1TRLA

Nmr solution structure of the c-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
b'VVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR solution structure of the C-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure.
pubmed doi rcsb
molecule keywords THERMOLYSIN FRAGMENT 255 - 316
source organism Bacillus thermoproteolyticus
molecule tags Hydrolase (metalloprotease)
total genus 24
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature ec 3.4.24.27: Thermolysin.
pdb deposition date 1994-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 1trlA00
4XN2A 3MS3A 3QJXA 3DBKA 4XNDA 3P7RE 3CHOA 5HQDA 4MZNE 4XN7A 5LIFE 1FJ3A 3DO2A 4L2LA 3FTSA 3T74A 4ZX4A 2TLXA 4DPRA 1LNBE 7TLIA 3MSFA 5FSSA 2R59A 4XN9A 3B3BA 3T8FA 3EBIA 3FULA 3F28A 4M65A 1LNEE 4MKTA 1PE8A 3FTWA 5TLNA 1GW6A 4Q4IA 6TLIA 4D91A 3FHEA 1TLPE 5FSPA 3T8HA 3T2JE 4QPEA 1GXWA 3MSAA 1FJOA 4OI5E 4XMWA 3FORA 3F2PA 3CHPA 1HS6A 3NQZB 4ZW6A 4ZW8A 4XNAA 2G4ZA 4R5TA 3B7UX 1LNFE 5TMNE 3FBOA 3FXSA 1TLXA 4GERA 1KJOA 3QGOA 4XO4A 3T87A 1KTOA 2XPYA 2XPZA 5TLIA 1PE7A 1LNAE 3FUIA 3NN7A 4K5MA 4XO3A 5DLHA 5DLLA 1NPCA 8TLIA 1KS7A 3FH5A 5A3YA 1FJUA 3P7QE 3FUNA 3P7UE 4ZQTA 4K5OA 2TLIA 4XMZA 3EBGA 2DQ6A 4R5XA 1FJWA 3DNZA 3P7SE 3T2HE 4MWPE 1LNCE 3P7TE 5L8PE 1L3FE 3B37A 3P7WE 1KL6A 3FU5A 5JXNE 4N5PE 3FVPA 4QMEA 3PUUA 3T8GA 4K5NA 3CHSA 2DQMA 8TLNE 3FTUA 3T8VA 3FLFA 2WHZA 4J3BA 3CHQA 3FGDA 3T8DA 4ZW3A 4K5PA 1FJVA 3FTVA 3FTZA 3QH1A 4PU2A 5JVIE 1TRLA 1KR6A 4QIRA 5K7TA 1U4GA 4XNBA 5DPEE 3T2IE 2VQXA 3FUHA 3FUKA 5JSSE 5BPPA 5LWDE 4ZX3A 1OS0A 1THLA 4MXJE 5JT9E 3CHRA 4MTWE 1QF1A 2TMNE 2ZXGA 3B7SA 3QH5A 4K89A 3FV4A 3Q43A 4OW3A 1LNDE 1SQMA 4N4EE 5L3UE 5DPFE 4TMNE 3B7TA 2WI0A 3N21A 4RVBA 6TMNE 3FU6A 3KEDA 3NQYB 3T73A 1PE5A 2HPOA 4GAAA 1QF2A 3FH8A 4Q4EA 4XMUA 4ZX6A 4TLIA 2XQ0A 3FU3A 3FUDA 3FUFA 4MS6A 5DYFA 1BQBA 3B34A 4XN8A 5L41E 4ZW5A 4XN1A 3FTXA 3DO0A 3CIAA 1KEIA 1KJPA 4H57A 4ZX5A 1KROA 4ZW7A 4XMXA 1HYTA 1QF0A 5FWQA 3FB0A 3LS7A 4B52A 2VJ8A 4R5VA 4XN5A 3NQXA 1Y3GE 3FUJA 3ZI6A 4XO5A 7TLNA 4K5LA 3B7RL 3P7PE 4R7LA 3B2XA 1ESPA 1TLIA 3MSNA 5FSJA 2HPTA 4QHPA 4QUOA 3SSBA 4XN4A 4PVBA 3Q44A 3EIMA 3FH7A 3P7VE 5JS3E 1KKKA 1H19A 4XMVA 2GTQA 4TLNA 3TMNE 3U9WA 4D9WA 3B2PA 1Z9GE 4N66E 1TMNE 2A7GE 4K90A 4TNLA 3DO1A 3T8CA 3FUMA 4XMTA 3TLIA 1FJQA 3FU0A 4RSYA 3FUEA 5FXNA 3FTYA 1FJTA 3FXPA 1ZDPE 3FCQA 1EZMA 4X2UA 4PW4A 5AENA 3EBHA
chains in the Genus database with same CATH superfamily
4XN2A 4XNDA 4KXCA 4L2LA 3FTSA 4DPRA 1LNBE 4XN9A 3EBIA 4MKTA 3FTWA 6TLIA 3FHEA 5FSPA 5C97A 4Z7IA 4KXAA 1HS6A 4ZW6A 5TMNE 1TLXA 1KJOA 3QGOA 5TLIA 2XPZA 4K5MA 4KXDA 3FUNA 2TLIA 3EBGA 4R5XA 1FJWA 3DNZA 3P7TE 5L8PE 1L3FE 4N5PE 3T8GA 4K5NA 8TLNE 3FTUA 4FGMA 3FLFA 4K5PA 3QH1A 4KXBA 1KR6A 4QIRA 1OS0A 1THLA 4FKEA 4MXJE 2TMNE 4KX8A 3FV4A 3Q43A 4OW3A 5L3UE 3Q7JA 4KX7A 4TMNE 2WI0A 4RVBA 3FU6A 2HPOA 4II7A 5LG6A 1KJPA 4H57A 5EV7A 2HPTA 1TLIA 3MSNA 4PVBA 5FSJA 4QUOA 4XN4A 3EIMA 3P7VE 4FYSA 2GTQA 4TLNA 4AR9A 4K90A 2A7GE 4FKHA 4XMTA 4RSYA 1FJTA 3FCQA 4WZ9A 1EZMA 4X2UA 3EBHA 3MS3A 5HQDA 4XN7A 5LIFE 4ARFA 2TLXA 2R59A 3FULA 3MDJA 5TLNA 4Q4IA 4QPEA 1FJOA 4OI5E 4F5CA 3F2PA 4HOMA 2G4ZA 4R5TA 3B7UX 3FXSA 4GERA 3T87A 1LNAE 3QNFA 3NN7A 1FJUA 4K5OA 4XMZA 4MWPE 3FU5A 3FVPA 3T8VA 2WHZA 4J3BA 5LDSA 3T8DA 4AR8A 4OU3A 5DPEE 3T2IE 5JSSE 3FUHA 5JT9E 1QF1A 1SQMA 5DPFE 3B7TA 3N21A 6TMNE 3KEDA 3T73A 4GAAA 1QF2A 4ZX6A 4XMUA 4TLIA 2XQ0A 3FUDA 1BQBA 4XN8A 4FYRA 3DO0A 4XMXA 1QF0A 3LS7A 3NQXA 3ZI6A 3B7RL 3P7PE 4KX9A 3FH7A 5JS3E 4N66E 1TMNE 4TNLA 5AENA 7TLNA 5AB0A 3T74A 7TLIA 3B3BA 4M65A 3F28A 1LNEE 1PE8A 1GW6A 3T8HA 3T2JE 1GXWA 3MSAA 3FORA 3CHPA 3NQZB 4ZW8A 4XNAA 4FYTA 4XO4A 1KTOA 2XPYA 4XO3A 5DLLA 3FUIA 1NPCA 1KS7A 3FH5A 3P7QE 3P7UE 4E36A 3T2HE 3P7SE 3P7WE 1KL6A 3CHSA 2DQMA 3CHQA 3FGDA 4ZW3A 3FTZA 4PU2A 1TRLA 5K7TA 5LWDE 5BPPA 3CHRA 3QH5A 1LNDE 3NQYB 3SE6A 1PE5A 4IHQA 3FH8A 3FU3A 5DYFA 3FTXA 4ZX5A 3CIAA 1KEIA 3FB0A 2VJ8A 4XN5A 1Y3GE 4XO5A 5J6SA 1ESPA 3TMNE 3U9WA 4D9WA 3B2PA 3DO1A 3TLIA 3FUEA 3FTYA 1ZDPE 4PW4A 4P8QA 3QJXA 3DBKA 3P7RE 3CHOA 4MZNE 1FJ3A 3DO2A 4NZ8A 4ZX4A 3MSFA 5FSSA 3T8FA 4FCAA 5K1VA 4FKKA 4D91A 1TLPE 4XMWA 2YD0A 4NAQA 1LNFE 3FBOA 1PE7A 5DLHA 8TLIA 5A3YA 4ZQTA 5CU5A 2DQ6A 1LNCE 3B37A 5JXNE 4QMEA 3PUUA 4PJ6A 5AB2A 1FJVA 3FTVA 5LHDA 5JVIE 1Z1WA 1U4GA 4XNBA 2VQXA 3FUKA 4ZX3A 4MTWE 2ZXGA 3B7SA 4K89A 4N4EE 4Q4EA 3FUFA 4MS6A 3B34A 5L41E 4ZW5A 4FYQA 4XN1A 1KROA 4ZW7A 1HYTA 5FWQA 4AR1A 4B52A 4R5VA 3FUJA 4K5LA 4R7LA 3B2XA 3SSBA 4QHPA 3Q44A 1KKKA 1H19A 4XMVA 4JBSA 1Z9GE 1Z5HA 3T8CA 3FUMA 1FJQA 3FU0A 5FXNA 3FXPA
chains in the Genus database with same CATH topology
4XN2A 3MS3A 3QJXA 3DBKA 4XNDA 3P7RE 3CHOA 5HQDA 4MZNE 4XN7A 5LIFE 1FJ3A 3DO2A 4L2LA 3FTSA 3T74A 4ZX4A 2TLXA 4DPRA 1LNBE 7TLIA 3MSFA 5FSSA 2R59A 4XN9A 3B3BA 3T8FA 3EBIA 3FULA 3F28A 4M65A 1LNEE 4MKTA 1PE8A 3FTWA 5TLNA 1GW6A 4Q4IA 6TLIA 4D91A 3FHEA 1TLPE 5FSPA 3T8HA 3T2JE 4QPEA 1GXWA 3MSAA 1FJOA 4OI5E 4XMWA 3FORA 3F2PA 3CHPA 1HS6A 3NQZB 4ZW6A 4ZW8A 4XNAA 2G4ZA 4R5TA 3B7UX 1LNFE 5TMNE 3FBOA 3FXSA 1TLXA 4GERA 1KJOA 3QGOA 4XO4A 3T87A 1KTOA 2XPYA 2XPZA 5TLIA 1PE7A 1LNAE 3FUIA 3NN7A 4K5MA 4XO3A 5DLHA 5DLLA 1NPCA 8TLIA 1KS7A 3FH5A 5A3YA 1FJUA 3P7QE 3FUNA 3P7UE 4ZQTA 4K5OA 2TLIA 4XMZA 3EBGA 2DQ6A 4R5XA 1FJWA 3DNZA 3P7SE 3T2HE 4MWPE 1LNCE 3P7TE 5L8PE 1L3FE 3B37A 3P7WE 1KL6A 3FU5A 5JXNE 4N5PE 3FVPA 4QMEA 3PUUA 3T8GA 4K5NA 3CHSA 2DQMA 8TLNE 3FTUA 3T8VA 3FLFA 2WHZA 4J3BA 3CHQA 3FGDA 3T8DA 4ZW3A 4K5PA 1FJVA 3FTVA 3FTZA 3QH1A 4PU2A 5JVIE 1TRLA 1KR6A 4QIRA 5K7TA 1U4GA 4XNBA 5DPEE 3T2IE 2VQXA 3FUHA 3FUKA 5JSSE 5BPPA 5LWDE 4ZX3A 1OS0A 1THLA 4MXJE 5JT9E 3CHRA 4MTWE 1QF1A 2TMNE 2ZXGA 3B7SA 3QH5A 4K89A 3FV4A 3Q43A 4OW3A 1LNDE 1SQMA 4N4EE 5L3UE 5DPFE 4TMNE 3B7TA 2WI0A 3N21A 4RVBA 6TMNE 3FU6A 3KEDA 3NQYB 3T73A 1PE5A 2HPOA 4GAAA 1QF2A 3FH8A 4Q4EA 4XMUA 4ZX6A 4TLIA 2XQ0A 3FU3A 3FUDA 3FUFA 4MS6A 5DYFA 1BQBA 3B34A 4XN8A 5L41E 4ZW5A 4XN1A 3FTXA 3DO0A 3CIAA 1KEIA 1KJPA 4H57A 4ZX5A 1KROA 4ZW7A 4XMXA 1HYTA 1QF0A 5FWQA 3FB0A 3LS7A 4B52A 2VJ8A 4R5VA 4XN5A 3NQXA 1Y3GE 3FUJA 3ZI6A 4XO5A 7TLNA 4K5LA 3B7RL 3P7PE 4R7LA 3B2XA 1ESPA 1TLIA 3MSNA 5FSJA 2HPTA 4QHPA 4QUOA 3SSBA 4XN4A 4PVBA 3Q44A 3EIMA 3FH7A 3P7VE 5JS3E 1KKKA 1H19A 4XMVA 2GTQA 4TLNA 3TMNE 3U9WA 4D9WA 3B2PA 1Z9GE 4N66E 1TMNE 2A7GE 4K90A 4TNLA 3DO1A 3T8CA 3FUMA 4XMTA 3TLIA 1FJQA 3FU0A 4RSYA 3FUEA 5FXNA 3FTYA 1FJTA 3FXPA 1ZDPE 3FCQA 1EZMA 4X2UA 4PW4A 5AENA 3EBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XN2 A;  3MS3 A;  3QJX A;  3DBK A;  4XND A;  3P7R E;  3CHO A;  5HQD A;  4MZN E;  4XN7 A;  5LIF E;  1FJ3 A;  3DO2 A;  4L2L A;  3FTS A;  3T74 A;  4ZX4 A;  2TLX A;  4DPR A;  1LNB E;  7TLI A;  3MSF A;  5FSS A;  2R59 A;  4XN9 A;  3B3B A;  3T8F A;  3EBI A;  3FUL A;  3F28 A;  4M65 A;  1LNE E;  4MKT A;  1PE8 A;  3FTW A;  5TLN A;  1GW6 A;  4Q4I A;  6TLI A;  4D91 A;  3FHE A;  1TLP E;  5FSP A;  3T8H A;  3T2J E;  4QPE A;  1GXW A;  3MSA A;  1FJO A;  4OI5 E;  4XMW A;  3FOR A;  3F2P A;  3CHP A;  1HS6 A;  3NQZ B;  4ZW6 A;  4ZW8 A;  4XNA A;  2G4Z A;  4R5T A;  3B7U X;  1LNF E;  5TMN E;  3FBO A;  3FXS A;  1TLX A;  4GER A;  1KJO A;  3QGO A;  4XO4 A;  3T87 A;  1KTO A;  2XPY A;  2XPZ A;  5TLI A;  1PE7 A;  1LNA E;  3FUI A;  3NN7 A;  4K5M A;  4XO3 A;  5DLH A;  5DLL A;  1NPC A;  8TLI A;  1KS7 A;  3FH5 A;  5A3Y A;  1FJU A;  3P7Q E;  3FUN A;  3P7U E;  4ZQT A;  4K5O A;  2TLI A;  4XMZ A;  3EBG A;  2DQ6 A;  4R5X A;  1FJW A;  3DNZ A;  3P7S E;  3T2H E;  4MWP E;  1LNC E;  3P7T E;  5L8P E;  1L3F E;  3B37 A;  3P7W E;  1KL6 A;  3FU5 A;  5JXN E;  4N5P E;  3FVP A;  4QME A;  3PUU A;  3T8G A;  4K5N A;  3CHS A;  2DQM A;  8TLN E;  3FTU A;  3T8V A;  3FLF A;  2WHZ A;  4J3B A;  3CHQ A;  3FGD A;  3T8D A;  4ZW3 A;  4K5P A;  1FJV A;  3FTV A;  3FTZ A;  3QH1 A;  4PU2 A;  5JVI E;  1TRL A;  1KR6 A;  4QIR A;  5K7T A;  1U4G A;  4XNB A;  5DPE E;  3T2I E;  2VQX A;  3FUH A;  3FUK A;  5JSS E;  5BPP A;  5LWD E;  4ZX3 A;  1OS0 A;  1THL A;  4MXJ E;  5JT9 E;  3CHR A;  4MTW E;  1QF1 A;  2TMN E;  2ZXG A;  3B7S A;  3QH5 A;  4K89 A;  3FV4 A;  3Q43 A;  4OW3 A;  1LND E;  1SQM A;  4N4E E;  5L3U E;  5DPF E;  4TMN E;  3B7T A;  2WI0 A;  3N21 A;  4RVB A;  6TMN E;  3FU6 A;  3KED A;  3NQY B;  3T73 A;  1PE5 A;  2HPO A;  4GAA A;  1QF2 A;  3FH8 A;  4Q4E A;  4XMU A;  4ZX6 A;  4TLI A;  2XQ0 A;  3FU3 A;  3FUD A;  3FUF A;  4MS6 A;  5DYF A;  1BQB A;  3B34 A;  4XN8 A;  5L41 E;  4ZW5 A;  4XN1 A;  3FTX A;  3DO0 A;  3CIA A;  1KEI A;  1KJP A;  4H57 A;  4ZX5 A;  1KRO A;  4ZW7 A;  4XMX A;  1HYT A;  1QF0 A;  5FWQ A;  3FB0 A;  3LS7 A;  4B52 A;  2VJ8 A;  4R5V A;  4XN5 A;  3NQX A;  1Y3G E;  3FUJ A;  3ZI6 A;  4XO5 A;  7TLN A;  4K5L A;  3B7R L;  3P7P E;  4R7L A;  3B2X A;  1ESP A;  1TLI A;  3MSN A;  5FSJ A;  2HPT A;  4QHP A;  4QUO A;  3SSB A;  4XN4 A;  4PVB A;  3Q44 A;  3EIM A;  3FH7 A;  3P7V E;  5JS3 E;  1KKK A;  1H19 A;  4XMV A;  2GTQ A;  4TLN A;  3TMN E;  3U9W A;  4D9W A;  3B2P A;  1Z9G E;  4N66 E;  1TMN E;  2A7G E;  4K90 A;  4TNL A;  3DO1 A;  3T8C A;  3FUM A;  4XMT A;  3TLI A;  1FJQ A;  3FU0 A;  4RSY A;  3FUE A;  5FXN A;  3FTY A;  1FJT A;  3FXP A;  1ZDP E;  3FCQ A;  1EZM A;  4X2U A;  4PW4 A;  5AEN A;  3EBH A; 
#chains in the Genus database with same CATH topology
 4XN2 A;  4XND A;  4KXC A;  4L2L A;  3FTS A;  4DPR A;  1LNB E;  4XN9 A;  3EBI A;  4MKT A;  3FTW A;  6TLI A;  3FHE A;  5FSP A;  5C97 A;  4Z7I A;  4KXA A;  1HS6 A;  4ZW6 A;  5TMN E;  1TLX A;  1KJO A;  3QGO A;  5TLI A;  2XPZ A;  4K5M A;  4KXD A;  3FUN A;  2TLI A;  3EBG A;  4R5X A;  1FJW A;  3DNZ A;  3P7T E;  5L8P E;  1L3F E;  4N5P E;  3T8G A;  4K5N A;  8TLN E;  3FTU A;  4FGM A;  3FLF A;  4K5P A;  3QH1 A;  4KXB A;  1KR6 A;  4QIR A;  1OS0 A;  1THL A;  4FKE A;  4MXJ E;  2TMN E;  4KX8 A;  3FV4 A;  3Q43 A;  4OW3 A;  5L3U E;  3Q7J A;  4KX7 A;  4TMN E;  2WI0 A;  4RVB A;  3FU6 A;  2HPO A;  4II7 A;  5LG6 A;  1KJP A;  4H57 A;  5EV7 A;  2HPT A;  1TLI A;  3MSN A;  4PVB A;  5FSJ A;  4QUO A;  4XN4 A;  3EIM A;  3P7V E;  4FYS A;  2GTQ A;  4TLN A;  4AR9 A;  4K90 A;  2A7G E;  4FKH A;  4XMT A;  4RSY A;  1FJT A;  3FCQ A;  4WZ9 A;  1EZM A;  4X2U A;  3EBH A;  3MS3 A;  5HQD A;  4XN7 A;  5LIF E;  4ARF A;  2TLX A;  2R59 A;  3FUL A;  3MDJ A;  5TLN A;  4Q4I A;  4QPE A;  1FJO A;  4OI5 E;  4F5C A;  3F2P A;  4HOM A;  2G4Z A;  4R5T A;  3B7U X;  3FXS A;  4GER A;  3T87 A;  1LNA E;  3QNF A;  3NN7 A;  1FJU A;  4K5O A;  4XMZ A;  4MWP E;  3FU5 A;  3FVP A;  3T8V A;  2WHZ A;  4J3B A;  5LDS A;  3T8D A;  4AR8 A;  4OU3 A;  5DPE E;  3T2I E;  5JSS E;  3FUH A;  5JT9 E;  1QF1 A;  1SQM A;  5DPF E;  3B7T A;  3N21 A;  6TMN E;  3KED A;  3T73 A;  4GAA A;  1QF2 A;  4ZX6 A;  4XMU A;  4TLI A;  2XQ0 A;  3FUD A;  1BQB A;  4XN8 A;  4FYR A;  3DO0 A;  4XMX A;  1QF0 A;  3LS7 A;  3NQX A;  3ZI6 A;  3B7R L;  3P7P E;  4KX9 A;  3FH7 A;  5JS3 E;  4N66 E;  1TMN E;  4TNL A;  5AEN A;  7TLN A;  5AB0 A;  3T74 A;  7TLI A;  3B3B A;  4M65 A;  3F28 A;  1LNE E;  1PE8 A;  1GW6 A;  3T8H A;  3T2J E;  1GXW A;  3MSA A;  3FOR A;  3CHP A;  3NQZ B;  4ZW8 A;  4XNA A;  4FYT A;  4XO4 A;  1KTO A;  2XPY A;  4XO3 A;  5DLL A;  3FUI A;  1NPC A;  1KS7 A;  3FH5 A;  3P7Q E;  3P7U E;  4E36 A;  3T2H E;  3P7S E;  3P7W E;  1KL6 A;  3CHS A;  2DQM A;  3CHQ A;  3FGD A;  4ZW3 A;  3FTZ A;  4PU2 A;  1TRL A;  5K7T A;  5LWD E;  5BPP A;  3CHR A;  3QH5 A;  1LND E;  3NQY B;  3SE6 A;  1PE5 A;  4IHQ A;  3FH8 A;  3FU3 A;  5DYF A;  3FTX A;  4ZX5 A;  3CIA A;  1KEI A;  3FB0 A;  2VJ8 A;  4XN5 A;  1Y3G E;  4XO5 A;  5J6S A;  1ESP A;  3TMN E;  3U9W A;  4D9W A;  3B2P A;  3DO1 A;  3TLI A;  3FUE A;  3FTY A;  1ZDP E;  4PW4 A;  4P8Q A;  3QJX A;  3DBK A;  3P7R E;  3CHO A;  4MZN E;  1FJ3 A;  3DO2 A;  4NZ8 A;  4ZX4 A;  3MSF A;  5FSS A;  3T8F A;  4FCA A;  5K1V A;  4FKK A;  4D91 A;  1TLP E;  4XMW A;  2YD0 A;  4NAQ A;  1LNF E;  3FBO A;  1PE7 A;  5DLH A;  8TLI A;  5A3Y A;  4ZQT A;  5CU5 A;  2DQ6 A;  1LNC E;  3B37 A;  5JXN E;  4QME A;  3PUU A;  4PJ6 A;  5AB2 A;  1FJV A;  3FTV A;  5LHD A;  5JVI E;  1Z1W A;  1U4G A;  4XNB A;  2VQX A;  3FUK A;  4ZX3 A;  4MTW E;  2ZXG A;  3B7S A;  4K89 A;  4N4E E;  4Q4E A;  3FUF A;  4MS6 A;  3B34 A;  5L41 E;  4ZW5 A;  4FYQ A;  4XN1 A;  1KRO A;  4ZW7 A;  1HYT A;  5FWQ A;  4AR1 A;  4B52 A;  4R5V A;  3FUJ A;  4K5L A;  4R7L A;  3B2X A;  3SSB A;  4QHP A;  3Q44 A;  1KKK A;  1H19 A;  4XMV A;  4JBS A;  1Z9G E;  1Z5H A;  3T8C A;  3FUM A;  1FJQ A;  3FU0 A;  5FXN A;  3FXP A; 
#chains in the Genus database with same CATH homology
 4XN2 A;  3MS3 A;  3QJX A;  3DBK A;  4XND A;  3P7R E;  3CHO A;  5HQD A;  4MZN E;  4XN7 A;  5LIF E;  1FJ3 A;  3DO2 A;  4L2L A;  3FTS A;  3T74 A;  4ZX4 A;  2TLX A;  4DPR A;  1LNB E;  7TLI A;  3MSF A;  5FSS A;  2R59 A;  4XN9 A;  3B3B A;  3T8F A;  3EBI A;  3FUL A;  3F28 A;  4M65 A;  1LNE E;  4MKT A;  1PE8 A;  3FTW A;  5TLN A;  1GW6 A;  4Q4I A;  6TLI A;  4D91 A;  3FHE A;  1TLP E;  5FSP A;  3T8H A;  3T2J E;  4QPE A;  1GXW A;  3MSA A;  1FJO A;  4OI5 E;  4XMW A;  3FOR A;  3F2P A;  3CHP A;  1HS6 A;  3NQZ B;  4ZW6 A;  4ZW8 A;  4XNA A;  2G4Z A;  4R5T A;  3B7U X;  1LNF E;  5TMN E;  3FBO A;  3FXS A;  1TLX A;  4GER A;  1KJO A;  3QGO A;  4XO4 A;  3T87 A;  1KTO A;  2XPY A;  2XPZ A;  5TLI A;  1PE7 A;  1LNA E;  3FUI A;  3NN7 A;  4K5M A;  4XO3 A;  5DLH A;  5DLL A;  1NPC A;  8TLI A;  1KS7 A;  3FH5 A;  5A3Y A;  1FJU A;  3P7Q E;  3FUN A;  3P7U E;  4ZQT A;  4K5O A;  2TLI A;  4XMZ A;  3EBG A;  2DQ6 A;  4R5X A;  1FJW A;  3DNZ A;  3P7S E;  3T2H E;  4MWP E;  1LNC E;  3P7T E;  5L8P E;  1L3F E;  3B37 A;  3P7W E;  1KL6 A;  3FU5 A;  5JXN E;  4N5P E;  3FVP A;  4QME A;  3PUU A;  3T8G A;  4K5N A;  3CHS A;  2DQM A;  8TLN E;  3FTU A;  3T8V A;  3FLF A;  2WHZ A;  4J3B A;  3CHQ A;  3FGD A;  3T8D A;  4ZW3 A;  4K5P A;  1FJV A;  3FTV A;  3FTZ A;  3QH1 A;  4PU2 A;  5JVI E;  1TRL A;  1KR6 A;  4QIR A;  5K7T A;  1U4G A;  4XNB A;  5DPE E;  3T2I E;  2VQX A;  3FUH A;  3FUK A;  5JSS E;  5BPP A;  5LWD E;  4ZX3 A;  1OS0 A;  1THL A;  4MXJ E;  5JT9 E;  3CHR A;  4MTW E;  1QF1 A;  2TMN E;  2ZXG A;  3B7S A;  3QH5 A;  4K89 A;  3FV4 A;  3Q43 A;  4OW3 A;  1LND E;  1SQM A;  4N4E E;  5L3U E;  5DPF E;  4TMN E;  3B7T A;  2WI0 A;  3N21 A;  4RVB A;  6TMN E;  3FU6 A;  3KED A;  3NQY B;  3T73 A;  1PE5 A;  2HPO A;  4GAA A;  1QF2 A;  3FH8 A;  4Q4E A;  4XMU A;  4ZX6 A;  4TLI A;  2XQ0 A;  3FU3 A;  3FUD A;  3FUF A;  4MS6 A;  5DYF A;  1BQB A;  3B34 A;  4XN8 A;  5L41 E;  4ZW5 A;  4XN1 A;  3FTX A;  3DO0 A;  3CIA A;  1KEI A;  1KJP A;  4H57 A;  4ZX5 A;  1KRO A;  4ZW7 A;  4XMX A;  1HYT A;  1QF0 A;  5FWQ A;  3FB0 A;  3LS7 A;  4B52 A;  2VJ8 A;  4R5V A;  4XN5 A;  3NQX A;  1Y3G E;  3FUJ A;  3ZI6 A;  4XO5 A;  7TLN A;  4K5L A;  3B7R L;  3P7P E;  4R7L A;  3B2X A;  1ESP A;  1TLI A;  3MSN A;  5FSJ A;  2HPT A;  4QHP A;  4QUO A;  3SSB A;  4XN4 A;  4PVB A;  3Q44 A;  3EIM A;  3FH7 A;  3P7V E;  5JS3 E;  1KKK A;  1H19 A;  4XMV A;  2GTQ A;  4TLN A;  3TMN E;  3U9W A;  4D9W A;  3B2P A;  1Z9G E;  4N66 E;  1TMN E;  2A7G E;  4K90 A;  4TNL A;  3DO1 A;  3T8C A;  3FUM A;  4XMT A;  3TLI A;  1FJQ A;  3FU0 A;  4RSY A;  3FUE A;  5FXN A;  3FTY A;  1FJT A;  3FXP A;  1ZDP E;  3FCQ A;  1EZM A;  4X2U A;  4PW4 A;  5AEN A;  3EBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...