5C97A

Insulin regulated aminopeptidase
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
866
structure length
860
Chain Sequence
LFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Leucyl-cystinyl aminopeptidase
publication title Crystal Structure of Insulin-Regulated Aminopeptidase with Bound Substrate Analogue Provides Insight on Antigenic Epitope Precursor Recognition and Processing.
pubmed doi rcsb
source organism Homo sapiens
total genus 263
structure length 860
sequence length 866
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 5c97A02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 5c97A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 5c97A01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5c97A03
4XNAA 4Q4EA 4NAQA 4FYSA 4XMUA 2HPOA 5AENA 3B7RL 4ZX6A 3CHSA 4ZW7A 3FUHA 4XNDA 1Z5HA 3FH8A 4QMEA 4XNBA 4PU2A 4FYTA 4ZX3A 3FUNA 5DYFA 4XMWA 4RSYA 3Q43A 3FU6A 4KXDA 4MS6A 3B2XA 4XN2A 4HOMA 4XN1A 2HPTA 4R5XA 5LG6A 4XMZA 4ZQTA 4KXAA 3RJOA 2DQ6A 4QHPA 4K5NA 4XN7A 4XN9A 4R7LA 4QIRA 4PVBA 5AB2A 5AB0A 5FWQA 4FKHA 4ZW8A 4XMVA 2XPZA 2XQ0A 4KX8A 2GTQA 5DLLA 4E36A 3FUJA 3CHQA 5K1VA 3FTSA 4ZW5A 4KXCA 4FKKA 1SQMA 2VJ8A 2DQMA 4ZW3A 4L2LA 4XN4A 5J5EA 3FU5A 4KX7A 3CHRA 3FUMA 2XPYA 1GW6A 2R59A 4DPRA 4R5TA 4Z7IA 4K5OA 3EBIA 4XN5A 5CU5A 3B37A 4XO5A 3FTYA 5LHDA 4FGMA 3KEDA 5BPPA 5LDSA 5C97A 4ZX5A 4ZX4A 4FKEA 4XMTA 3FUDA 3FTUA 4K5MA 1H19A 3FUKA 3FTZA 3B7UX 3FH7A 3FUEA 3FUFA 4KXBA 4F5CA 3FU3A 1HS6A 3EBHA 3MDJA 4PJ6A 4R5VA 3FU0A 4XO3A 3FTVA 3CIAA 4KX9A 3FUIA 3Q7JA 4MKTA 4XN8A 3PUUA 4P8QA 4RVBA 4ZW6A 4PW4A 3B3BA 4X2UA 3FTWA 4QUOA 5J6SA 3CHPA 4XMXA 4J3BA 4JBSA 3U9WA 3B2PA 4K5LA 3CHOA 3B34A 1Z1WA 3FTXA 4Q4IA 4WZ9A 3FH5A 4FYRA 3SE6A 3FHEA 4FYQA 4GAAA 4OU3A 3EBGA 3T8VA 3FULA 4XO4A 3B7SA 4K5PA 3B7TA 3Q44A 4QPEA 2ZXGA 4NZ8A 3QJXA 3QNFA 2YD0A
chains in the Genus database with same CATH superfamily
4YFDB 3U1SH 1IKNC 1NIAA 1D5IL 3WKYA 4K3EH 4OIFA 3QJHB 3KYMA 3H0TA 1JFHA 3O45A 3C6EA 4JG1H 5JOFA 3MBEB 3T8XB 4G1EB 1IQWL 4GSDH 4AJWA 3ZKXC 2ICWI 1PIGA 3BKCL 3IU3A 5ALBH 1ADQH 1TYJA 1P7QD 3KPRA 4QHNB 3SDDD 2ZCKH 4KXDA 2R0KH 3LCYA 4E68A 4KUZH 5TD4A 1BZOA 1JGIA 2W80C 3FQWB 4LFHG 3RQ3A 1QNIA 3NCYS 5C09D 1KENL 3RDTD 2VDPB 3OXRB 4A2HA 5HVHC 4PVBA 3IF1B 1Q8MA 3ATFA 1JDDA 1WIUA 1AFVL 4MCYA 4Y9BA 3V2AR 3QQDB 1YPZF 4F8QA 4B7IA 4GEIA 4OI9A 4I4WA 1GXEA 5IUSA 3P4OB 5D7JA 1OWRM 3S3JA 3ZUCA 5DVLA 4HK3N 1S9VB 4QEGA 1QI4A 3KLSA 3BVNA 3TBVB 1PZDA 3II2A 3BN9C 4WFEE 1U2YA 5DEZA 5BQDA 4EZKA 3CDCA 5D9SB 1N6QL 3UGEA 2I32A 5L2KB 2CR6A 2QHRL 2XWJA 4G6JL 2DTML 4IMLB 4KUCF 4XVUC 4E5XA 4MVBC 2FEEL 4AENA 2BIMA 4ZAKA 3IDUA 4B27A 4IOIB 4H1LA 3HC4H 2A5UA 3LIZH 3CFJA 2BOCB 3BQUB 3OAUH 1JPGA 2C9QA 2OMXA 4OZGB 3VGHA 1HKLL 2UVEA 4BE6A 3WU1A 4HEME 3E0GA 1G0DA 5E6IC 1UWEH 1KELL 3K1DA 5IMKA 4S2SA 3T3PE 4PP1D 1G7HB 4OBRA 4S1DC 4I3RH 2QGEA 3E80A 3CFKA 1DQKA 3C60D 3KPSB 5CEYA 1JNJA 1CICD 5L2KE 2ESVA 4H5SB 2AV7A 2VZVA 3ELAT 3QQ3A 2G2RB 4F7EB 4CBZA 3DX3A 1Z3RA 4NZDA 1LP9F 4CC4A 4FA8A 5GZNC 3T04D 2GTWB 4Z7OB 5CZKA 2H3NA 4FZ8L 1EPFA 3FQRA 2D0HA 2FQEA 4MBOA 4U6VL 5CKAA 4GRLA 5FM4A 3QPXL 3EYUH 3NJMA 2HT4C 4GS7B 4KPHH 4HW6A 3V7MA 4RISL 2ARJA 4K3DL 4U6HA 1HH6A 2FJFA 3NGBB 2CK0L 1PZUB 1LL1A 2E74C 3BP4A 2PWGA 5HYEA 1I4FA 1R19A 4E9TA 3H9HA 1ZT1A 3O3BB 3AM8A 3L8QA 1S7UB 3C09C 5FCUL 1WZ1H 4FL4B 3EYSL 4OJYA 5D1QA 3VRLF 4ZT1A 2YD6A 3NJLA 1EZMA 4MNQD 1FVDA 5JLZA 4LRNH 1QRNB 3TYFB 4E9SA 1A4JB 3C6LA 4OH2A 5EZJA 4W9EC 4JB9H 3OBAA 5CMAA 3QHFL 1A6UH 1CB4A 4BFJA 1DL7L 1T5XB 4AKPA 2FTAA 2W9DL 3AB0C 5HGAB 5C0JA 2E6PA 4XNZB 4APQC 4YBHA 4OD2B 1DJZA 1CGSH 1NBQA 4L4VA 2FBOJ 2YGNA 4XO9A 2XV3A 4HDIA 1DQLH 5JDSA 1K4CB 4ZW8A 1TEFA 3T1WA 2OMWA 1SDAB 1YYLH 2X89D 4CMHB 4YHML 3ZHLA 5D1XD 2AW2A 2AV1A 1JDCA 1FNEA 1G1CA 3D39E 3VXMB 4CBPA 5EIIB 4ZXBC 1U30A 3L4UA 3EH1A 2EXYD 5C1MB 1ORQB 1X5GA 4XTRC 1MHCA 4B9FA 4H0GA 3T3MB 3ESOA 4CVWA 3K6DA 4YDVA 5EEVA 4NNPH 5FO9A 4A55A 3ZE0E 1EGJH 5TFSH 2CNZA 5ID0A 1HEZA 2UWEE 4ZFGL 2GJJA 1HZHL 4WFGE 3V0DA 5IEHA 1IX2A 1A4KA 2Q86A 3PWLA 1A14L 3A24A 4XC3H 1S3KL 43CAB 5JR1L 3MOBH 4ZSOA 4C4BA 3HBQA 3MSPA 1AKJA 3OMAB 4R2GD 3I6LE 4WFFD 3QDMA 1F18A 1R3LB 1GJUA 1PLAA 2VLKE 3SBWC 5I5JA 4GOSA 1NBYB 2FX7L 4HIIB 4JUSA 5SWSA 5AOZA 5D6DA 1UXLA 1W6WA 3S5ZA 1YCSA 4GG8A 3RU8H 3ZL4L 3EOTH 1C1EH 5IZ7A 3HNSL 4LGPB 2OMVB 3LS5L 3BT2H 4PLOB 3ZXAC 2D9QB 4XN8A 2BVPB 5CGTA 1I8IB 1FZMA 2HT3C 3LXUX 3Q8EA 4Y4KD 3UBGA 5EO1A 3HCVA 1GSMA 1H6TA 2HSIA 2QMKA 2E5EA 4HS6B 4PRPA 1XH2A 3B5GA 3HEIB 3IVKB 5ES4B 4JX0A 3D6GA 3QH1A 5DPEE 4W9GC 1IEHA 2M1KA 1AR2A 5C0CA 1VFBB 1F4HA 1ZVSA 4MWFB 4RGOL 4X4MA 4PCTA 5AVZB 1Z5LB 1PZ5A 2BSRB 1U3HA 1A3RL 4UT9H 3M6DA 4LF3A 4KROC 1MREL 5KS9B 4JLRA 3TJEH 2JFCA 1Q90A 1B0IA 2CH8A 3HB3C 4DN3H 3VI3F 1TG8A 4OFQA 2FJUB 3IJYA 1XWVA 5T33H 1DVFB 3TBYB 3HC3H 5FYJD 2RALA 3STBA 2FLBT 1D6EA 2B14A 3B7RL 1V10A 2J88H 2VZSA 3AWEA 1MFBH 5LCVA 1E5AA 3P7VE 2HP4A 3U0PB 2WWOA 4B97A 2CHNA 4TNFA 1AZUA 5DYFA 2R0LH 3E6FB 4GQRA 4OZ4A 1LK2A 1TLIA 3O3EB 1VJSA 4X7TB 1NSNH 3SD2A 5DQDL 1CFNB 2MRYA 3ZBMA 1W72L 4M4PA 2BSTB 3KDMA 1NC2A 4KJQC 5DRZA 5A7EA 1R6VA 3CPLA 4XMVA 3PAVA 2I69A 3V5DA 1GL4B 4YS4A 2W9EH 4PY7A 5GS1C 1UXSB 3LQMA 2ICWB 5HD8C 3QJZA 4HSQA 2BZCA 3MJ8B 1JTOA 4LMQI 2VJ8A 1E3XA 2F7PA 1IO4C 1P1ZB 3IFNL 2X7LB 4RFOH 4KZEL 5LIFE 3DV6B 3WENA 2CDFB 1A3QA 4LLWA 4QOKD 4P2RA 3I6GA 2FH6A 1HCYA 4RDQF 3Q3GA 5IQOA 1G9MC 4GYBA 1HHJA 2AGJH 3U30B 1HSBB 5E8OA 3B37A 2WBJC 1E7UA 5ALCH 5B22A 3VACA 6PCYA 1N7MH 1HQ4A 2TRYA 1CG9A 5E2UH 4RNRA 5SX4I 5F7DA 4P57B 1CDYA 1U92B 2CUAA 2IDTA 1R3JA 5F8RC 2YHGA 5FKAA 3JWDL 5L4FA 5KVEH 3IU4H 3S2CA 3UZVB 1MWOA 3TO4C 3MLUL 4YK4C 4WWNA 3IBEA 4Y2OA 1P69B 3CIAA 3N41F 3MJ6A 3VFMA 4EZJA 2OZ4A 4IRJC 1EZSA 4KKQA 1ZXQA 1X5YA 3FRPA 2GBAA 3ARDB 3WFBH 4U0RC 4RMVA 4YE4L 4D9WA 5D5ME 1QSFE 3MROB 1UD2A 2BC4B 3FO0H 1ACYL 3MN8A 2BH0A 4NQDD 4U31A 4D9LL 5D4QA 2EIZA 3BWZA 1CLOL 3L9EA 4OFVA 2ZWKA 2VLMD 3REVB 1FHGA 2J4WH 3E8UH 2FH8A 3UAAA 1SLVA 1FLRH 4H88H 4JM4L 3VVVA 6TAAA 1AO7E 4DP2X 3UG5A 1I7UA 1H3XA 3KHQA 1AYRA 1KCBA 1MFDL 4ODVL 1JZ2A 1UASA 4K55A 4GKZB 5CNHA 3RY6A 1K3IA 1BJMA 3V0AC 5JW3H 1NIEA 3DX1A 3G08B 4NUGL 2FT6A 4FQCL 4XNAA 5AAWC 1MIML 3T73A 1VHPA 4Y19B 3I2CL 4PS7A 3T8XA 4JRYE 3DUSB 3M17B 1UM6H 3DOHA 1DLFH 1CYXA 1I3RB 1KGYE 3NSJA 3QWOA 3TV8A 1S7SB 4Q97A 4JFTA 2FO4A 4K94L 4MQSB 3UTTE 4QRSA 1NKRA 3FQWA 4XGZA 4HPHA 1M6OA 3ULSB 1QD0A 4L8SA 1DFBH 3RX9A 4YZFE 2I25N 4KKLC 2R1WB 3W0WD 1U33A 2ZSWA 1KEMH 1NOFA 3L3HB 5DHVH 4YHLL 3QQDA 4L8BA 4PRDA 4V1DE 4N9GB 5FO2A 1JNHA 3WG7B 1X7TA 3BPLB 2DJ4A 4PJ5D 4IJ3C 3NFNA 3P4MB 2GW5A 2ITDA 4HC1H 3TNMB 2K3TA 4JPSA 1S9VA 1HWHB 3F00A 3X1FA 1S78C 4TUJA 2IWFA 4FQLH 2F0CA 2TLIA 5J11B 3LPFA 2UXFA 4OZHE 4WTWA 1KF9B 1NBZA 1TMQA 3VXNA 3EUDA 2L7EA 1JNNH 1KJ2L 2A7BA 5K9QG 1W0VB 3S37H 4EQ3A 5B38G 1QBLH 4IMLA 2OW6A 3PWVA 4PGEB 4AOFA 3FT9A 1YY9D 4UTBH 1NEUA 4OAWB 4UNUA 5FUZH 1Y6NR 1UA7A 1OT4A 4Y16C 5D7IA 2XKSA 1DQMH 3FHQA 4IOIA 5AW6B 1SVCP 1FLTX 4H4NA 1GC1L 5JPMB 5AL8A 3ZN6A 5DURD 5KBNC 2CJTA 4PRHA 3SE3A 4JPIA 2JSFA 5KBPA 2PMZA 4QCIA 3LKPB 5D8JL 3FUIA 4PJEB 1G6RL 3D4ZA 4BZ2A 3DX4A 3BYTA 4YL9A 1J1OL 4TL4A 1A9EB 4Y7MA 3KPSA 1Q0XH 1RUKH 4OUUB 4U1GC 1MJUH 1G6VK 3O2DL 1UOWA 4H5SA 6PAZA 4XMXA 2G2RA 1MHPL 2IOMA 2WXJA 3WEOA 1WHOA 4P2OC 4YX2H 4R9HA 4NQQA 2UVFA 1KJVB 2GTWA 3BN3B 1R3KB 2R7EB 3EO9L 3MJWA 4DN3L 5J12B 3OMNB 1XGZA 5HI5D 4HWZB 2FO8A 3WFCH 2FJGB 2XQYG 1LNEE 5TE6H 1NCGA 3MKGA 1NCCH 2EYSA 4N66E 1FFPB 2SEBB 1FZKB 5EEWA 2YAOA 3ZTJH 3PYCA 2Z0UA 2G2NA 2ZSVB 3CLWA 2PNDA 1S7UA 1OPGL 3LKQB 4YQXL 3NJVA 1AQHA 3BRGC 3NCYP 3RVUD 4HIXH 1YEEL 4HUUA 2D8KA 4BQ6A 4XMUA 4AYID 3H7BA 5IB4B 1KFAL 3G5VB 4M7ZC 4XPGL 4YDZA 4RWYL 1QRNA 3TYFA 1M57B 3T8DA 1A4JA 4LCWE 2BOBA 4LP8A 3OB0H 2WO2B 3BZ4B 1P5UA 4JFEA 2VC2L 1HH9B 1J8RA 3QDJD 3IETA 3NN8B 4YDIL 5HGAA 1PKQA 3DVNB 1EXUB 1TU2B 3DVGB 4XNUH 5FGSA 1UQSB 1FBIH 2UX6A 3CN4A 3PP4H 3IYLW 2G4GA 5I1IL 4FMFA 1P84K 5ISZD 3VXMA 5KSAA 5FUCC 5DMYA 2OKMA 1HSAA 3VRJA 5EIIA 4JG1L 1T3FA 4OZIB 4GSDL 2YQBA 5FPIA 4FADA 5ALBL 1ADQL 1GSKA 5C0GB 3EOBA 5EN3A 2R0KL 3FUMA 4HHWA 4DGVL 1T0NB 4OGYH 1U8CB 2Y6TE 5EN2B 1RJCA 2EABA 4FX5A 4PRIE 5F3BB 4BGDA 3WGUB 3QYNA 1AAJA 2CIKB 1GYUA 3ZU8A 1AQDA 2XHNA 4KFZC 4ZTPH 2EYRB 1XCWA 4TRPL 4N8CL 4EKJA 43CAA 4L4TD 1YQVL 4B95C 3P0YH 4B0MB 2VDNB 4PD4K 4WI7A 5FSPA 4JG5A 4HJUA 4PR5B 5JPNB 1QKZL 2V5SA 1J86A 4GI9A 4XP1H 1LHZA 3OJDB 2IQ9H 4NO5A 1UFUA 4OI5E 2KS0A 5M95B 4HPOL 4NJAL 2F8XC 1HFUA 4XC1H 2BVPA 3LVEA 4LL4A 4OCRL 5DZVA 4QRRD 1BEYH 4L0PB 3ARWA 5A7BA 5FYJU 4HS8H 3KPOB 3MLRH 5M94B 4YHYC 3LNDA 2ORBH 4M5ZH 4PB9H 3BPOB 1MAML 1I53A 3CK0H 2Z4TA 3IVKA 3WJLA 3RVWD 3U9WA 3DVIA 5JHDB 2APWA 4WI6A 3UAJC 5AWNL 1OSYA 5CBEB 2E59A 1ID5I 5HDBF 1VFBA 4DKTA 4HULB 1YMMB 3QPQC 4H8WC 1AIFA 5GJTH 2X53A 3B3IB 4K07A 5JW4M 1Z5LA 3OGCB 2BSRA 2VR4A 3OAUL 2CGZA 3GI9H 2DI9A 2IBZX 4FQIL 5SWQA 4MDIA 5KVMC 4EN3D 4X6FA 1DR9A 1IQDA 2V9TA 1CR9L 4I3RL 1OM9A 2V6HA 5FDYA 2UY6B 1TNMA 2Q8AH 3EJYD 4DO6A 4F91B 2FT7A 4Q4EA 3FQ1A 1KCVL 5LBSA 1X7QB 2FLMA 3VG9B 2ADGB 2ZUUA 3RL1B 4JS7A 1NM9A 1ACCA 2I5YL 1XEDA 2F7IA 3E6FA 2V2WB 3QW9A 1Z32X 2ITCB 3FB6A 5H2BB 5I9QC 2CM5A 1QSEE 2JKWA 3MV7B 3ESVF 1SN0A 1FH5H 1KTJA 2WWKO 4LIQL 4U2ZA 4D7BA 2M83A 2AJVH 1I1AB 1KXHA 2C4FT 1KCSL 2NQCA 4Y9EA 1WZ1L 1R0AL 3VXUE 1VCAA 3BD4A 5T5FH 4EUPA 4PV1C 4NKOB 3MJ8A 1B2WH 5F9AC 4MZIA 1YHPA 1HI6A 2X7LA 2Q3XA 4Y2DC 3NCEB 4ZW3A 3MGAA 4EXPX 2V3EA 3U83A 2VLLA 1KL6A 2FHFA 1MKFA 4DPRA 3VXRD 2KI6A 4HWUA 1S2EA 2B8OT 4QXTB 4P2AA 5CCGE 1IGCL 5F6HI 2CRYA 2DJUA 4BFKA 2FEDD 1YYLL 2FB4L 4W9JC 3EO0B 3O6KL 3SCMC 2GUOB 5IMOA 2DM4A 1PG7L 5IF0B 5A2AA 1MI5E 3UZVA 1AE6H 3VD3A 3HFFA 5SWZB 3OL2A 4NB7A 5EEZA 4QXUH 4GUQA 4NFBA 1IMHC 4ETQA 2Y5EA 1SJEA 3HPLA 5PCYA 5A2JH 3I84A 1KG0B 2EKJA 4CC1A 1GMIA 4O9HL 1BOGB 5EWIL 1AS8A 4X4XA 3W57A 2F54B 4MMZC 3RILA 3CFUA 4ZD3L 3C5ZB 3D3VA 4GW1B 1S3RA 3ZDXE 3MZTA 1YYML 3UTZB 3QWRD 1ET5A 1KUMA 4J3OH 4Y4HD 2F5BL 1BV8A 3QO1A 3GRWA 2HLFC 3WIFA 1HYSC 1QPXA 1N67A 4F15C 3NJJA 4HU2A 1SEBA 2NY6C 2UXVA 2NY4D 2FAUA 5D6CB 3BWAB 5C07E 4K8RD 3BEVB 1W9XA 1QQDA 1TVDA 1DHKA 1U8IA 2OS7A 5EF0A 4G11A 3HLAB 3NYKA 1TVBB 4Y19A 5EOCL 3IS1X 4PEEA 5DJXA 3AW5A 5FUOL 4GKOA 3DUSA 3M17A 3W9DA 1MIEH 3L4WA 4HPYH 4PGDA 1S7SA 2JCCA 1SBBA 1V54B 3LYRA 1JZFA 2DKUA 4WGWB 4C54A 1QEXA 4DO4A 4E9VA 3SBWA 2G60L 5EDXA 3ULSA 2GI7A 1ZVYA 3GSQB 3SDAD 2PPDA 4M00A 4JY4B 2QVTA 2PYED 4BEIA 1OTSC 4X5QA 3OAYH 3V4VB 2Y07H 3SYPA 4N9GA 5T33L 4X0KA 2V5MA 2IPKB 4UTAH 3FF8A 1W0YT 2J88L 2HJFB 3HVNA 3RWEA 1MFBL 1DSYA 2KDYA 2CNYA 2ICEC 1DJHA 1FSKB 4E2OA 3NP3A 2DYPA 3QI9B 5IV2B 1DDTA 4ICWA 4J12A 4Z0XB 1U3ZA 3RFZC 1UM5L 4NI6A 4OF5A 2J43A 4GT7A 5JT9E 2VQ1B 3MRLB 4ZMNA 2OAAA 4JDEB 4DTGL 3SE9H 1MH5B 1HOCB 1MW3A 3PWNB 4U6YA 4JPVL 1W0VA 2GI0A 1NSNL 2XZAL 5F7WC 3MV9A 1LNBE 3EBIA 4ONGH 1B0GA 1S9WA 3F62A 3U46B 4H26A 2CGRL 4U6TA 2W9EL 1MCKA 5JPMA 4A6YH 2X70A 3GXPA 1CCZA 5IVXE 3TEWA 1IC4L 4X42A 3GXTA 4RFOL 5IROC 1ZD6A 4JGNA 1KJ3H 1NTDA 2VLJE 4UQ2B 4FFWC 4PJEA 5ICXB 2BP8B 3N1PC 1BAFH 4JO3L 4XNYL 4NQTA 1WAAF 3CN0A 5ICYA 2WHZA 2WBXA 3B2UC 2Z31B 3MRJA 5TJWK 3PPEA 5L4JA 1J8SA 4LVHB 2QQKH 3VAEA 2HFFA 1FORH 4LLMA 4FTVE 1T22B 1U93B 5E8DH 1GOHA 2LV4A 3NIGF 2R23A 2RIKA 3BP6B 1NPJA 5E00B 4ABWA 2R7EA 4DGYL 5EF3A 2N0MA 3EZ8A 4BFFA 4GIOA 3ZDWA 1P9MA 5GS1A 3QDGE 2GY5A 1YPZB 4FI6A 3PGCB 3AABA 5GGTA 2C7UB 1G7LB 3DURB 3UH8A 7PAZA 3LZLA 3PL6B 1YNKH 4W9KC 4YHIA 3CQQA 3UPRB 5D71L 5C0AD 2J6EA 5DRXB 4DK5A 2ZSVA 3H9YA 1W15A 2QV4A 3NPSC 3OKYA 3WIIH 4RDBA 3WEMA 3GBNL 2P45B 2ED7A 5DHMC 4Z3GA 3GBEA 5LQBL 2VABA 2WBJA 3S5LA 2HKHH 5EZOH 3IT8D 3NEXA 1U21A 3G5VA 3QFJD 4GRMB 3LDBC 2BSEA 2J4WL 2WINB 3E8UL 4OZFH 4Y1AA 1E50A 3IK2A 3JUYA 2CJSA 2X4OB 1FLRL 1NH6A 1PG7W 1HHHA 2VNCA 4H88L 1RPUA 3DNKA 3CZGA 3FQUB 4K90A 3CDZA 2ZJSL 4OLXH 3HLKA 1SJMA 3QIWB 4ZFQA 4RAUB 1XIWB 4FJ6A 1EXUA 5E6ZA 3TO4A 4PB0H 5A6IA 3TA3D 1CDJA 2XFXB 1MJ8H 5IQNA 2YD2A 5LJYH 1TTUA 4IRJA 5IVNA 1CXKA 1J10A 3OKOB 1Z0MA 1NICA 2DMHA 1GYAA 3V6FB 2R39A 2J71A 1CDHA 3LOWA 3WY1A 2OM5A 1AC6A 2W94A 3V4PA 3RHWF 4OZIA 1UM6L 2XG4A 1XDTT 1QPKA 3RNKB 1BBDH 1OXYA 4BYHA 4XR8C 2JMRA 5D93B 1KB5L 1U8CA 3TN0C 5J5EA 1C12B 1LP9B 2WSDA 3RBSA 3L4YA 4AYFB 4BH8B 5DK2B 5F3BA 3V6OE 1I3VA 2CIKA 3GSOA 3F7YB 5L7XH 5DMIH 5HGDA 5HYJE 4G5ZH 4N6QA 4P23C 1P84J 5FXCH 3VVWA 4UDUB 3RPIA 4XB7A 1TTFA 1HJBC 3CXDL 1EZVY 3DYOA 3SY0B 3ZE2F 4ZUWB 3B2VH 5JPNA 3NESA 3MTRA 4AVKA 4O51B 3Q1SH 1B9ZA 2WCSA 4KGLA 3WEAA 1YQ2A 5BVJA 1U8KA 5AAWA 1HINH 1IV8A 3NDZE 4N8PA 4UOW0 1CUOA 5CR8A 5CEZE 4PN6A 1Q9LB 4X9HA 3IGUA 3F84A 2XPGB 3KWXA 5HI4C 5FB8A 2AEPH 2L04A 5CFHA 4N0CD 3BGFC 2XDHA 4PD4J 4PJXF 4PYHA 3RUGA 2GIXA 3RWGA 1LM8V 2PKDA 3CFMA 4UTBL 2OYPA 4MWPE 4YNYA 2H32H 3SDCD 3VB9A 3DO7A 4MXJE 1UB5B 3CHPA 1ZOXA 3UYRL 4WUUD 4J3BA 1ORSB 3HG1E 1DQML 4AGNA 2V33A 3OLEA 3QJRB 4PJFA 1C9SA 2OL3H 2AITA 4O2EB 4H2AA 3ZL1A 3DECA 4Z7VA 1CDUA 1E5ZA 2K6ZA 5KBLA 4U1IA 5I2IA 3WHE0 1F4XH 1N0LA 5FYJL 3RIFF 4B5EA 5A6LA 5CXPA 5B39G 2VSDA 4OJAA 3INUL 3RPBA 3E1F1 1PE7A 1E8YA 1E5UI 1X7QA 2KKQA 1CD8A 2YUZA 3PAUA 1JPST 3RL1A 3UBFA 5CLYA 3DC0A 3TBTA 4Y16A 3VCLA 3WFCL 4JPWH 1RURH 2ZZUT 5DT1H 2B08A 3LD8C 2F53E 2DQGH 1OAQH 4TLIA 4K23L 4NCC2 1FJWA 2ZKWA 3FRUA 3MGOB 5GQBA 3QR0A 2VXSL 4KQ3H 2IAMB 1XH0A 1I1AA 1NMBH 5KBMA 5EFIB 3JWOL 1WBZB 2PXYD 2A9ML 2NY1C 1NA8A 4HIXL 1F6FB 3Q8FA 1VF5C 4PJ7A 1M3IA 1OCWL 1WTGT 4KKAD 2W1NA 3ZT7A 2OMTA 5ILTH 3UEQA 1QR4A 5IQMA 1D6VH 3EFFA 4YHPB 4GFTB 4YVUA 2N1TE 4P2OA 4AYMC 3VW3H 4ABQA 1J05B 5CO1A 3V95A 3DGGB 4M1GL 1OSEA 2ENPA 4XI5D 4XPBH 3V6BR 4PJGF 3IDGA 4FQPA 2KDGA 2Z1KA 3BUYA 1FBIL 4UT6L 5E4OA 1I75A 5ACMA 1QW8A 3ARBD 4GRWH 5AOMA 1RIHL 1FV1A 1UWFA 1JVLA 3EO0A 4ELKA 1E4JA 4M56A 3SE8L 3PP3H 3K71B 3L3GB 1T66D 1T5WA 4KNSA 2FR4A 5EU6D 3VI3B 4PJHF 1SBSH 5K59F 4YGVA 4Q9RL 3A4EA 1NDMA 4Y5YC 4BSVB 5SWZA 1AR1D 3K8MA 2B1AH 5DVPA 3RVVD 2V3FA 3UPCA 1W72B 2VXQA 1FJQA 1T4KB 1PZAA 2O5ZH 1EUUA 1IGYA 1BD2B 4OGYL 5MEOA 4FNLL 4N6RB 4WEUD 4YAQB 4B9YA 1CS6A 1REIA 2A0LD 2K7QA 5ETUB 2F68X 2YPLD 3T8GA 1BOGA 1S5IH 4FP8L 1F1GA 4J2QA 4YBQD 4ZTPL 2Y7OA 1IBFA 3IFLH 5FYLH 2VLRE 5EO9A 2WNXA 2F54A 3BUBA 3C5ZA 2D7NA 2OFQA 1IBHA 1TZOA 3VJ6B 1J5IA 2I9LA 3GWJA 3QEGL 4JG0L 1LNAE 4H0LC 3JBG7 4PJCE 2J8UF 3SO3B 4PBXA 1Y18A 3GMNA 2O6PA 2B3RA 3AS3A 3C5SB 3K2UL 3P77B 4KJPD 4OKDA 1JN6A 2EDJA 4GAAA 3T08A 3L7EB 5I0YA 2OYKA 2PETA 1IL1B 3BAYA 3MODH 4FZEH 3AY4C 3GHBH 4WSGA 2O5XL 5D6CA 5E70A 4HS8L 2HMIC 2D73A 3FL7A 4S1QH 5GJSH 3WOVA 1OGPA 2X3CA 1OE1A 1U8QB 3HLAA 4GQ9H 1XR9B 2AJZB 2YA2A 4PREA 1HHGA 3IJSB 3B4NA 3N1FC 5D96C 5AALA 1GIGL 4P46C 3DSFL 4MJ5B 5IQ7H 1FA4A 5EZPA 1BZDA 2R0ZL 2COQA 2H8PB 3LH8A 2ADFH 2V9UA 1PX8A 1QEWB 4E9XA 5FYLE 5GJTL 5JOPE 4I1RA 3PDGA 4ZS6D 3FUHA 1A7RL 3TT1H 3GXNA 1IBGH 3OSVA 5C6TL 4JE0A 3DI3B 4WW2C 4UOW1 4R7XA 1J0HA 1HESA 3VQ2C 1MVUA 4FF9A 4ATWA 3TEZA 2NR6C 5GGUB 1TTCA 2A4ZA 2WMPA 1T0PB 4YDNA 4URTB 3N41B 3MLTA 2IPKA 4UIKL 2Q8AL 1KYUA 1BJ1H 1XEUA 3DO3A 2HJFA 1N26A 2NYYD 3BLKA 2R8SH 1XBDA 3LNGA 3R1GH 3WHXB 2YRBA 3QI9A 5IV2A 3DJRA 4Q9BA 3J7HA 1T1YB 1ZLWH 4Z0XA 3T0EE 2FNBA 5FGBC 3UAJA 1RY7B 3IXTB 3T2QA 2EVGA 4I9XA 3IGKA 4JDEA 2APBA 1EJFA 1MH5A 3O6FB 4A7VA 1FVCA 2MQGA 3PY9A 1TJGL 3BAJA 4N2IA 1O9VA 2XACC 1FJOA 4U4BA 3Q6GL 3WHE1 3JV0A 1UJ3B 1FYTB 4XPHH 2GT9A 2AJVL 3V4UH 2YC1A 1D7CA 3AT9A 5IIEB 4FQJL 4JCWA 2G30A 4QWWD 4Y1TA 3RAJL 4NRYB 1JBJA 1IEBB 1LO2H 1BX2B 4JFQA 4PJ8B 1T1ZB 2EDEA 3VSQA 4YHZH 3WUWG 5HDLA 5HGGS 2D4FA 4JY5H 1XMWA 1PPIA 1ZLSH 2EC8A 3LZFH 2N1KA 1NMAH 3PIQA 4XMLL 1D5ZA 4F7MB 2BJMH 2BP8A 3FCUB 4N2DA 4P5MB 3WY3A 5FA3B 2YMXH 1W8NA 5DZNA 1PBYA 3ABZA 4R97C 5JA8B 3AMLA 3HRZC 2YQ2A 4DCQB 3NEOA 3GZKA 3V4LA 4RVBA 1UM4L 3DTXB 4PW4A 4KGJA 4C4KT 1FYTE 4L8DA 3DJTA 4MZ2A 3SBRA 2VB5A 2F7RA 4GKNB 1XBRA 1EXGA 1MN4A 4FAAB 4LASL 1MCOH 1JZEA 4XCYB 1BM7A 1KJ2B 1YPZA 4Y5XB 4FQ1H 3KYOA 1MOEA 1G7LA 4GERA 2G5BA 4CILA 1MWAA 4J3OF 2YD4A 3UPRA 3GXUB 5DRXA 5A3IC 1IGMH 2WWMD 1H9VA 1IM3D 5F70A 3VH8G 2BNQB 5DRWB 3X14B 3D51A 3UABA 1UWGL 5KYNA 3JXAA 1WP6A 2XTJD 3IM1A 3PV7A 3UBXG 3GB7B 3L3JB 2A6DA 3TM6A 1AGDB 4GRMA 5L2JA 1N5YH 3IDYC 1NAMA 3PXLA 2WINA 3TPUA 2Z7ZA 1G6RB 5D4IA 1AXSB 3UADA 43C9A 1JWMB 1SM3L 2DL9A 4ZX6A 1KIPA 2C9RA 2GJ6E 2NNCA 3B9KC 1KXVC 4RH4A 3VXSD 5I73B 3SCMA 1XF2A 5E4AA 1JWUA 1XIWA 3H9SD 3T2NL 3D2UB 4TS6A 3WD5L 3PXHA 3T65A 4JM2C 3IJ7A 2BW4A 4PJDF 1YC7A 2CD0A 3SBPA 1QHQA 1KCKA 1A64A 2QPEB 1G7JA 3U6RB 2R9HD 4TPRH 4Z7WA 3U0TB 5BXFA 1IAIL 2WO3B 4LKCA 1WFJA 1I9EA 4NCC1 1MIEL 4TNGA 3RNKA 3L1FA 1RUPH 4MMZA 4NRXA 1P4BH 1GH7A 4ZYKA 1URIA 2GFBB 5CN3A 2YKLH 3O6ML 1EANA 4HCRA 1OIOA 4P2CG 3VRIA 1GCYA 3S98A 4D9QE 4DKEL 2B9AA 4LAQH 1ZIBA 2CRMA 1S7QA 1JI2A 4K5OA 4LU5H 3HMXH 4CJ0A 3WNJA 4X9YA 1KBVA 1DQDH 3OSKA 4OTXH 1E4HA 1CL7L 5EUOF 2OYLA 2QHLA 4KKCC 4WHTB 1HNFA 8TLNE 2VC2B 1E6JL 5IBTH 5T3XE 1IAMA 3WFZA 4HF5L 4HD9A 2IFFH 3HBPA 5JIDA 1XGYH 1MCPH 5KYWB 3MXVL 1C8QA 1NFDA 1X4ZA 1U8OA 4DGUA 1C5DA 1G5GA 5T1KA 5IHWA 1QR1A 3D69A 1JNLL 1M71B 3C5XA 1BZ7A 1RH8A 4ODTL 4ADIA 3KCWA 3CFDB 4DQOH 3D05A 4NQCE 1AP2B 2XRAH 1PLCA 5DS8B 5DTFB 3SPCA 4BXVA 2I9TB 1P4UA 5AW4B 5C7ZA 1RIUL 1ES0B 2IH3B 1KJ3L 4OCYH 2O5YH 2ICEA 3RTQC 2DQHH 5AG9A 1BAFL 4MNHB 4PLJC 5DMGC 3RVXC 5CJXC 3RFZA 5BZDB 4LHQB 1P5VA 1LILA 1Z9LA 3Q9PA 2QQKL 3Q44A 5DUML 3OJMB 3PQYD 5EIVA 4L3CB 4OIBA 4EOWH 3V5KB 4E5XG 3MFFB 2EDTA 4G7RB 3HJ0A 3QNFA 4AIZB 5GISL 1DUYB 3OHMB 3QPKA 4H1LG 2QTEA 4HGKC 1MCJA 1KIUA 2LAGB 4BFIA 2PTTB 4AGOA 2QDWA 2DOCA 5GRXG 3K2MC 1YNKL 4L1HA 1E28B 3MGOA 3F05A 4RGNB 3FUNA 2H2PC 4NO3B 3ZRCC 5IROA 3U4AA 2IAMA 3QEQB 5BRZB 4QRQB 1BDYA 1KY6A 4JR9H 1UATA 3IPBA 5EFIA 3EJUA 1MCNA 2ADIB 4ELME 1SDYA 4HJGB 1KCWA 1MAJA 4MXVF 4Z7UF 2FATH 2VQTA 3RDJA 5EZOL 4MNGB 1SVZA 3II1A 1ZV9A 5I8KL 3CZJA 3EJSA 3KLAB 4FQXC 2I60H 4NPJA 1TR7A 1UFGA 4CU8A 4LRIC 4NQSA 1J05A 2YD5A 3DGGA 1H3VA 2ODHA 4BZ1H 3W39B 5BS0D 2YBGA 3EJTA 5HDBB 1HC1A 5AVQB 3HS0B 1NC4D 4LVNB 4YPJA 4PB0L 5KANG 4UQAA 3EG9A 1OWWA 3OKDB 3QRLA 5MERB 3QUZD 4KKBC 4LSQL 5AKRA 3HAEH 3B7YA 3L3GA 5I19H 3QH5A 3DJSA 5AFAA 1DBJL 1I1YB 4P0DA 3RGBA 2CLRB 1MRCH 4XCCL 1WBXB 4MNGE 3N2JA 2H0JA 2G2PA 3D8MA 5DD6B 3HS8A 3GHEL 1G5AA 4LPCA 1WIPA 4U1LA 1ONQB 1ESOA 4MAZA 2OTWB 4YAQA 4JZOA 5GGSB 1H0DA 4A39A 1QYGH 5DS2A 5L7XL 3HN5A 4RAVB 1J48A 5DMIL 4G5ZL 5HDBE 2Y1AA 4WHDA 4F57H 3KPRD 2XA8H 4JFWA 5TH2A 2NY0D 2QL1A 1KPRB 1THCA 4W9ZA 4B9PA 4JREB 3VJ6A 2ITEA 2L7QA 3NCJL 2RH0A 4RMWA 5BMFH 3PFUA 2IH1A 3JV6A 3QHZH 4P3WA 1RZIA 1HDMB 5AZEL 4AQEA 3P77A 1TEYA 4YSQA 1LLAA 1A6AA 4K8RL 4MA8H 3QXDA 5L6YH 1T03H 5HHQB 4LIQE 1EVUA 4R4BB 4JFVA 3BH9A 3WTWA 4FXGC 1KTCA 1PTZA 4DPCX 6FABH 1O9ZA 4PUBH 5DLHA 1F0LA 1TXKA 2XXCB 4X9GA 3I6SA 1S7VA 2AJZA 4OCMC 3IJSA 2HX9A 4TF4A 4NC1E 4OLWL 2XG5B 5D2NE 4PGJA 5I15H 5I1EL 3ZHDA 2DZEA 3QQNA 3UJTL 1JVKA 4P23A 1BMWA 5IFJA 5F7BA 2JLLA 4PLKC 5I74C 4CA4A 1QEWA 2OL3L 1BOYA 1J7VR 2OCFD 4TVPH 8TLIA 4N26A 1T04B 2X9WA 4AWJC 1K6QH 3TL5A 1W6LA 1CGVA 2BNRA 1AZCA 3J8F7 1COBA 3S88L 4Y2LA 2Q9OA 4LDCA 5BUAA 2X6VA 4GP5B 4ZAKD 3ARGC 4HUVA 5KYXB 4A2DA 5IR1B 1BQHB 1L9SA 4KVCH 4FNTA 4O2FA 3CGTA 4AZ8B 4BJLA 3MCLL 4Q56A 1BFSA 1N64L 2WLJA 5J89A 5ESVB 1XSJA 3CZFB 3R0NA 3EYQC 3D30A 1BGXH 3O41A 2X9YA 1YJDH 3HUJF 4ENEC 5I30H 3WHXA 4K5NA 1VZGA 1QHOA 2MKWA 3H4HA 2PF6A 3ZJAA 3EHBD 5GRVL 3AITA 3IXTA 4HWBL 1AKPA 2ESVD 4E36A 1Q94A 4IIQC 4Q0XL 1RURL 2CHZA 3O6FA 5DT1L 2P9RA 3FB5B 5JIMA 2H1XA 1DANT 2GSIB 1BLIA 2DRUA 2ZWYA 3ABGA 4X7SH 1ZLDA 4E9WA 4TVPE 1QFWL 3TT3L 5I8OL 1UJ3A 3EJPA 4X83A 5I8EB 4GRLD 4AI7A 1P7QB 3MJ7B 4PGCA 3SDDB 5E5UB 5FFGA 1HN1A 3NUKA 2LU5A 3MVSA 4PRNB 5EBGA 5I82A 1IEBA 3P2TA 5DJZA 3U0WH 1Q38A 4P9HL 5C09B 2OP4H 3RDTB 5ILTL 3WS3A 1D6VL 2FGWH 1HCZA 1CWVA 1VGKB 1YEHH 2XN9A 1DVTA 3CU7A 3NQIA 5J9PB 1OGAA 5D1QD 2V5YA 4IU2B 3K72B 2IALA 1A1NB 2K4AA 4ORZC 1TT6A 2HJLA 2Z64C 4A38A 3FSZA 4DEWA 2BLFA 4NBXB 2Y25A 4WI9A 4PJ6A 4Q6KA 1WC7B 3BSZA 2EDNA 3C6LD 4BQ9A 4JFPB 3DTXA 3LY6A 1TO5A 1X4YA 4GKNA 4WKXA 3RJDA 1EUTA 3D08A 2JELL 1SBSL 4L4VD 4NZRH 3GPEA 2WW8A 1MFCL 4JQIA 4JDVA 1DEEB 1KSRA 4PHXA 3T2JE 3L13A 4PS4H 1OE3A 5F1NB 1E2WA 4HCIA 1GR7A 4TQIA 5E0QA 3GLZA 4QRPE 1EZLA 5GS0D 5DRWA 3X14A 3GJEB 1HHIA 3FULA 3GUTA 1ZHBA 2Z7YA 1S5IL 4F3FB 2YEQA 4WWKB 2IANA 4YXKL 4W9IC 4XNXL 2C4FU 2MCPH 4G8EA 4BFGA 3GB7A 3L3JA 2WBWB 2IGTA 1AGDA 4ZDHA 4HFUH 2WJ7A 3D7PA 4JHWL 4X6CF 5KVFH 2IQAB 2W91A 3TYGL 1JWMA 4O02H 3C60B 4GQQA 5K9KA 2UX7A 2B5IB 3QB7C 1MQKH 2FWOB 4JKPL 4LEXH 4DERA 3I74A 1AKJD 4IJTA 4N2CA 5E1QA 3D2UA 3QDMD 4BA8A 1X5AA 4F2FA 4XNBA 3CFQA 5LKNA 1MZZA 3LRSB 1OOAA 4Y5YA 3VD2A 4TNWF 4BQCA 3MODL 3C5JB 1VADB 3FRPG 4A2FA 4EIUA 2YXMA 3VFRA 2A1WH 2R29A 3BEWA 4FLQA 4JFUA 4K71C 3OKMB 5F0PB 2Y2TA 4JFZL 1K5NA 1AG6A 3U0TA 4KC3B 2LU3A 4KXAA 2VN7A 3GSNL 3RNQB 4R7LA 2ADFL 3AXHA 1FCGA 1NCTA 1K8IA 2H9GA 3GZQA 2GFBA 3RB7A 5KVGL 3OTTA 1BIHA 3JWNH 4PRPD 2B2XH 4DUVA 2Y7SA 2NW3B 3NIGB 3VE0B 3VXQB 1MAKA 3G5WA 1DQVA 4ISVA 3QAZC 2EDLA 1PDKB 5KVFE 3VX1A 5HGBB 5C0CD 1R17A 5EU5A 2EH8L 4MXWL 4HUNB 1RV6X 4FG6D 4GSXA 1CF1A 3B5TA 1U3HD 4O00A 5HGHA 5FXNA 5E2VH 1N4XL 3AY4A 1EEUA 1Z7JA 5DA0B 4I87A 2ZWLT 5IB1B 4WHTA 4BQ8A 1HWGB 1M7IB 4IEFB 4J4PC 1WAAE 3P30L 5LDSA 4L23A 1U8JB 2QBWA 4URKA 1YA5A 5IW6B 1WA1X 3KAAA 5D1XB 1U8MB 1BFOA 4M8QA 1H8OA 3IRZA 3VFOA 4KQ0A 3NIGE 5C2BH 1PZ3A 3EO1B 4MQ7A 2N0KA 2YARA 3AREC 3DBSA 5F9OH 4WW2A 1KBWA 5CD5C 2AFNA 4MNQE 5FDWB 3DO4A 3QG7H 1ZANL 4I88A 1V05A 1F8TL 2NR6A 4HYTB 4UB0L 3CFDA 2MNUA 2C9VA 1KB5B 3P2BA 1AP2A 5DTFA 2ALAA 2A74B 2QPFA 4MQXC 1J0JA 4YHZL 4YMPA 1NC2D 1ZLSL 2EADA 3F7KA 1NMAL 2WBKA 2J72A 4HIJB 1G9NH 4G43A 4G8GB 3BSHA 5AKSA 3VSVA 2K6WA 2Z92B 4R2GB 4MNHA 5KSUB 5E6YA 3M8OH 2BP3A 2NLJA 3ZGHA 3QJSB 4EXKA 5FGBA 2NYKA 4LLQA 5D1XE 3WS6C 4BINA 3MJ9A 4MKMA 3EBGA 1JERA 1BLNB 4N1HB 5ABZA 1ANUA 2OX5B 3IKKA 4X5PA 4ONOA 1AH1A 4YSCA 3NBNA 4X9BA 4PQXA 1UENA 5GRUH 4FFZH 3CFIC 3REWB 4MA7L 4J8QA 4RX4A 2LTQC 5TE7H 4Y4KB 2PCXA 2QPUA 4KJYB 2CAKA 2VMCA 1QFPA 2VN6A 2EO9A 4P2QE 1E28A 2VDKL 5FGCB 4NO3A 2WZ6A 1RCYA 4J3SA 3QEQA 2CO6B 4QRQA 5BRZA 2Y7QA 1NQBA 5B1JC 4PY8J 3AS1A 1T1XA 4ZUSB 3TZVD 3LIZA 4NO2A 3VFTA 2H0EA 1KPUB 1RJZB 1AD9B 3L95B 4P2YA 1KGIA 3ROOA 3EFOB 4PJXB 2E4TA 3IJHB 3L5IA 4J1UA 5C0IB 1BF5A 1Q72L 2GTQA 3A67L 5DLLA 3F3HA 3FUJA 3W39A 3AQDA 4J23A 4K9EC 4A2MA 3CUPB 4Z76B 3HS0A 5DJCA 4OSUL 5JW5B 2NNAB 3ZE2E 1NGZB 4KK6C 1SHMA 4HWEH 1FNFA 3SQOL 2BP5M 3OKDA 1T6VN 1Z3GL 5T3ZD 4BKTC 1I8KB 1J9QA 4MXQD 5PAZA 2ICWJ 1IAII 4DHLA 4OCXL 2P5EE 3LKSB 4MMYB 4S1RH 3GMPB 5E9AA 1XZ0A 5CP7A 5L0QC 3R8QA 3DXAE 1L3NA 1ONQA 4PJXE 1RFDL 1OSZA 4AVHA 1YN6B 4MX7A 3OZ9H 2KHAA 5I8CA 2WQUA 1FVEB 3BIKB 2DWEA 3I9PA 3A6BH 3HZYB 5DJ2B 5GGSA 1MRDH 2OQJB 3B9KA 3FS9A 5CSZB 1KXVA 1WLHA 3DROA 1KTLB 3TFKD 2HUHA 3VWJC 3CWGA 4JHBA 4AQ1C 1U8PB 1OB0A 4QOKB 1CL7I 3HMXL 4IBWA 2UWEA 2NZ9D 3QXAA 1CE1L 2NNRA 2E7DA 3LS4H 1LMKA 2W0KA 3UFIA 4KK9C 5EIIG 1RJYA 1MCHA 5AUMB 2IPUG 2R0WL 2VLKA 2IFFL 2QVKA 1ZTMA 1YSOA 4FMKA 4TQPA 2LVEA 1KGCE 1KPVA 4XPTL 3R8BB 4NO0D 4HH8A 4L3FA 3T8CA 1J9SA 2X4TB 3RP1A 2HVJA 4OU3A 4HJJL 3MA9H 1ZA3A 2BNUA 1I3UA 2R56H 5I71C 1GCFA 2CUMA 4R26L 3VU1A 4TOYL 2Y2WA 1SN2A 3P3SA 5E5LA 4QHMA 4GW5B 5IFAH 1ZT7B 4E0RB 4QOKE 4PJGB 5JMRA 3KLHD 3E38A 2AJUL 1JGEA 4DQOL 2VDRH 3LB6D 1QRKA 3TJHD 3OLDA 1MVYA 1EGJA 2OSXA 3AFLA 2HG0A 3O3DB 2GG1A 1I1RA 2IBGA 4JRXE 4I1NB 4LKXA 4NQDB 5DUPL 2OJZL 1WH0A 1JXFA 3MXWL 3MRDA 5JHLL 1XCTA 4G80B 4F37F 1BQHA 1WFUA 2NXZC 2ZXEB 4PJHB 5AL0A 4AZ8A 5C9JA 3FGDA 2Z1PA 3R0MA 4BIKA 4PRHD 5ESVA 5HHOA 5IHUH 1B88A 2YUXA 4RSYA 5DC4B 4NQXA 2APSA 1E3ZA 3QULB 1FFOB 2AQTA 3QIBC 4AV4A 4X0NA 4AR1A 4OVVA 4XMPL 1YEFL 1HL5A 3BESR 3KPSD 4K7PX 1P4IH 4UNVA 3VYOA 2WXLA 4WDIA 2JK5B 3T2LA 4FA6A 2P8PB 2HA1A 2Z7UA 5JZ7C 3FB5A 3V7AG 2X2JA 5DC2A 2GSIA 2R1YA 4M6AA 1S46A 1WVZA 3D18B 4PJHE 5K59E 3WAJA 1DUZB 1NKGA 1ZSDB 1LWJA 5F6IB 2P7TA 2EEBA 3L1OL 1K5WA 3LNEA 1FJ1A 4UT9A 2PP8A 4TSCH 1OTUD 3BWUF 1L0YA 1IGJB 2ZX5A 3MRPB 2DH3A 3W0WB 5C92A 3D2TA 3K6SA 5J9PA 3BVXA 3D09A 4PJ5B 5BUPA 2HVKB 4P4KC 2CBPA 3MACH 3FSVA 3DX9B 1G7IA 1WC7A 5KSBF 1QRND 4ZK8A 1ZEAH 1KIRB 3MLZL 4G5AA 2V3DA 4Y9CA 4CDGC 1J5HA 3I3BA 3MZGB 1LK3L 3BZFA 4JFED 4OY9A 1XAKA 2J8UE 3IJEB 3QNZB 4RIRB 3NJIA 5FO7B 1CTOA 2MTPA 2RBLA 2H3KA 1WA0X 3HZMB 4MLSA 1Z66A 1M56B 4N3UA 5DFVD 1EZUA 4A2EA 4FJZA 4KJWD 4JKNA 5IJKC 3QS2A 1MRCL 3PREA 1DEEA 1R5VB 3L3OC 1AGFA 1PCSA 3IDMA 4W9CC 3ILPB 3VXMD 3D50A 5KSAD 2WVTA 4X7CC 4FQXA 2YGOA 3AU0A 3C8HA 4YDMA 4LRIA 3K8LA 3ME0A 3FO9A 5T5NF 5DURB 3EYOA 3MHZA 4WWKA 3PGFH 2OR9H 2APXA 2GBVA 1EO8H 5D5MA 2M2DA 2AQNA 2APVA 2EC9T 2IQAA 5KYYB 4X7FC 2P42B 2X1QA 3OZKA 3QJQB 4L3ED 4TSAH 1FZOA 3NCXA 4JFSA 2LR4A 4U1NB 4AUYA 5B7FA 3FB8B 1D7FA 1QF0A 1I7RB 4HIEA 3LRSA 4N8VA 3V6OC 1T03L 1AO7A 2ERJB 3QJFA 3FH8A 1TLPE 1A0QH 1E5BA 3VWKC 6FABL 1E9OB 5C2UB 1HL8A 3IWUA 3K80A 3H6JA 5D2LB 2FX9H 2ZOKB 3OJ2C 1N9PA 4Q6IB 2NUTA 2EDRA 3SOBL 5KW9L 1ET8A 4N90D 4I0PC 4MJIA 5I15L 3OR7B 3CDYA 1QLEL 1HXMA 2DBLH 2QTVA 2IH9A 1YMHA 4MDJB 2YK1L 1Z9OA 2ZUTA 3QZNA 1F2QA 4JRYA 1AZVA 1ZDPE 2NW3A 3WJJC 5HHPB 1G4RA 3MBXH 1PDKA 3U7YH 4NUJB 1I8LA 4D8PB 5F3HB 3FAXA 4KVCL 4WSKA 2DIJA 2XVKA 1PKOA 1TMNE 2UZIL 3M1CA 5CU9A 1ECZA 5CCKH 1OQXA 4GG6A 1FG2B 3TMNE 3FB7B 4LESA 4I18C 3OXSB 1VAHA 1OAKL 1PY4A 5I30L 1XXFC 4N28A 2CGYA 4V1DA 3EGSB 4H40A 1J5CA 1NBVL 3U9UA 1FG9C 2ZUQB 2DIAA 4CMMA 3VB8A 1U8JA 4HJIA 3ZE1F 3BN9D 2NSXA 4PCKA 1YRKA 3LKNA 5AZ2H 5A1AA 4CGTA 5ISZB 2D3NA 2VDLL 2F1EA 3FO2B 2JKSA 1S8DB 3WTUA 4XVUD 1FFNA 2DS4A 1DVQA 3EO1A 1RHHA 3N44F 4MVBD 4OZHA 3TTSA 3MDJA 4P5TC 2A83A 1A3LL 3ARGA 1XF5B 4I9WD 2MJWA 4UDTB 4HJ0C 4MKTA 1KGUA 1CFTB 4QXGH 3QDJE 2A9NL 2OP4L 4PJDB 3WDHA 4K7FA 4AYDC 1FPTL 2FGWL 4X6EA 4DKDC 4HIJA 1A2YA 4L4TB 4F93B 1MFEH 3CN3A 4G8GA 2JB5H 4YO0B 2Z92A 3MRBB 4NENB 4S1DD 5KSUA 5DHVA 4JKWA 2QLYA 4K2UL 5B38B 1IFGA 3H42L 1X9UA 3FORA 4LSTH 1ETZA 2PW2A 2XKNA 1JYWA 2WLLA 4HC1A 1AI1L 1U8LB 1JD7A 3CVHL 5MI0C 4L9LB 4QRRB 4PV9A 5K9OA 5C3LD 3IKCA 2MWCA 2NRDA 2HT4D 1GHFH 3HC0A 4I77L 3BZEB 3WLBA 3JT0A 4NZRL 1AXTH 5KVDH 1XL6A 4NAQA 3RPKA 1J0KA 5LXVA 2H45A 4PS4L 5EUOB 3NACL 2GHZA 1NCDL 2VO8A 4IHOB 2VJXA 4OM0L 2F74B 2NY7L 2EEDA 5DHEA 1FJUA 2OJEA 1V3MA 1F90H 1U42A 1YAZA 2IGLA 5L4MA 2O30A 4G6ML 5KJRH 1RJZA 3L95A 4UINL 1WSST 3QK0A 3GMRB 1JF1B 4EI6B 3HI5L 3HMWH 3WO4B 4EN3B 4QRRE 1QAWA 3TIEB 1A1MA 1RMFL 5I75C 4APQD 3FFCB 1HVXA 4LEXL 4CC0A 4NUMA 3H4FA 3CUPA 1N68A 4LCUA 3D3VD 3FTSA 5E51A 5AVTB 2B4CC 3W82A 4KMTH 2DWSA 5TLNA 2UZPA 5EUKB 4F9LC 4Z3IA 5J13B 4TUKH 4ZXBD 1CXFA 4I3GA 2AK4D 5C6WH 1E2VA 2KLRA 5DZLA 2EUXA 3LKRB 5INCB 5T1DL 1GTNA 3KH3A 1OOWA 4PVMA 3F12B 1GOGA 3S5LG 5F93C 2EDXA 4Y5VC 3DRTB 4UAHA 1MHEA 5I5MA 1JPTH 4Y19D 4K7PH 3MSAA 5H8DA 3FTUA 1FVEA 2C9SA 4YBLB 3HZYA 2OQJA 1IZJA 4HGWB 4HUWA 4QI3A 4Z7NF 1FCCA 3WIAA 3UTSA 4JPQA 3DV4A 5IFHH 4H8PA 1U8PA 4PRIA 5KG9B 1IJ9A 3GJFB 1ERNA 2EDQA 2NDGA 5E2VL 4E41E 3A22A 4B9KC 2FK9A 2WYHA 1AGEB 2PO6C 1UUNA 3AMKA 3LJ3A 2DY2A 2AI0L 5TF1H 5TPWH 4LARH 2HT3D 2ED6A 4Z7UB 1MCRA 1EJ8A 1C08B 3VQLA 2Y6SC 4FCAA 5FS5A 4JQXC 4NC2B 1M1XA 2FYYA 4M4RB 4F7CB 5C2BL 2DYPD 4OGQC 1UACH 3BKJH 3VQ1C 1QACA 1XTMA 5A2BA 2DLFH 1L7TH 5IG7B 3FT2B 1ASPA 2G0KA 1I1FB 2AXGA 1X5ZA 1T20B 4PJGA 5E8NB 1A1OA 1CGWA 3ESNA 4TLNA 1EAJA 3MV9D 1MW1A 4N2NA 3T0EC 4MMXC 3VI4B 2IJ0C 4FQHB 4F7KA 3VXRE 3O3DA 1HZLA 3FYIB 2P5PA 4M62H 3C75A 3UROR 4N0RA 5TE4H 1SHXA 4J4PA 4WO0A 4U1HA 1YY8B 3V8OA 2AZAA 4Q2ZA 1MLCA 4KDTC 5HPMB 4Y4HB 4Q58C 5JUEL 1G7QB 1TTRA 1X5IA 3MCG1 5TQ0L 3MV8E 5B8CC 4BRJA 2DPKA 1K2DB 2R1XB 3BLPX 3QULA 5AVXB 1FFOA 4A66A 2NY4B 5I17A 2WANA 1AQ8A 1E30A 1W2KT 2MNJB 2Q7NA 4JHAL 4JZJB 5DLMH 4D94A 2R15A 4R5XA 3M1BA 1R24B 1GJIA 3GINA 4L29B 1YAIA 2FNWA 1FJVA 4WU5B 1QFHA 5J1SC 1UZ8B 1HAWA 3OQ3B 4KJQD 5JQ6H 4TULL 3X1EA 1T0MA 1F02I 1RZ7H 2H32B 2WWNA 3KJ4B 3N9GL 3CIQA 3D18A 2BHZA 3W37A 1U58B 3CDFA 4LPUA 1YEWA 5HD8D 1ZSDA 2F8VA 1VKXB 1QSEA 1UCBL 2OL3B 4OT1L 3JV4B 4BFNA 3WS6A 3WYRA 3I6KB 1SQ2N 1WV7T 5EZLA 3SDAB 1KXTA 3O4OB 5HTSA 4K89A 3WDIA 1CBVH 1F4WL 3W0WA 2PYEB 1BVKA 2QSCH 4JDZB 2CHDA 4K94C 1UEMA 4EUPH 2QGBA 3ATEA 3NZ8A 2J5WA 1BYPA 2QVFB 5LHDA 2XTSA 1DCEA 4FFVC 4ODSH 4XVTL 4ALAC 2YWYA 2VERA 2W88A 2WBJD 1O7VA 2HVKA 4ZO6A 3QNYB 3VG0H 4XT1C 1X4XA 4ACTA 2XWZA 1AOZA 2BSED 4HP5A 1KIRA 2V8MA 4HWEL 4K3JH 4Y1AD 4UQEA 4A7TA 4OD3L 4U2YA 1KXQE 3RYMA 4RIRA 1KTKE 2EO7A 1TIUA 3IJEA 1WYJA 2E6JA 3IJ8A 3RL2A 2IH8A 3HZMA 1RZQA 5B1JA 3TO4D 2FJHA 3AU1A 4R3SA 5F72S 4IRJD 1R5VA 1QOKA 1I9RL 2BW5A 4KHTH 4J3UA 3V6ZA 2PYEE 5I16A 1PYWA 2BSBA 4P99A 1MI5A 5GS0L 3HUJB 4KI5E 1HT6A 3U48A 3OZ9L 1L9TA 3A6BL 2AABH 3I3EA 5E6UB 1BBJB 4IKJA 4HHAB 5T5FA 4GAGL 2HKAA 1A7NL 4IGBB 1GVIA 3L9BA 4HMEA 3GLAA 3OHXB 1GC1C 1OSPH 2P28B 3ATAA 4K0OA 4PI2A 3KWWA 2H47C 2PP9A 3KCPB 5KYYA 3DA0A 1A6WH 3LS4L 2Y5TA 1MCWM 2MOQA 2BCMA 3NP4A 5F8QC 1TVHA 3FB8A 4X6BA 1X9LA 5HYQB 3P9MA 2XWBA 4ONFL 2XBZA 1PD1A 4NKDB 5DJ6B 3TH2T 1MJ7L 2N01B 3TFBA 3P73A 4GRWB 3HUJE 1E9OA 4FFYH 1DBKH 4MJJA 2NX5E 2EQDA 1MFUA 2ZOKA 3NIFE 3PNRB 4Q6IA 5D2LA 4LSRL 1T83A 1CZ8L 3FW6A 3KGTA 5C07A 3NSDA 3OR7A 4KNTA 5DSCA 5C0AB 2B9BA 1Y6KR 4AQ1A 4WUKL 3CDGB 1RZJH 3QUHA 3TCXA 1SPDA 2FBJH 2VDRL 3MLWH 4POYA 2PP7A 3I50L 1AS6A 4AK1A 4O58H 6TMNE 3Q6FA 2XXGA 1VGEH 2QR0A 4KKLD 1FF5A 3SKOA 3T4AB 1KGWA 1DBMH 1P2CA 3H3PH 4D8PA 1H5BC 3MO1A 3QFJB 1YEKL 3GBML 3N1MC 4PVNA 3BMWA 1UVQA 1DBBL 3QUXB 5E5RB 3LNFA 4OM1L 4YHNB 1T1WB 3HZVA 4AITA 2EILB 5IHUL 3EFDL 3HZ3A 1DSFL 1RK1B 4IRSC 2PCYA 1S78D 3BUDA 4OV5B 2FHCA 2WXQA 3TA3B 4HU8A 4XPAL 3CZKA 4OB5L 1WF5A 4PJBE 3X1GA 2DWDB 5F1IA 2YS4A 5FV2A 4OBSA 2NDFA 5LWYL 1E5CA 3SJVE 2DQTH 2X28A 1T2QH 2BY2A 3IDIB 1S7WA 3QZLA 4X6CB 5I1GH 5BV7H 5DUBA 4R90L 5T1MA 4Y16D 3U4BH 4DJMA 3GSNB 3MRKA 3NA4A 2Z8WC 3DLQR 2J1XA 2FWLB 4ZODA 4ZTOH 4AIXA 2BWDA 1CFTA 1JXGA 2FYVA 3NQKA 1D7BA 4W93A 4PJDA 1T7XA 3SHSA 1X6NA 1I1AD 2GTZB 3NEEA 4M7JH 2CKNA 3W2DL 1CFBA 3EYFB 4YO0A 3MOAL 4GT0A 1KACB 4NENA 5LNDA 5IVXA 5J6SA 4IOFD 2BOLA 3MPCA 4DKFH 4GI6A 3STZA 2KERA 2WCPA 5FKPB 1VACB 5F6HJ 2PW1B 4UTAA 2VLJA 4PTUB 1FGVH 2VXTH 1KYAA 3K5SA 4P2OD 5CSBA 1U8LA 3PHQB 1NGPL 3PXJA 4L9LA 2AJSH 4ZO8A 3TTYA 4N2LA 4JFYB 4JO1H 2QJDA 1NGWB 2IMNA 3CD4A 4TUOB 2ZAHA 3K0YA 4R6UA 3AC0A 5B7MA 4KY2A 4JL1A 3SDCB 4IHOA 3B9VA 3F83A 3QDGA 1FL6B 1DANU 3CNKA 4UAOC 3UMTA 3QR2A 3GMOB 5J6GB 2X41A 2Y69B 4J2XA 1U4FA 4JANA 5SWZD 4A6YA 4OGAC 2J6EH 3PGFL 3QG6A 4XP5L 3SY6A 4TNVK 4JKKA 2OR9L 4KTDL 2GUYA 3E1ZA 4ZOAA 1F4AA 1HIMH 3BOVA 1NKOA 2F5AL 3OV6A 4QRUB 1LNCE 4UI2A 2FEJA 3OPUA 1HXYB 3MS3A 1RXLA 4EI5B 3SKNB 3FQTA 4J3TA 2F54D 3FFCA 3Q9QA 4MA1B 4D0CB 1YDPA 5EORL 5AB2A 4Z95H 5IJKA 4HMCA 4XP4L 3KPQA 1B4RA 5T3ZL 5IWLC 1JF6A 3L3OA 5EUKA 2ZYIA 1A6ZB 4NM4L 2VMJA 3NQXA 4WUUE 1E40A 4B5ZA 5FWRA 4U05A 1VPOH 3CFBB 4WENB 3SKMA 3ZK0A 2B1HH 1ZK9A 1KTDB 2VSCA 4P9MH 2J3SA 1UT2A 2F19L 3F12A 1RUAL 4DZBB 1ODAA 2W0PA 2QEJA 2VDOH 1XXDC 3HE7C 3U7AA 4QHKJ 3WV0A 4QDGA 5ERWB 4AW4A 1WT5C 3KHOA 4YXLL 4JQVC 2PXYB 5IHLB 5AVRB 2DQEH 3ZQ9A 4GBXC 1SY6H 3QNXB 4HGWA 1QFUL 3GM0A 1IC0A 2QPSA 4JFFE 4K3HA 1F5WA 5DD0H 5I28A 1KJMB 3B9DA 5E5MB 5F9JA 4KVNH 4NC1C 3V6OA 5D2NC 4OZFA 3RJQB 2VDPL 5CCKL 4EVNB 3VSUA 3QE5A 4LSPH 3VWKA 3ZTCC 3FTVA 3PWUB 5T1JA 5JDJA 4H8UA 2CJUH 2W38A 1OGTB 2E7MA 2TLXA 2C26A 3OKEB 3U1QA 1DLHA 2DMKA 3VMNA 4I0PA 3TEYA 2ZKHH 3GEFA 4AQZA 5K1JA 5GPRA 1S7RB 4RFNC 3CFEB 4OLEA 4XCFL 2WLMA 3ARBB 1R46A 2BIHA 4X5XB 1UEYA 3BUPA 2EKSA 5D7IF 3WL9B 2X0WA 5D7LB 3W9EB 5C86A 5EU6B 2E3VA 3B43A 1C5CH 1N3NB 3QI9D 3TO2B 4HKZB 1Z1WA 4FLRA 2NY5L 1BVLB 1GRWA 4JVPA 4L1TA 5HHMD 5DRNA 3WJJA 3OLGA 3UAJD 2FSEA 2JXMB 3K4DA 4XAWL 3ZVVA 3FT2A 1SXNA 5CM1A 1AR1B 3QEHB 2Q6WB 3DSNB 3GT6A 1N5AB 4QD2E 1NIFA 2A2QT 2DLEA 1P53A 5E8NA 4XNQB 3CH8A 4L8CB 3TLIA 2YPKB 3VI4A 2JKXA 3EGXB 3ZDYF 2YPLB 4X7EC 2G3NA 4XCEB 1Y1DA 3HG1A 5FHBH 3EDJA 3T09A 1ZA6A 1MFEL 1KLFB 4QTHB 3I02B 5DDHA 4OF3A 5LAPA 1YEJL 2VDMH 5HPMA 3P9LB 3BE1H 1V55B 1AD0B 1BIIA 1GKEA 5DEGB 1G7QA 2OJ1A 4BZ2L 4PWIA 3F7LA 3NSCA 4FYTA 5KSVA 3DJ9A 4BK5C 2W65A 2R1XA 5JHMA 4HZAA 3QBTB 4NRZB 2Y22A 5DZPA 4MAYC 4CNIB 4P5TA 5HDWA 4DP4X 5HYSA 4EDXA 4NHCH 4XH2A 3V0WL 5HHVH 1GHFL 4M43L 5JIIA 2ZWNA 1R24A 2D7PA 2L0DA 1YJDC 5J4MA 4P04A 1JRHH 3V52H 5E8EA 1JD9A 1M4KA 2MPAL 1LO4L 2OMYA 4YC2B 5IB2A 4Y4FC 2H32A 3VA6A 3POCA 2N3JA 1U58A 3IMVA 4N2KA 2JB6B 3DO0A 1F90L 2X1WL 2OL3A 4WNSA 3HI6H 3TH3T 3GQFA 5E08H 1AGBB 3BH4A 3VDAA 4MS8D 1OCZB 3VGBA 4XMKL 3TBWB 4WO4C 1WZLA 4X80H 3HVDA 3ASWA 3IMBA 2Z35B 3VU2A 4PBVC 3BPNB 2BPBA 1U91A 4AQAB 1IB5A 1DCLA 5IVZB 4FGMA 2HTKC 5JW4Q 2QQLH 1A6TA 3LQZB 3R18A 4G2AA 4LCYA 4GXVH 3O4LB 1HQRA 1OD7A 2VR8A 1XD0A 4XRCB 3T3MF 3X12A 2HLAA 3SCMD 1MFMA 4M6OH 5LUMA 2Q8BL 3I9GH 2ENJA 1XIWD 3DIVA 4GI8A 5CLTA 3TIDB 3DMMC 3E2HC 1GA2A 4ZG1A 4HAKA 3MTXA 2CJ3A 2FX8L 3P40A 1KKKA 5BOJA 2EIJB 2FRGP 3KWUA 1JGLH 3O0LA 4TVUA 4N2HA 4HT1L 1JPTL 3VTTA 4K7PL 4TNLA 4GO8A 4YXHH 3L3IB 1BREA 2VXQH 1ASOA 4HHAA 4J3WA 4MJ4A 2L3BA 4NYLA 4A7SA 1SOKA 5GRWA 2V7HB 5I1HL 4IGBA 4PP2B 4I2XE 3DRQB 1MRFL 5D1ZC 3GEWB 4XCNA 2HLFD 1HYSD 2J44A 5TGBB 4R4FL 3R7RA 2VLRA 1V7MH 4NNXB 3S3PA 4I1PA 3N21A 5I6LA 3LQAL 4PP1C 4QRTA 2EUWA 2AAAA 4HMDA 4LEOA 1CFQA 4GUPB 4PTTA 4H8QA 4LARL 1KCUH 2KL6A 4PJCA 1CICC 4FABL 1AANA 4M5TA 4OVUA 4Y5VA 3LRMA 4UQDA 8PAZA 2AXJA 4P48A 4U3SB 1IE5A 3HAEB 2YQ3A 2R2HB 3ET9F 2AJYL 4DO5A 1L0PA 2DLFL 5E9DE 4GXUM 1J1XL 4RQQA 2WQSA 1IM9A 5C0AA 3NDYE 2DQDL 2BS71 1IM3B 3IXAB 1YN7A 3T0XA 5T1KD 1PCXA 1H15A 4G7QB 3S36X 4W9HC 2XTJB 1FAKT 3QC6X 3T4AA 3LXAA 2PO6A 4M62L 5E1AA 5IY5B 1IAKB 4I48B 1OTSD 4MZ3A 4W70A 5EBMA 1F3JA 3QFJA 3V79C 3QUXA 1F3RB 1FNGA 4F33B 2WLHA 3JWNC 4MA3B 4YHNA 3PWJB 2J7LA 3QVAA 2BP0B 4L37B 5I1KL 4AEFA 1NCWH 1TF4A 4JQXA 2XV2A 3QQXA 1D2PA 1T4WA 1U3NA 2DKMA 4KRLB 1TLKA 2CO2A 3MLVH 2GJPA 3H9SB 3HIZA 3T8HA 3UJJH 1TQVA 3OPZL 1OHZA 3F7RA 4R5TA 5DLML 3AXLA 2DWDA 5LBSL 5KSBE 4F8LA 2K9FB 3F6LA 2VN5A 3AT8A 2XXMB 3FSWA 5DHYA 5F88B 3MRQB 3MR9B 4DH2A 3IDIA 4WF7A 3T0EA 2MOGA 1MF2H 3MYJA 4MMXA 2VR7A 4YHKH 2D3JA 3VTAA 1JV5A 1FFTB 1NLBL 4K5MA 1LDSA 3H7LA 4OFDA 1ZAGA 4R0LC 1QLEB 3DDGA 2EXYC 4WAFA 3ILQD 2H26B 1U95A 2D2OA 4KDTA 2VL4A 2BS8A 4M1DL 4F2ME 2PWDA 3LV3B 3VXSE 3D34A 1V8HA 1FAIL 1WRFA 5IROD 2YAFA 1MW0A 4JPKH 3NTCH 4QNPF 1N12A 3FT0A 1CBVL 4HH9A 4FFWD 2P47B 2R4SL 1URLA 2AQPA 2ZUWA 5JA9A 5TMNE 2IDSA 2DM2A 3B2UD 1IC7L 2Z34A 4HBCL 5I18L 1EZVX 3JTTB 5FKPA 2I7OA 1RUMH 3UPAA 3UBHA 4E42B 5K9JH 1DBAL 3CVBA 3ALXA 3BVUA 1QNZH 3MRRA 5A16A 4M93B 1G9NC 5I6XC 1F58L 5EA0H 2COVD 3FH5A 1CF8L 5CGYC 3WUWB 4JAMA 2BRRL 1UD6A 1LYQA 5DJ0B 2B59B 4AMKL 4LDEB 1DVUA 3LTVA 2VDLB 5B1KA 1SDDA 1MEXH 1NGWA 4WFHD 1YEIH 2LQRA 35C8H 3R4DA 1OQOA 1YNTA 1FL6A 2W07B 5IW1B 4XX5A 3GMOA 1JXJA 2AERT 5BQ7A 1TJIL 2KQNA 3L3DA 4KTEH 3NZSA 1Q0YH 1GPOL 4QMEA 3O8XC 4ODUA 4DSYA 2B0SH 3ULVE 3PABA 3N44B 1D5MB 5CZRA 1JMZA 4R84A 1KC5H 3WTXA 5I23A 4EI5A 5AVYB 2AQ1A 5TQ2L 1CDIA 1NAMH 3VM5A 1N2RA 1Z2KA 3PQYB 4C8XA 3NAAH 4KHXL 1VA9A 2E7HA 2O72A 3EAKA 2KLTA 3GRWL 1GGBH 3G6AB 1A6ZA 4G83A 3V9EA 4G3YL 4HIHA 1JL8A 2JCCF 5IESL 2Q7YA 3KPNB 2X4NA 1XF4B 3ZE1E 2E27L 1N0XL 4K4KA 4X5WB 5E7FA 3MRNA 2EE6A 4CJ1A 1XVSA 4WI0B 2AXWA 1BCIA 2HCZX 4YPGB 4TQ8A 1JZ8A 5J1AB 3CZNA 1SOXA 3MLWL 5ERWA 4PGBB 1LE9B 4B9JA 1JZGA 4O58L 1JPEA 4ODHH 1ZXKA 32C2B 4P23D 2PCPB 5DJ8B 3WNLA 5JXNE 1DBML 5CIPB 1VFAA 1W0WB 3KG5A 4S0SD 1OS0A 1JI1A 1QTSA 1EMTL 1KJMA 2GJRA 4BBWA 2QZ5A 2FIRT 1LVEA 1XB8A 4K3GA 2BNRD 3AT0A 3MNZB 2EDYA 1UD5A 2BIPA 2CKBH 1L3FE 3HR5B 4EVNA 3NA9L 3DUUB 4O02B 5BS0B 1O5DT 4IDJL 4G7VH 4IOSD 1FFRA 1I7TA 1NC4B 1OGTA 1V7NH 3CFCL 4W9LC 4X8JB 5DJYA 4F7TB 2EC9U 4YLCA 3CMOL 2XWCA 1KLGA 3GK8H 1NFAA 3SYCA 2XN2A 5LGHH 3QIUC 2V2TB 4WU7B 4X5XA 3KM1A 3QUZB 5EO0B 3GMQA 3WL9A 5CD3A 4BWUA 3ZI6A 5D7LA 1MNUH 2LAAA 1N3NA 2D2CC 3UTQB 1KNOA 4HKZA 1I85C 4JFDE 3GMLA 5MEQA 2R4RH 5F7LB 3PCYA 4AEHL 2JXMA 5G5DA 5I1AA 1V3JA 2AK1H 2C1PA 3S8FB 1VEPA 1N5AA 1H5BA 2IC2A 2VIRB 3O6FD 3V0VB 3H0TB 3O45B 4QTFA 2IV9A 4XNQA 3UACA 2YD7A 5JOFB 4G7YL 1E4KC 2YPKA 3L45A 4XO4A 4N20A 4PIBA 3EGXA 3LPOA 3X3FH 4LE8A 1UXWA 1JMXA 3IU3B 4M7JL 3P3UA 4QTIL 3KPRB 2W95A 3NJKA 2NY0B 3ECVA 1N59A 1YG9A 2HWZL 4NQCA 3S34H 2AEQH 3OKNA 1OO2A 1TQSA 4DKFL 4DP1X 4ICXA 1MCQA 4HSAC 4OJCA 2K7PA 3P11L 4MYWB 5DEGA 1OL0A 2XN9D 4MCYB 1QG3A 3VFGH 1OGAD 2V37A 5FYKH 4XXWC 3CC5A 3V9CA 2A6JA 4DWHA 1WWBX 4I4WB 4NGHL 3VMOA 4KRPC 5C0BE 2ZKXA 2AJSL 4KKZA 1CT8B 2WZ0A 4GINA 2DM7A 3LZNA 4S0TD 3WFEL 1HU8A 3VA2C 1EH9A 1N8ZA 1LO5B 3K3QA 4H7VA 1NANH 4I5BA 1RU9L 3KPRE 2TRHA 4F1SA 5GIRA 4EAEA 1FE8H 4HKJB 3KLQA 4JMNA 2XWJB 4Z7QF 1MFAL 2NY1D 5J8OA 4CADB 1MFNA 4NKIL 1W16A 2DQFB 2WPGA 2XWXA 4E5XB 4U1KB 1ZTXH 2J6EL 2ATKA 3DUHA 1AGBA 4QLWA 3QFGA 2WC7A 4AENB 1DO6A 2FJSA 4BFOA 4ZAKB 5ICUA 2P43B 4I0CC 4H1LB 1NUNB 1HIML 1G9ML 1JPFB 4ELMA 4PS8A 3CFJB 3MBWB 2FO1A 4Z7NE 1HL4A 4JG9A 2X4RB 1JPGB 4FDWA 2OMXB 2IAND 5F0MB 1GGTA 3IS0X 4AQAA 3FQNA 3PWPD 4LLVA 4M8UA 4Z95L 3P3RA 4S2SB 2XT1B 1ZRUA 2ADYA 5BO0D 2XFGB 4KKRA 5EOCJ 1CMOA 2EACA 4F20A 1VLXA 3O4LA 4OZIF 3BUTA 1E9QA 3EHBB 5CEYB 3IMUA 5E99H 2ESVB 1CD9B 4OCSH 4NZUH 1OARL 1QMUA 3QQ3B 1KT2B 3EW3B 3D2UD 5TK4A 3PV6A 4WSJA 2VRQA 1DZ0A 2QKIC 2H3NB 2VERN 4TQEH 3KL3A 3LH2L 1BQUA 3APNA 4GRLB 4R4NC 4DZ8A 4R7DB 2OYMA 3V4PL 5GSRA 2ARJB 1PLGH 4U6HB 1HH6B 2D4DA 5D7SL 2OTUB 3AS0A 4BKSC 2Q20A 3ARRA 3N85L 3BP4B 1F41A 4AZUA 1L9OA 2ZYRA 1I4FB 3KZ8A 3RG1C 4FXKC 1ZT1B 4LLUB 5TDOB 2Y36H 5D1QB 2A73A 3JVFC 5CZVL 5IWLA 3FN3A 3RGVC 2MQ0A 4IHBA 3QDAA 2ESVE 5TGBA 3WKMH 2HT2C 3FJTA 2IWEA 4Y88A 3ZIMA 2BHFA 3L54A 4BZ1A 5JLZB 1H8SA 4WV1A 2I07A 2EICA 3C6LB 4OV6F 5E4EB 5FV1L 3RUGF 2DTSA 5JHBA 2HMID 2CE6A 4AG4L 2YRLA 3QT2A 4KK5C 5C0JB 4ZBJA 2EYTA 4PJFF 4BKLB 1WT5A 4NFCA 4JQVA 4L4VB 3HAEA 4P46D 4UILH 4M8RA 3QRGH 1M7DB 1EEQA 2FHBA 2R2HA 3JTSA 4LCCB 4Z7VF 4GBXA 5E2WH 3W38A 2OMWB 4O2CA 2EVJA 3SDYL 1IFHH 2AV1B 2J1ZA 1FNEB 4ZMOA 5F7YC 5KUMA 2R83A 4ESKA 3ORJA 4BDVA 3QXWA 1MDTA 1MHCB 2RA1A 2Q3AA 3VFUA 3GKZA 4PJIF 5ANME 3B2XA 2YJQA 1OALA 4RGMB 1KJOA 1IAKA 4LSUL 5FO9B 2NR6D 1NEZA 1KB3A 1TZ8A 1HEZB 4FTDA 4MA3A 2E76C 4UT7H 2VDML 5IEHB 2C1OA 2XKUA 5CINH 3PWLB 2Q86B 3H1ZA 3GBLA 4ZSOB 3CG8A 2Y06L 5EMYA 3RWFA 2YPVH 1FC1A 4D7PA 1AKJB 3H9SA 5FK9A 5IGXH 4F8PA 3QDMB 5JXAH 3W11D 4WLCA 4YHOH 2IEPA 5INDA 1TZHA 3FONA 1L5GA 1RP8A 4GG8B 4K9JA 4LVEA 4LBEA 3ZIYA 2CBTA 5MEPA 1JGUH 3MUZ1 3EYVA 5GGQH 5F88A 5I1LA 5JQHC 5LBVA 2E9WA 4PIRF 4PJ7F 4U1JB 1R33A 4ZOEA 4FE9A 3V52L 4RX4D 5EZIL 3B6SA 1OAXH 1QABA 1NFKA 5E03A 5EO1B 3WSQH 4XE0A 1BQHG 2H26A 4PRPB 3SDXF 3T0DA 1QATA 1GYVA 2VDRB 3HI6L 1IGFH 4U3HA 3FUEA 2VCOA 5FECA 5IJBC 5C0CB 3QEQD 5BRZD 1Y0LA 1ZVSB 2D0GA 3L9RA 3O9WC 2XJKA 4BK5A 4DAGL 5FW6A 4NN5C 3Q5OA 2WLZA 1U3HB 5SWSE 4MAYA 5C9KA 3NZHH 1LEGA 2Y5QA 4JLRB 4JCLA 2QQLL 1VFMA 2HFGH 5F7EH 5L41E 5AZUA 4OCWH 2VQUA 3APMA 3FT3A 2XX1A 3ARYA 4Y4FA 3W5MA 4M6OL 4WEBH 4L18A 1CTNA 3FU7A 3I9GL 3ULUH 2VL5A 1L6ZA 4ZQKA 3U4EA 5DJ0A 3H2WA 1G9HA 3QGVA 5MP6L 1GGCH 1JK9A 4HZLB 4XVJH 3S3DB 5I1JL 5C0CE 3FT4A 4OZ4B 5A3ID 3TH4T 4QLRA 1LK2B 1R5IA 4X4ME 1R4XA 3QC5X 4WO4A 2W07A 3MLYH 4P3CL 4EDWL 3US1A 2FLRT 5IW1A 5FW7A 3V9FA 3QCVH 1U4GA 1OM3L 4YXHL 4D2NA 1NCNA 3VGAC 2VXQL 3D39D 5DRZB 1SHSA 2DLIA 4QRPA 4YN3A 1FDLH 3BW9A 3MLXL 2A4CA 1D5MA 3B9KD 3G5XA 3S48A 4MD4A 2WZPA 4NQEE 2Y7LA 4KY1H 2XQYK 1MCBA 3OC5A 2JJUA 1RZFH 4LLWB 3I6GB 3DMMA 4AT6B 4NUQA 3APDA 2W59A 3HNTH 3V8CA 1W8OA 2YSSA 3IFOA 1MPAH 1OTTC 3ASOB 2P5WB 1FO0H 5F96H 3U7WH 1KBKA 3I6LD 2IGFH 1HQ4B 4BSJA 1CG9B 2VLKD 5H35B 4RNRB 5F7DB 3EF4A 4L5FE 1B90A 2I7SA 4P4RB 5BRQA 1ZJBA 1UGKA 2DJMA 5IM7A 5IW3A 4DEPB 2VITB 5FKAB 4ES9A 3FN0H 5DO2C 3EUUA 4PGZA 5D1ZA 4YUEH 3D07A 3TZVB 4TXVB 3RLSA 3VFMB 3O6LL 5JNYA 32C2A 5LBGA 5DK3A 1JZ7A 3VGFA 5B1AB 2E9JA 3FRPB 4P2RE 3FAWA 1W0WA 3NJHA 4FC3E 2MCAA 1BEXA 3VXTA 3QUYC 5MENB 3CVIH 3X3GL 3MNZA 4M5SA 4ARFA 4Z3EA 3EH5B 3QCTH 1JYVA 1U3YA 2EIZB 4DOHB 3DUUA 4O02A 5BS0A 25C8H 4DN4H 4X8JA 3WI9A 4XP6H 1CIDA 1WCQA 2CRZA 5A2LH 3BVWA 2X4UA 4GMSH 5HHOD 4B60A 5FIEA 1I7UB 1QWUA 5DWPA 2V2TA 3HNVH 1SNRA 2HJKA 4DW2H 3HZKB 2FEDC 3DVFA 1NOLA 2FUQA 4YHKL 4IMKC 4X2UA 4XHJC 5JIKA 2V17H 4A2LA 5FF6A 4H8WL 3KYNA 5EOQL 2VIRA 3V0VA 2CR0A 3ARVA 4WZ9A 2QQNL 2WXMA 3C8DA 4YWGL 4LNVA 4TNEA 3QWOB 1SYSA 2VISA 2FVNA 4XBEL 2FO4B 4XP9L 1J1PH 4PLJD 4M9PA 4QRSB 5DMGD 1FN4B 3RVXD 5HHXL 3M88A 1ZCRA 4XGZB 1M6OB 5T3ZE 4L8SB 3FO1B 1TJMA 2EH7H 2CR3A 5D72L 2LLGA 1RUML 3DYPA 4Z18A 3WXVH 4C4UA 5HYFA 5IKCA 2ZSWB 5C70A 1QNZL 1T80A 1UCTA 3K4ZA 4IS6A 4L8BB 4PRDB 2NQDA 1YLBB 1JNHB 2UXGA 3MJ9H 1P4LA 2X5PA 3NFNB 1LNUA 1THLA 1GW0A 4M9OA 2WTRA 1BWMA 4JO5A 2OXGB 2ITDB 1GYCA 4R0LA 4NO0B 1CT8A 5DQ9A 5EBLA 1NMCC 3LEVL 4HS3B 5FA4B 5I66A 3THMH 3ZW3A 1NCBH 2IOIA 1LO5A 4OGZA 1MEXL 4TUJB 4KFMA 2H2PD 1YEIL 1BFTA 3SSBA 1NBZB 35C8L 3VXNB 4GQZA 3ETBJ 1ZGLM 4HKJA 5DD1H 2RACA 4L05A 5GGVL 2QELA 4OI7A 5CLXA 3POHA 4P2QA 4CADA 3PWVB 2DQFA 1MWAL 4OCNC 1XB6A 2X4PA 4U1KA 4N5EC 4XNMB 4KTEL 4C56A 5BVPL 1QBML 1NJ9B 5D7IB 2WQWA 4FQXD 4PJAB 1JPFA 1TETL 3Q8CA 4DP6X 3MBWA 3B8YA 1SMDA 2XSKA 5CUSL 4IBSA 2X4RA 4WWKD 3UTPE 4PRHB 2X2HA 4JPIB 3LRHA 4QCIB 1NAML 4TL5A 1QW9A 1NDGA 2O4EA 2Q7AA 4KI5C 5ADOH 4LEBA 1YEGL 5CN2A 2JCWA 4TN9A 4S11A 4N2FA 4Z7WF 5B7EA 1UWXK 3ZDYB 4F9PC 3MRIA 4FFZA 4KKBD 5F9WC 1ZJAA 2X6MA 3S97C 1H19A 1KT2A 4O4YH 4KMQA 3B7UX 4ODWB 1AO7D 3H53A 2DD8L 2EXWC