA 3P7UE 4J3BA 4PW4A 1L3FE 4B52A 3DNZA 3B7SA 3NQYB 4QHPA 3B7UX 1PE8A 4Q4EA 3Q44A 3P7SE 1TLPE 3TMNE 1FJTA 4D91A 3FUFA 3N21A 3FU6A 2XPYA 2VQXA 3MSNA 1GW6A 3FB0A 4XO5A
chains in the Genus database with same CATH superfamily
4HOMA 4ZW8A 5TLIA 4K89A 4OW3A 4MTWE 4F5CA 6TMNE 3FTWA 2TLXA 3NN7A 1FJWA 5LWDE 3P7QE 4Q4IA 1Z1WA 1LNBE 3QGOA 4R5XA 5TLNA 1FJUA 1OS0A 4MWPE 3T73A 3FUIA 5LHDA 4XO3A 1THLA 3FTVA 1LNDE 4TLNA 4PU2A 5DLLA 4OU3A 1PE5A 3EBIA 4FGMA 3FUDA 2XPZA 3CHOA 4XN8A 5JS3E 2DQMA 1BQBA 1HS6A 4R5VA 4FYRA 4AR8A 4L2LA 3CHSA 2GTQA 3DBKA 5AB2A 4K5LA 2R59A 4QPEA 3T2HE 4AR1A 3T2JE 3QH1A 5DLHA 4RVBA 3FTZA 4KXAA 1TMNE 3FCQA 1LNEE 3SE6A 2YD0A 3FUJA 3FBOA 3B37A 1FJQA 3FTXA 5FXNA 3P7UE 3DNZA 3B7SA 1PE8A 3TMNE 3N21A 3FU6A 2XPYA 2VQXA 5AENA 4MXJE 3TLIA 3B7RL 4ZW6A 5DPFE 4N5PE 4K5NA 4XMTA 4K5MA 3MDJA 4XN1A 3FUEA 4XMUA 5L8PE 3PUUA 3FUMA 3P7VE 5LDSA 5BPPA 3FXPA 3B34A 3P7WE 5K7TA 4NZ8A 2ZXGA 4FYSA 5FSSA 3T8DA 5JVIE 1TLIA 4XN9A 1FJOA 5FWQA 4TMNE 4X2UA 4FYQA 3DO0A 4PJ6A 3CIAA 4MZNE 4MS6A 3FLFA 4FYTA 4WZ9A 4ZX4A 1QF1A 3FTYA 4XMWA 4K5PA 1FJVA 3B2PA 4GERA 4R5TA 5JXNE 3P7PE 3DO2A 3FTSA 3FXSA 4ZW5A 1HYTA 3FUNA 4MKTA 6TLIA 3NQXA 1LNAE 1Z9GE 1KJPA 4N4EE 4ZX6A 5TMNE 4DPRA 4E36A 4PVBA 3FV4A 3FULA 4IHQA 4NAQA 3T8CA 3Q43A 3QH5A 2HPOA 1L3FE 4KX7A 3NQYB 3B7UX 4D91A 3Q44A 1TLPE 3FB0A 4XO5A 2TMNE 4KX9A 4XNBA 5FSJA 1ESPA 3U9WA 1KL6A 4XN2A 4N66E 3B7TA 2XQ0A 5L3UE 4ZX5A 4Z7IA 5DYFA 5L41E 5LG6A 2DQ6A 1LNCE 1H19A 1Y3GE 1PE7A 4XN4A 5K1VA 3KEDA 4XN7A 1GXWA 4KXDA 4II7A 4RSYA 1NPCA 3MSAA 4QUOA 4FKEA 3EBGA 4KXBA 3FVPA 4TLIA 3T8GA 1ZDPE 3T74A 1KJOA 3EIMA 1QF0A 3EBHA 3FORA 2WI0A 3Q7JA 4XO4A 5A3YA 2HPTA 5EV7A 3QJXA 5JT9E 4ZQTA 2VJ8A 3MSFA 5J6SA 3T87A 3ZI6A 3CHRA 3SSBA 1Z5HA 3NQZB 5CU5A 7TLNA 1EZMA 3QNFA 4J3BA 4FCAA 4B52A 4QHPA 3P7SE 3MSNA 1GW6A 4P8QA 3LS7A 4ARFA 3T2IE 3P7RE 4XMZA 1TRLA 8TLIA 4R7LA 3FHEA 1SQMA 1KKKA 3FU5A 4ZW7A 1KEIA 4XMVA 3FTUA 1LNFE 4TNLA 1QF2A 1FJ3A 4H57A 1U4GA 3FH7A 4D9WA 4XNAA 4ZX3A 4QMEA 2WHZA 4XNDA 3CHQA 4QIRA 5C97A 5DPEE 3T8FA 1KROA 3F28A 3CHPA 4ZW3A 5HQDA 3MS3A 3P7TE 1KS7A 3FH8A 5AB0A 3FUHA 4KXCA 2TLIA 1KTOA 5FSPA 3FU0A 4XMXA 3FH5A 3F2PA 4FKKA 7TLIA 3FGDA 4FKHA 4JBSA 2G4ZA 5JSSE 4KX8A 3FUKA 3B3BA 3DO1A 1KR6A 3T8HA 1TLXA 4GAAA 4XN5A 4OI5E 4K5OA 3T8VA 8TLNE 2A7GE 3B2XA 4K90A 5LIFE 4AR9A 3FU3A 4M65A 4PW4A 4Q4EA 1FJTA 3FUFA
chains in the Genus database with same CATH topology
5AENA 4MXJE 3TLIA 3LS7A 3B7RL 3T2IE 2TMNE 4XNBA 4ZW8A 5TLIA 4ZW6A 3P7RE 4K89A 4OW3A 4MTWE 4XMZA 6TMNE 1TRLA 8TLIA 5DPFE 3FTWA 4R7LA 2TLXA 3FHEA 5FSJA 1SQMA 1KKKA 3NN7A 1FJWA 1ESPA 3FU5A 4N5PE 5LWDE 4K5NA 4XMTA 3U9WA 4K5MA 1KL6A 4ZW7A 3P7QE 4XN1A 1KEIA 3FUEA 4XMUA 4Q4IA 4XN2A 5L8PE 4XMVA 1LNBE 4N66E 3B7TA 3FTUA 1LNFE 3PUUA 3FUMA 4TNLA 3QGOA 3P7VE 4R5XA 5BPPA 2XQ0A 5TLNA 3FXPA 1QF2A 1FJ3A 3B34A 1FJUA 1U4GA 4H57A 3P7WE 1OS0A 5K7TA 4MWPE 2ZXGA 5FSSA 3FUIA 3T73A 3T8DA 5JVIE 5L3UE 1TLIA 4ZX5A 3FH7A 4XO3A 5DYFA 5L41E 1THLA 3FTVA 4XN9A 4D9WA 2DQ6A 1FJOA 5FWQA 1LNCE 1LNDE 4XNAA 4TMNE 1H19A 1Y3GE 4TLNA 1PE7A 4X2UA 4PU2A 4XN4A 3DO0A 4ZX3A 5DLLA 4QMEA 3CIAA 2WHZA 1PE5A 3KEDA 4MZNE 3EBIA 4MS6A 4XNDA 3FUDA 3CHQA 2XPZA 3CHOA 4QIRA 4XN7A 4XN8A 5DPEE 3FLFA 3T8FA 1KROA 1GXWA 3F28A 4RSYA 3CHPA 1QF1A 4ZW3A 4ZX4A 5HQDA 1NPCA 3MS3A 3MSAA 3FTYA 3P7TE 4QUOA 4XMWA 2DQMA 1KS7A 1BQBA 5JS3E 4K5PA 3FH8A 1FJVA 3FUHA 3B2PA 3EBGA 3FVPA 4TLIA 4GERA 1HS6A 4R5VA 1ZDPE 3T74A 3T8GA 1KJOA 2TLIA 1KTOA 1QF0A 3EIMA 4R5TA 4L2LA 3EBHA 5FSPA 3CHSA 3FU0A 3P7PE 5JXNE 3FORA 4XMXA 2WI0A 3FH5A 4XO4A 2GTQA 3DBKA 3DO2A 3F2PA 3FTSA 3FXSA 5A3YA 2HPTA 4K5LA 4ZW5A 1HYTA 3FUNA 4MKTA 7TLIA 3QJXA 6TLIA 3NQXA 2R59A 5JT9E 4ZQTA 2VJ8A 1LNAE 1Z9GE 4QPEA 3FGDA 1KJPA 4N4EE 2G4ZA 3MSFA 3T2HE 3T2JE 5JSSE 3QH1A 3FUKA 4ZX6A 3B3BA 5DLHA 5TMNE 4DPRA 3DO1A 1KR6A 3T8HA 1TLXA 4RVBA 3FTZA 3T87A 4PVBA 3ZI6A 3FV4A 3CHRA 3FULA 4GAAA 4XN5A 3SSBA 1TMNE 3FCQA 4OI5E 3NQZB 4K5OA 1LNEE 3T8VA 8TLNE 2A7GE 3B2XA 4K90A 3Q43A 3T8CA 3QH5A 7TLNA 3FUJA 5LIFE 1EZMA 3FBOA 3FU3A 4M65A 3B37A 1FJQA 3FTXA 5FXNA 2HPOA 3P7UE 4J3BA 4PW4A 1L3FE 4B52A 3DNZA 3B7SA 3NQYB 4QHPA 3B7UX 1PE8A 4Q4EA 3Q44A 3P7SE 1TLPE 3TMNE 1FJTA 4D91A 3FUFA 3N21A 3FU6A 2XPYA 2VQXA 3MSNA 1GW6A 3FB0A 4XO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEN A;  4MXJ E;  3TLI A;  3LS7 A;  3B7R L;  3T2I E;  2TMN E;  4XNB A;  4ZW8 A;  5TLI A;  4ZW6 A;  3P7R E;  4K89 A;  4OW3 A;  4MTW E;  4XMZ A;  6TMN E;  1TRL A;  8TLI A;  5DPF E;  3FTW A;  4R7L A;  2TLX A;  3FHE A;  5FSJ A;  1SQM A;  1KKK A;  3NN7 A;  1FJW A;  1ESP A;  3FU5 A;  4N5P E;  5LWD E;  4K5N A;  4XMT A;  3U9W A;  4K5M A;  1KL6 A;  4ZW7 A;  3P7Q E;  4XN1 A;  1KEI A;  3FUE A;  4XMU A;  4Q4I A;  4XN2 A;  5L8P E;  4XMV A;  1LNB E;  4N66 E;  3B7T A;  3FTU A;  1LNF E;  3PUU A;  3FUM A;  4TNL A;  3QGO A;  3P7V E;  4R5X A;  5BPP A;  2XQ0 A;  5TLN A;  3FXP A;  1QF2 A;  1FJ3 A;  3B34 A;  1FJU A;  1U4G A;  4H57 A;  3P7W E;  1OS0 A;  5K7T A;  4MWP E;  2ZXG A;  5FSS A;  3FUI A;  3T73 A;  3T8D A;  5JVI E;  5L3U E;  1TLI A;  4ZX5 A;  3FH7 A;  4XO3 A;  5DYF A;  5L41 E;  1THL A;  3FTV A;  4XN9 A;  4D9W A;  2DQ6 A;  1FJO A;  5FWQ A;  1LNC E;  1LND E;  4XNA A;  4TMN E;  1H19 A;  1Y3G E;  4TLN A;  1PE7 A;  4X2U A;  4PU2 A;  4XN4 A;  3DO0 A;  4ZX3 A;  5DLL A;  4QME A;  3CIA A;  2WHZ A;  1PE5 A;  3KED A;  4MZN E;  3EBI A;  4MS6 A;  4XND A;  3FUD A;  3CHQ A;  2XPZ A;  3CHO A;  4QIR A;  4XN7 A;  4XN8 A;  5DPE E;  3FLF A;  3T8F A;  1KRO A;  1GXW A;  3F28 A;  4RSY A;  3CHP A;  1QF1 A;  4ZW3 A;  4ZX4 A;  5HQD A;  1NPC A;  3MS3 A;  3MSA A;  3FTY A;  3P7T E;  4QUO A;  4XMW A;  2DQM A;  1KS7 A;  1BQB A;  5JS3 E;  4K5P A;  3FH8 A;  1FJV A;  3FUH A;  3B2P A;  3EBG A;  3FVP A;  4TLI A;  4GER A;  1HS6 A;  4R5V A;  1ZDP E;  3T74 A;  3T8G A;  1KJO A;  2TLI A;  1KTO A;  1QF0 A;  3EIM A;  4R5T A;  4L2L A;  3EBH A;  5FSP A;  3CHS A;  3FU0 A;  3P7P E;  5JXN E;  3FOR A;  4XMX A;  2WI0 A;  3FH5 A;  4XO4 A;  2GTQ A;  3DBK A;  3DO2 A;  3F2P A;  3FTS A;  3FXS A;  5A3Y A;  2HPT A;  4K5L A;  4ZW5 A;  1HYT A;  3FUN A;  4MKT A;  7TLI A;  3QJX A;  6TLI A;  3NQX A;  2R59 A;  5JT9 E;  4ZQT A;  2VJ8 A;  1LNA E;  1Z9G E;  4QPE A;  3FGD A;  1KJP A;  4N4E E;  2G4Z A;  3MSF A;  3T2H E;  3T2J E;  5JSS E;  3QH1 A;  3FUK A;  4ZX6 A;  3B3B A;  5DLH A;  5TMN E;  4DPR A;  3DO1 A;  1KR6 A;  3T8H A;  1TLX A;  4RVB A;  3FTZ A;  3T87 A;  4PVB A;  3ZI6 A;  3FV4 A;  3CHR A;  3FUL A;  4GAA A;  4XN5 A;  3SSB A;  1TMN E;  3FCQ A;  4OI5 E;  3NQZ B;  4K5O A;  1LNE E;  3T8V A;  8TLN E;  2A7G E;  3B2X A;  4K90 A;  3Q43 A;  3T8C A;  3QH5 A;  7TLN A;  3FUJ A;  5LIF E;  1EZM A;  3FBO A;  3FU3 A;  4M65 A;  3B37 A;  1FJQ A;  3FTX A;  5FXN A;  2HPO A;  3P7U E;  4J3B A;  4PW4 A;  1L3F E;  4B52 A;  3DNZ A;  3B7S A;  3NQY B;  4QHP A;  3B7U X;  1PE8 A;  4Q4E A;  3Q44 A;  3P7S E;  1TLP E;  3TMN E;  1FJT A;  4D91 A;  3FUF A;  3N21 A;  3FU6 A;  2XPY A;  2VQX A;  3MSN A;  1GW6 A;  3FB0 A;  4XO5 A; 
#chains in the Genus database with same CATH topology
 4HOM A;  4ZW8 A;  5TLI A;  4K89 A;  4OW3 A;  4MTW E;  4F5C A;  6TMN E;  3FTW A;  2TLX A;  3NN7 A;  1FJW A;  5LWD E;  3P7Q E;  4Q4I A;  1Z1W A;  1LNB E;  3QGO A;  4R5X A;  5TLN A;  1FJU A;  1OS0 A;  4MWP E;  3T73 A;  3FUI A;  5LHD A;  4XO3 A;  1THL A;  3FTV A;  1LND E;  4TLN A;  4PU2 A;  5DLL A;  4OU3 A;  1PE5 A;  3EBI A;  4FGM A;  3FUD A;  2XPZ A;  3CHO A;  4XN8 A;  5JS3 E;  2DQM A;  1BQB A;  1HS6 A;  4R5V A;  4FYR A;  4AR8 A;  4L2L A;  3CHS A;  2GTQ A;  3DBK A;  5AB2 A;  4K5L A;  2R59 A;  4QPE A;  3T2H E;  4AR1 A;  3T2J E;  3QH1 A;  5DLH A;  4RVB A;  3FTZ A;  4KXA A;  1TMN E;  3FCQ A;  1LNE E;  3SE6 A;  2YD0 A;  3FUJ A;  3FBO A;  3B37 A;  1FJQ A;  3FTX A;  5FXN A;  3P7U E;  3DNZ A;  3B7S A;  1PE8 A;  3TMN E;  3N21 A;  3FU6 A;  2XPY A;  2VQX A;  5AEN A;  4MXJ E;  3TLI A;  3B7R L;  4ZW6 A;  5DPF E;  4N5P E;  4K5N A;  4XMT A;  4K5M A;  3MDJ A;  4XN1 A;  3FUE A;  4XMU A;  5L8P E;  3PUU A;  3FUM A;  3P7V E;  5LDS A;  5BPP A;  3FXP A;  3B34 A;  3P7W E;  5K7T A;  4NZ8 A;  2ZXG A;  4FYS A;  5FSS A;  3T8D A;  5JVI E;  1TLI A;  4XN9 A;  1FJO A;  5FWQ A;  4TMN E;  4X2U A;  4FYQ A;  3DO0 A;  4PJ6 A;  3CIA A;  4MZN E;  4MS6 A;  3FLF A;  4FYT A;  4WZ9 A;  4ZX4 A;  1QF1 A;  3FTY A;  4XMW A;  4K5P A;  1FJV A;  3B2P A;  4GER A;  4R5T A;  5JXN E;  3P7P E;  3DO2 A;  3FTS A;  3FXS A;  4ZW5 A;  1HYT A;  3FUN A;  4MKT A;  6TLI A;  3NQX A;  1LNA E;  1Z9G E;  1KJP A;  4N4E E;  4ZX6 A;  5TMN E;  4DPR A;  4E36 A;  4PVB A;  3FV4 A;  3FUL A;  4IHQ A;  4NAQ A;  3T8C A;  3Q43 A;  3QH5 A;  2HPO A;  1L3F E;  4KX7 A;  3NQY B;  3B7U X;  4D91 A;  3Q44 A;  1TLP E;  3FB0 A;  4XO5 A;  2TMN E;  4KX9 A;  4XNB A;  5FSJ A;  1ESP A;  3U9W A;  1KL6 A;  4XN2 A;  4N66 E;  3B7T A;  2XQ0 A;  5L3U E;  4ZX5 A;  4Z7I A;  5DYF A;  5L41 E;  5LG6 A;  2DQ6 A;  1LNC E;  1H19 A;  1Y3G E;  1PE7 A;  4XN4 A;  5K1V A;  3KED A;  4XN7 A;  1GXW A;  4KXD A;  4II7 A;  4RSY A;  1NPC A;  3MSA A;  4QUO A;  4FKE A;  3EBG A;  4KXB A;  3FVP A;  4TLI A;  3T8G A;  1ZDP E;  3T74 A;  1KJO A;  3EIM A;  1QF0 A;  3EBH A;  3FOR A;  2WI0 A;  3Q7J A;  4XO4 A;  5A3Y A;  2HPT A;  5EV7 A;  3QJX A;  5JT9 E;  4ZQT A;  2VJ8 A;  3MSF A;  5J6S A;  3T87 A;  3ZI6 A;  3CHR A;  3SSB A;  1Z5H A;  3NQZ B;  5CU5 A;  7TLN A;  1EZM A;  3QNF A;  4J3B A;  4FCA A;  4B52 A;  4QHP A;  3P7S E;  3MSN A;  1GW6 A;  4P8Q A;  3LS7 A;  4ARF A;  3T2I E;  3P7R E;  4XMZ A;  1TRL A;  8TLI A;  4R7L A;  3FHE A;  1SQM A;  1KKK A;  3FU5 A;  4ZW7 A;  1KEI A;  4XMV A;  3FTU A;  1LNF E;  4TNL A;  1QF2 A;  1FJ3 A;  4H57 A;  1U4G A;  3FH7 A;  4D9W A;  4XNA A;  4ZX3 A;  4QME A;  2WHZ A;  4XND A;  3CHQ A;  4QIR A;  5C97 A;  5DPE E;  3T8F A;  1KRO A;  3F28 A;  3CHP A;  4ZW3 A;  5HQD A;  3MS3 A;  3P7T E;  1KS7 A;  3FH8 A;  5AB0 A;  3FUH A;  4KXC A;  2TLI A;  1KTO A;  5FSP A;  3FU0 A;  4XMX A;  3FH5 A;  3F2P A;  4FKK A;  7TLI A;  3FGD A;  4FKH A;  4JBS A;  2G4Z A;  5JSS E;  4KX8 A;  3FUK A;  3B3B A;  3DO1 A;  1KR6 A;  3T8H A;  1TLX A;  4GAA A;  4XN5 A;  4OI5 E;  4K5O A;  3T8V A;  8TLN E;  2A7G E;  3B2X A;  4K90 A;  5LIF E;  4AR9 A;  3FU3 A;  4M65 A;  4PW4 A;  4Q4E A;  1FJT A;  3FUF A; 
#chains in the Genus database with same CATH homology
 5AEN A;  4MXJ E;  3TLI A;  3LS7 A;  3B7R L;  3T2I E;  2TMN E;  4XNB A;  4ZW8 A;  5TLI A;  4ZW6 A;  3P7R E;  4K89 A;  4OW3 A;  4MTW E;  4XMZ A;  6TMN E;  1TRL A;  8TLI A;  5DPF E;  3FTW A;  4R7L A;  2TLX A;  3FHE A;  5FSJ A;  1SQM A;  1KKK A;  3NN7 A;  1FJW A;  1ESP A;  3FU5 A;  4N5P E;  5LWD E;  4K5N A;  4XMT A;  3U9W A;  4K5M A;  1KL6 A;  4ZW7 A;  3P7Q E;  4XN1 A;  1KEI A;  3FUE A;  4XMU A;  4Q4I A;  4XN2 A;  5L8P E;  4XMV A;  1LNB E;  4N66 E;  3B7T A;  3FTU A;  1LNF E;  3PUU A;  3FUM A;  4TNL A;  3QGO A;  3P7V E;  4R5X A;  5BPP A;  2XQ0 A;  5TLN A;  3FXP A;  1QF2 A;  1FJ3 A;  3B34 A;  1FJU A;  1U4G A;  4H57 A;  3P7W E;  1OS0 A;  5K7T A;  4MWP E;  2ZXG A;  5FSS A;  3FUI A;  3T73 A;  3T8D A;  5JVI E;  5L3U E;  1TLI A;  4ZX5 A;  3FH7 A;  4XO3 A;  5DYF A;  5L41 E;  1THL A;  3FTV A;  4XN9 A;  4D9W A;  2DQ6 A;  1FJO A;  5FWQ A;  1LNC E;  1LND E;  4XNA A;  4TMN E;  1H19 A;  1Y3G E;  4TLN A;  1PE7 A;  4X2U A;  4PU2 A;  4XN4 A;  3DO0 A;  4ZX3 A;  5DLL A;  4QME A;  3CIA A;  2WHZ A;  1PE5 A;  3KED A;  4MZN E;  3EBI A;  4MS6 A;  4XND A;  3FUD A;  3CHQ A;  2XPZ A;  3CHO A;  4QIR A;  4XN7 A;  4XN8 A;  5DPE E;  3FLF A;  3T8F A;  1KRO A;  1GXW A;  3F28 A;  4RSY A;  3CHP A;  1QF1 A;  4ZW3 A;  4ZX4 A;  5HQD A;  1NPC A;  3MS3 A;  3MSA A;  3FTY A;  3P7T E;  4QUO A;  4XMW A;  2DQM A;  1KS7 A;  1BQB A;  5JS3 E;  4K5P A;  3FH8 A;  1FJV A;  3FUH A;  3B2P A;  3EBG A;  3FVP A;  4TLI A;  4GER A;  1HS6 A;  4R5V A;  1ZDP E;  3T74 A;  3T8G A;  1KJO A;  2TLI A;  1KTO A;  1QF0 A;  3EIM A;  4R5T A;  4L2L A;  3EBH A;  5FSP A;  3CHS A;  3FU0 A;  3P7P E;  5JXN E;  3FOR A;  4XMX A;  2WI0 A;  3FH5 A;  4XO4 A;  2GTQ A;  3DBK A;  3DO2 A;  3F2P A;  3FTS A;  3FXS A;  5A3Y A;  2HPT A;  4K5L A;  4ZW5 A;  1HYT A;  3FUN A;  4MKT A;  7TLI A;  3QJX A;  6TLI A;  3NQX A;  2R59 A;  5JT9 E;  4ZQT A;  2VJ8 A;  1LNA E;  1Z9G E;  4QPE A;  3FGD A;  1KJP A;  4N4E E;  2G4Z A;  3MSF A;  3T2H E;  3T2J E;  5JSS E;  3QH1 A;  3FUK A;  4ZX6 A;  3B3B A;  5DLH A;  5TMN E;  4DPR A;  3DO1 A;  1KR6 A;  3T8H A;  1TLX A;  4RVB A;  3FTZ A;  3T87 A;  4PVB A;  3ZI6 A;  3FV4 A;  3CHR A;  3FUL A;  4GAA A;  4XN5 A;  3SSB A;  1TMN E;  3FCQ A;  4OI5 E;  3NQZ B;  4K5O A;  1LNE E;  3T8V A;  8TLN E;  2A7G E;  3B2X A;  4K90 A;  3Q43 A;  3T8C A;  3QH5 A;  7TLN A;  3FUJ A;  5LIF E;  1EZM A;  3FBO A;  3FU3 A;  4M65 A;  3B37 A;  1FJQ A;  3FTX A;  5FXN A;  2HPO A;  3P7U E;  4J3B A;  4PW4 A;  1L3F E;  4B52 A;  3DNZ A;  3B7S A;  3NQY B;  4QHP A;  3B7U X;  1PE8 A;  4Q4E A;  3Q44 A;  3P7S E;  1TLP E;  3TMN E;  1FJT A;  4D91 A;  3FUF A;  3N21 A;  3FU6 A;  2XPY A;  2VQX A;  3MSN A;  1GW6 A;  3FB0 A;  4XO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...