5C97A

Insulin regulated aminopeptidase
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
866
structure length
860
Chain Sequence
LFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-cystinyl aminopeptidase
publication title Crystal Structure of Insulin-Regulated Aminopeptidase with Bound Substrate Analogue Provides Insight on Antigenic Epitope Precursor Recognition and Processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 263
structure length 860
sequence length 866
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 5c97A02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 5c97A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 5c97A01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5c97A03
3FHEA 4XN5A 5J6SA 4FYSA 4FKHA 3B2XA 2R59A 5FWQA 4XMXA 3FH5A 4KX9A 3EBHA 3B37A 3CHOA 3FTXA 4Z7IA 4KX8A 3FULA 3PUUA 5LDSA 1GW6A 4P8QA 4KX7A 2HPTA 3QNFA 4Q4EA 3CHPA 3FUKA 3FH8A 3FTYA 5AENA 4XN4A 4ZX3A 4FKKA 3FUEA 2DQ6A 4K5PA 4XN2A 2ZXGA 4PW4A 5LG6A 3MDJA 4Q4IA 4R5VA 4QPEA 3CIAA 3FUIA 4K5LA 3RJOA 4PU2A 4XNDA 3FUFA 4L2LA 4XN8A 1SQMA 4RSYA 4E36A 3FTWA 5DLLA 4XMWA 5LHDA 3FU3A 2XPZA 4ZX4A 3Q7JA 1H19A 4XN7A 4K5MA 4FYTA 1Z1WA 5K1VA 4XMVA 4ZW6A 3B3BA 3FUHA 4R5TA 3FH7A 4PJ6A 5AB0A 3FTSA 2YD0A 3B7TA 4KXAA 3CHSA 4XN9A 4OU3A 4FGMA 4XNAA 4X2UA 3B7UX 4ZW5A 3Q43A 3T8VA 4DPRA 3FU6A 5C97A 3CHRA 3FTUA 2XQ0A 3FTVA 4XMZA 4PVBA 3B7SA 3FUJA 4ZQTA 4R7LA 1Z5HA 4XN1A 4K5OA 4QUOA 2DQMA 4JBSA 4ZW3A 2GTQA 4XO4A 3FUMA 3CHQA 4QIRA 4R5XA 2HPOA 3FUNA 5CU5A 3Q44A 3EBGA 4MKTA 3EBIA 4QHPA 4FYRA 4NZ8A 3QJXA 3B34A 4MS6A 3FUDA 5J5EA 5DYFA 4ZX6A 3SE6A 4F5CA 4FKEA 3FTZA 4KXDA 4GAAA 4NAQA 4XMTA 4XMUA 3FU0A 1HS6A 4XO3A 3B2PA 4KXBA 5AB2A 5BPPA 4ZW7A 4K5NA 4XO5A 4RVBA 3U9WA 4WZ9A 3B7RL 2VJ8A 3KEDA 4FYQA 4QMEA 4XNBA 3FU5A 2XPYA 4ZX5A 4ZW8A 4J3BA 4HOMA 4KXCA
chains in the Genus database with same CATH superfamily
4K3DL 2NLJA 1MRCL 5E6UB 1O7SA 2GIMA 3NEXA 3SE3C 4X6DB 4XC1L 2FJUB 1FGNL 3MJ7A 1PNDA 4UT9H 1ZLUK 3N2JA 3CDGB 2GTWB 5C0RH 5FO2A 2ATPA 1N0LB 4JR9H 3S5ZA 4ODWA 3S3PA 4GXVL 1ASQA 1KS7A 2CXKA 2XTJC 2HKAA 3LDBB 2Z93A 4QKXB 1I1YA 1W8EA 1FFNB 2BNRD 2CO1A 3ARDD 4HCIA 4YLQT 1FHNA 4WU5A 3S4SA 3IVKA 3LH8A 3RIFF 1ADQL 1RVFL 3MMEB 3QFDB 2G60H 4RFEA 1RJZA 4XP9L 4X7SH 1HKFA 3RWFA 5I66A 4AVIA 2A4CA 4Y4HC 3SN6N 1BZ7B 3T09A 3HB3C 3T0ED 3L4TA 3P0VL 2EABA 4LVEA 4PQXA 1CDBA 1JRHH 4AE0A 3T87A 2IH1B 2WUCH 2JKLA 5KVGE 5GZNC 2BVPA 3M8OH 1ROWA 4EN3A 5FA4A 4JY4A 1JPGA 1MCOL 1Q0XL 3UJTH 2DWDB 4QRRB 1AZUA 4FG6C 4UM8A 3BP7B 4A04A 1DLFL 5EU3A 2PWDA 2QKSA 2J2ZA 3KH4A 2EH7H 2V3DA 3RJDA 3TCTA 3PE9A 1KLFB 2X87A 4W70A 2EILB 3LSOB 4NRYB 3QJOA 1B4TA 4U2YA 3FO1A 1CXFA 1Z3GL 3X2QB 1TXKA 1ZLVH 5FYJU 3ZZLA 2ALWA 1A2YA 4I8DA 2LE9A 5HYJB 5E1AA 5C97A 3ZE2F 3BYYA 4BKSC 1QLRA 2B1AL 3BH9A 1K8DA 1PLGL 1EJ6A 1KWKA 3FQTA 1AXSB 5BV7B 1IQDA 4F15C 2OMXB 1N10A 3VXRB 2NZ9D 4GW4B 4TULL 1CD0A 2YLHA 1QVOA 3T0DA 1FZMA 1ZJBA 1KYUA 2FQDA 4OSUH 3V0JA 2ICES 5JXEA 3T5WA 4A2GA 3RVVD 3IMVA 1VACB 4ONGH 3TCLB 2OMUB 3TPUA 2ENPA 1NGPH 2CWRA 2X05A 2IXQA 4EUPB 4AH2A 1A7BA 3E9UA 4M7KH 5DD5H 4ZMQA 1NMBH 4HFWA 4ZXBC 1NIEA 3I75B 2WBWB 3QUZA 4WFEE 4D0CB 2CO6A 2APTA 3MKGA 2X4PA 3JWOL 4U3CA 1MREL 3NCYS 1TIUA 3FOMA 3L7EA 1KV7A 1YMMD 1PLAA 2A9BA 5A3IC 4RMUA 4X7CC 1VGKA 1S4IA 1AR2A 6FABL 1J9QA 3CFBB 4JX0A 5FS5A 2VN6A 4D9QE 1R6VA 2UX6A 1THLA 3AXIA 5FYLL 5DMGD 5FYJE 3HC4H 5HDBE 3S37X 5K1NA 1LMIA 5EEXA 1NC2A 4M48L 3FT4B 1NGXB 3A4FA 4MKMA 1PZ5B 3D9AH 3DX0A 3V6OC 1WFTA 4UTAL 3RPIB 5JIDA 1MY5A 1SY6L 3VMNA 4P2RB 4P3DA 5T3ZD 5IMOA 4PJHA 1XCQA 2FB4H 3QQ9C 2YXWA 1TQBB 3O41A 2YKLL 4CJ0A 2XN2A 4S0TD 4J8RB 5KBDA 2ZXGA 3CSYA 4BA8A 8TLIA 2H2PD 1OHQA 2NCEA 2Z31A 2NXZC 4UDTB 4RISH 2HT4C 1MVFA 2ADIA 3VGEA 1TJIH 5G4OA 5B1CA 5D2LA 1HNFA 3PFUA 1FJOA 4NQXA 3V55A 3R4RA 1JZ4A 1VHPA 5IHZB 4BUGA 2ED9A 2GK0B 3P30L 5KWYC 3WY3A 2YA0A 4LCIL 1VADB 4OGZA 4Q89A 2Q8BH 4QCIA 2V9QA 3MV9D 2LTQC 2H8PB 2X70B 4JM4L 3H56A 4P4KA 2RTTA 4MNQA 4NENA 3AB0B 1EANA 2K3HA 3QDHA 2DL2A 3QI9C 3T65A 1XGTB 2QJDA 1BF5A 4L3FA 2ICCA 2YAMA 1WC7B 3K1KC 4G43A 3BKMH 3UPRB 3N50A 3ULVE 3C60D 2E56A 5JW3L 1N67A 1HEHC 2EXWD 4NZUH 3MNZA 4HUVB 2P8MB 3ECQA 4XOCA 3MYJB 5IJBC 4GMTL 2K8QA 2PTUA 2HJFB 2YPVH 2I85A 1II4E 5C07B 4GXUM 5F3HB 5HHME 3BAWA 4I0PC 2YGQA 4WFGE 2WKLA 4XBEH 3SCMD 4L8DA 4PJ5D 2NY4D 3CFQA 4FFYL 4ZOEA 4PWKA 1PAMA 3A6BL 4MQ7A 2X2UA 5AW0B 1ZT1B 2G2NA 4Z7OE 1XGUB 3SYOA 1AXTL 4YHNB 1P7HL 1J12A 2ZWSA 5CJ8A 1UVQB 4G3YL 2K8MA 5EORL 3ZL2A 4GG6B 4XBMA 4GMSH 1HH9B 2YK1H 1G6VK 4MQTB 4RGND 4B3EA 4ZFFA 4PJ8D 3NQYB 4NQVB 3N1PC 3HI1B 4HIIB 2HLAA 4E2OA 5I75C 3FB8B 3H9HA 1CTNA 3MGTB 4GQ9L 4NJ9H 4PJHE 3UJJH 2Y6SD 3MXVL 4HOMA 1XDTT 4R7NB 5F1IA 3L3IA 1HE7A 1BFVH 5FFLA 3HZKB 4R26L 4LO9A 3FF7A 2QVIA 5LBSH 1UCBL 2NQDA 5B1BB 1F18A 4WWOA 4FQLL 3ARBD 3V5HB 5IEHA 3TP4A 4JK0D 2LQRA 4M29A 4MQXD 4RFOH 5A2KH 3MI6A 3T0XA 5D2LE 1OT2A 2NSMA 5IQOA 3Q3GB 1URLA 1F8TH 3KPSA 1DFBL 1A9EB 1YNTB 2FJHA 3H2QA 3PWLB 2IWFA 1NCWL 2KQNA 5T3XL 1HZLA 1BVNP 1Q9LB 3HZMA 2AZAA 3KPOA 4JO8A 1N8ZB 4DWHA 4IOFC 2NX5A 4B0MB 1KIRB 2NY2B 4L3CA 5CUSH 2A7BA 4MNQE 2EIJB 4FQPA 4HKZA 4QWWC 5AAWA 3OAZK 1DUZA 3OBAA 2G4ZA 4FMVA 1LGVA 2WQWA 3MLVL 5AL0A 3B2DC 2ERJC 1A6ZA 1EJOL 4FZEL 4N2EA 4QRUA 3MUZ1 3ULUD 2WWOA 2R23B 3EHBD 4UTBH 4FHJA 1TZHB 5IMKA 3TYGH 1HOCB 1R5VB 2FLMA 3DO7A 2QSCL 3X1FA 2R8SH 5K9JH 2AVFA 2DH3A 1XV8A 4JKPH 3TN0B 5IHBA 4NQCB 1ONQB 1DQML 3N04A 5D71L 4FZ8L 3LVEA 3SY0B 2F8IA 3G5VA 3FN0H 1IIKA 2C9UA 3UO8B 1YUKB 5DLHA 1BYPA 2AEPL 4BQBA 4ADJA 1H6EA 5ETUA 2W88A 5FDWB 3VG9C 4KTDH 3DVFA 2OLDA 2VXQA 3QUYC 3RDTA 5DUPL 3RNQB 3FBKA 4NSKB 3KM1A 2P5EA 3L9BA 3NH7L 3S3BB 4AI7A 4CADB 2YMOA 2XVGA 5F44A 2BSTA 3WN6A 5J1TC 1DYZA 4FTDA 4JKLA 3IBEA 5I0DA 4GW5B 5GS2D 1LHZA 2DEXX 1RZ8A 2XIDA 4EZMA 1UA6L 3BIKB 3OC8A 4PAZA 1G5GA 5GHWL 5TFSL 1CIUA 3VB8A 3FB5B 2UUDK 1AZBA 1UJTA 3QDGD 3DMMC 5J5EA 1RPKA 3T3PF 4F7KA 4H26B 3WJLA 4NWTL 5B1JC 3ETBF 4QHUA 5LGYA 3KPSE 4QGTA 1A4JA 4FQIL 1MQKL 4FFVD 4FE9A 4PJAA 1B88A 2W9EL 3BQUB 4NP4H 1U9KA 1LILA 2NX5E 1D6EB 3QWNA 5SWSB 5B39G 4H8HA 4AYMC 4XNUH 5DRXB 1M71A 1PLBA 1RMFL 2PW1B 4NRXA 4XP5L 5FV1L 5D1ZB 5IVXF 4IMLB 1RPQA 1YEGH 1CCZA 2CG9X 4TTDC 1INDL 3NFSL 2KZKA 4RZCA 5FYKD 1TEFA 1HAUA 2WZ6A 4P23A 2FWUA 3KJ6L 3QYCA 5KVDL 2GY5A 4JHBA 4LNVA 4KX7A 1ADWA 3DSNA 4WI2A 4Y4KA 1TCRB 4QAMB 4DK5A 3CMOL 2AEQH 1H5BC 3QW9A 4DGIL 4F3FA 1QQDB 1IEBA 3ILQD 3U6RA 3QIBB 1GMEA 5BNXD 2CJ3A 2YWZA 5F1KC 1CLCA 3STBA 3DBKA 1DN0A 1MWAA 3ZHFA 4X7TA 4X9YA 4YXHH 3D0LB 2ZX8A 1J10A 4M93C 5I5JA 4DZ8B 4F91B 3IMSA 2P5EE 4AM0A 1P5UC 3ZRSA 3L1OH 3NJFA 2R0LH 3FCBA 4TQEL 2J6EH 1GGIH 2X4OB 3LEYH 2ZG2A 5JHBA 4YGVB 4ZAKB 3KYNA 1CYXA 1I9RH 4Y9GA 2VQ1B 4AZUA 4BJLA 2H32B 3MRDB 2YXVA 3OQRA 4J28A 4EQ2A 4YUEH 4KTEH 3WN5C 3OHMB 4KJQD 1DQIA 3Q5OA 2QZQA 2VKWA 5TDOA 1PZUB 4BFKA 5H4ZA 4F1SA 3UZQA 3SQBB 2TSBA 3VGGA 4AW4A 4OU3A 4XVJH 5CINH 1ZGLM 4LGRB 2PCXA 4AVHA 1I1AC 2OJEA 3KBEA 4NKOA 4PJAE 4DP6X 3MA9H 5E8DL 4JAMA 4YVNA 1OSYA 3MBWA 3O2VH 1KGXA 5DJZA 1JNNH 4LDLB 1OK0A 5EBMA 1G1OA 2XA3A 3LXBA 1QSVA 2B39A 5JA8B 4ZODA 4MHHG 1KCKA 1T1WA 4FLHA 4IGBC 5J1SC 2ED8A 3KLHD 2XG4A 2BC4A 2VXSH 3LQMA 5JOPD 4KQ0A 3OKMA 2J5LB 2FL5A 3BSGA 3BKJH 4BFIB 3GHEH 5HYJD 4FN0A 3LRGA 1A7NH 1Z0NA 3T77A 2VL5A 1ZA3B 5D1QC 3VXRD 2I5YH 2AFNA 5IWLC 3QAZB 5B22A 3HS0B 4XXDA 4JCMA 5B8CC 4WUUA 4FYQA 4LF3A 3FU5A 2H45A 4J3BA 2NTSP 2J21A 4XNYH 3LZQA 5A2LH 5C09B 2BK8A 4FI6A 3FZUC 3T6XA 2O61A 3G6DH 4BD4A 1A8ZA 1WCQA 3ABKB 4IIQB 2XY1A 3GQFA 4LAQL 4B60A 4AENA 2WXOA 3TEWA 3HCVA 2IBZY 1ACYH 2RD0A 3QRFM 2CALA 2Y1AA 3U9PL 3VU2A 3ARWA 1N0XL 1LDPL 5J3HC 1MH5A 3ZIYA 5EU5B 2OR8A 1WBZA 1QSED 2VDMH 4MXWL 4ZPVA 1IC4H 3B5HA 2ITDB 2L3BA 5DD1L 1UFGA 4ZMTA 1YECL 2A9AA 5DD6B 5D6CB 4H25B 3QT2A 4HBCL 4J1UA 4U1SB 5C6TL 1G6RH 4LLDB 3OB8A 4HC1L 2G9HA 4YFLI 5EIIG 5I1EH 5JIKA 1DQDL 3RUGF 5D8JL 4QHMB 2BHYA 4PB0L 4ZSOB 1BD2A 3PGCA 4WY7H 3BVNB 1FJVA 4FXKB 5KW9L 5CS7A 5F7DA 5IW6A 2IMNA 2ZUQB 4P2RD 2AANA 1DJYA 5J57B 3VRIB 5BUGA 4OY9A 1S7UB 2ZX5A 3STZB 3ZE1F 4Z78B 1F1DA 5E6IC 4YHYB 2R1WB 2PR4L 5A6MA 3H9YA 2F54A 1D5ZB 3MRNA 2XKSA 4MGXA 1CD9B 1A1MA 3RY5A 1PJWA 5GGQH 5I6XB 2JB6B 2DMGA 2NDGA 1TZOA 3N1GC 3FO2A 4XMKL 1E6OH 3QQDA 3DRQB 3VD7A 5KSBF 4XX5A 4EDWL 1KMGA 1C5DB 2QHRH 1QR1B 4WUUE 1KC5L 4JPIA 5DC0A 3IF1A 5E2VH 3VH8G 3G5YA 2NQ3A 4XH2A 2CO7B 3ME0A 2F53A 2CKBL 3RKPA 4FXGA 1CG9B 2BRQA 2WLNA 2VAAA 3O45A 5GJSH 4UCFA 1FPTH 5IVZB 1FL5A 1LE5B 5AVUB 5D93B 3X17A 1BSIA 4HSCX 2OXHA 3DK0A 3MV8B 5LO7A 5LAPA 1SM3H 3C12A 3GXFA 2R56L 3MLPA 5DU7A 2LHAA 1OAUH 3RKDD 1OV8A 3P3RA 1BOGA 5DI8B 3H9SB 4JFYA 2VLME 2A6DB 4B9ZA 1EAPB 3VXSB 4KGLA 3RZWA 1VFUA 4YHPA 4ZW8A 1NCNA 1SEQL 3TO2B 1X5YA 1JHLL 2A74B 2UZXA 3GBNL 3HTLX 4A2LA 4I18A 2XWCA 5EO0A 4DUVA 2J25A 2EICA 2PUQT 3MNVB 3V4LA 2LGNA 2UZIH 2CK0H 1M4KA 1BD2E 1OCWH 4KX8A 1DQLL 1KCSL 2O5YH 1HESA 4OCMC 2H1PH 1KXVA 5C0BB 4EZJA 2FK9A 3H0TB 3EO1B 4MMXC 1FBIL 1KCBA 3MV01 5IROC 2IO5A 5L2KB 1LEIB 1A7QH 3OKLA 3ARSA 4Z77A 4NRZB 5D96B 4HCFA 2F54E 1GIGH 3ROOB 1T2QL 3D1MC 1IC1A 5AVRB 1D5BB 2EDXA 2WOBA 2DLTA 4N0FB 3H42L 4W93A 4RNRB 5L4JA 3EKCA 5DJAA 3NPZB 4PLOB 3UADA 2W81C 1D5MA 2H2SC 4ETQB 4KJYA 2WUBH 4TL5A 4Y9FA 1BBJB 4AQAA 1JFQH 3RP1A 2EDJA 5IHUL 3VD9A 3V2AR 1SOSA 3QUHA 4R0LC 5FM4A 1MJ8L 4J39A 4KZCA 2NY2D 4APQD 4ZX4A 2VKXA 2AJUH 2CQVA 4TVPH 5EZLA 2F53E 4Z3HA 4N85A 4WRLA 1I3GL 3UO1H 1NBYA 5LGJA 3WJJA 4X9GA 2VDQB 4P9ML 4BFNA 3X1NA 4XHJC 5GS1C 1JGDA 4N25A 3SBRA 4D2NA 1BJ1H 2YS4A 3NABL 1KV3A 3EJJX 1BOYA 4JKKA 3W0WB 3P0YL 3KMDA 4HPOL 3MBEA 4JPKL 4FTVB 4NOBA 1JV5A 5DS1A 5KUMA 2HX7A 3TN0D 5FUZL 4N9GB 4NQCD 3FQYA 4ZTPH 1MCCA 1T5XB 1K85A 4X9BA 1L4IA 2DJ4A 3F7QA 5ILTH 2E7LA 2JNZA 4NAMA 3L7FB 1U58A 4JGUA 2FX8L 3TFKD 4YAQA 5GGTL 5HYEA 3U0PB 1D6VL 3QDJB 3QZBA 5DQDH 5AAPA 2IDSA 5EN2A 1VGEH 1FE8H 2XZQL 4HZLB 5IREA 4XCNA 3U36B 4R3SA 4KKLD 3WTXA 4N1HB 3D08A 2SEBB 1ND0A 5K9QG 2BWDA 5KYUB 2KC0A 5BRQA 4L4TA 4OUOA 3LS5L 4ODUA 3NN8B 4NN6B 1HU8A 3ZJAA 1GXWA 3LVTA 4HS6A 2I07B 4EVNA 4Y9CA 3KWWB 2DI7A 2GJ6A 1C8QA 3D18A 1BIHA 2YEVB 1HHHB 3IDGA 4O4YH 2ZOLA 1UM5L 2VLRA 4K23L 1BQLH 3BXNB 3P9LA 4LDOB 4H4NA 5B3NA 9CGTA 5JXEC 1Z9OA 5K9OB 5ITFA 3P4NB 1ESOA 4N90E 3UDWC 2ZF8A 1OPGH 2ZSWA 4MXVE 1V8HA 4I7ZC 4FABH 5BQ7A 5A6LA 2B20A 1G84A 1KTBA 3CVHL 3BQUD 3HI5H 3P11L 2FSEB 1M05B 1VFMA 4F7TB 4Q4EA 2W0PA 4MBOA 4UUJB 1QFWL 2PPDA 4GEJA 3NRFA 3I6SA 3AQZA 2WW8A 4XBPB 5C0CB 5SWSD 3GRGA 3HVDA 4L0ZA 3C8DA 4JO3L 4MA3A 5DT1H 1GS6X 5I0XA 4ODSL 4L2YA 5D1ZD 5D4IA 4F58H 3RU8L 1DQQA 1GA2A 4L29A 3T3PB 5L8JB 2HTLD 4DW2L 3AUVA 3JYBA 1LNBE 3F58L 1UB5A 4Y8DC 2EEXA 15C8L 1OTSD 2R69L 1L7IH 2Y36L 3IJ8A 3S3SA 4ZMNA 4ORZC 1ZPUA 2IADA 3IAGC 1WZ1L 1BAGA 1PCXA 5HHOB 2EKJA 4E36A 2BOCA 5E03A 3VGBA 3ZT7A 3TO4A 2AK1H 3QIBD 2VDOL 3MLUH 5IVXB 3FONA 1PX4A 3LKRA 2I9TB 2W60B 1QYGL 3DO0A 2A5UA 4BSJA 1WK0A 5B7FA 4XE5B 4RFNB 4F2ME 4WO4B 5CJQL 5FEBA 4GAYB 4Q6YA 1E40A 4GSUA 1AD9A 1LD9B 4LCWB 4MXJE 5ADPH 1XSJA 1EGJL 2XNAB 3D3VB 4FG0A 3MLXL 3VRLF 4ANUA 5EZIL 3II1A 3FHAA 4B9PA 4H8QA 2BZ7A 3W5NA 4JVPA 2IGTA 4GRWE 4ZAKD 1TQUA 1MRFL 4A6YH 4O58L 4UT9A 5BRZB 2BSBA 4L4TE 2BS71 4IOSA 3EH3B 3OPZH 1HL8A 4Q8BA 2AP2A 2ZUYA 3V52H 1YN6A 1CFTB 1E6JL 1SJHB 1G0XA 1PDKA 2MNWA 2V5SA 3HR5A 2C3WA 2ZOTA 7TLIA 1MJJA 2MTPA 2JF1A 2WQ8A 3BUPA 3LEVH 4P4KC 2VLRE 5E8PB 4G83A 5BOPA 1YNLL 2X40A 1VENA 1YY8A 1T03L 4E0RB 1A22B 3NJVA 2Z92B 2OL3L 3D69A 2X10A 3F12B 4DESA 3LKSA 4OLYH 2HKFL 3FFOA 2J56A 2G3NA 3KHQA 3OL2A 1J0HA 4Q56A 4FQ2L 5F7MC 1IGMH 4XB7A 2FAUA 4AIXA 4G9FB 5C0EA 1PBYA 4LL9A 5KVGL 4ILDA 4U3SB 3FT2A 4F8PA 4AX3A 4LLYA 2YGPA 3HW7A 5T3ZH 1VESA 4CILA 2KI6A 4PBWD 2L7UA 1WAPA 2HLFC 2Y6TE 3ELAT 4XMLL 2Z8SA 2PTTA 1RUMH 1UT1A 4Z7OB 2CNYA 5GRUH 3EZ8A 4LSUH 3NIGE 3OF6A 3SE8H 3MV7A 2HCZX 4KQ3H 1I7ZA 3FTXA 4JN1H 3P4OB 3KWTA 2OP4L 1VZHA 3EGXB 4NPJA 1T22B 1UWXH 3DHUA 4HIJB 5DR5H 4FD0A 1MFEL 3IXAA 5I1LB 3E8VA 2FGZA 3UTPD 5KYWA 5C09D 1Q9OA 2YD7A 4K7FA 4LBEA 1JN6A 5I9QB 1AGFB 1W80A 4AG4H 4OKDA 3ECBA 1PKQA 1L5GA 1MUJB 3ULSB 3HR6A 4BH7A 2G5RA 2QEJA 4L48A 3VRJB 5JXAH 1YMHB 5K39B 3DX6A 5JLZA 5GGRB 2F2HA 2R9HC 2NY3B 4XPBH 5IOPA 3DIVA 2DM7A 3L3OC 4H1LH 1GHFH 4LSPL 5I8EB 2DQFB 3V0WH 5I74C 3V9EA 4KY1H 4WEBL 1JZ3A 1KENH 4RRPA 2I32A 4YBQD 2K3TA 4XPGL 2BZCA 3L3DB 3WL9B 1UXSB 5AZEH 4AM0Q 1KT2A 4ODBD 2OI9C 4PJGF 1TKWB 4GS7B 1B4RA 3HJ0A 4F8QA 2QSQA 3Q2LA 5FGBC 2A73A 4NC2B 2BIMA 3IMRA 4PYGA 3K7UA 2CCWA 2KMWA 1C7TA 3T8VA 4CVWA 4OB5L 3QDMA 3BJ91 2GEQA 1TEYA 5FYJL 2W07A 4R97B 4MD0A 1JWUB 1Z32X 3U79A 1MHCB 1B6UA 4N2NA 1UD5A 4PP2A 3V0EA 3X3FH 3SYPA 3FUMA 3CHQA 1BXVA 3ABZA 1T04B 3BAXA 3G5XA 3MUUA 3S97C 1OE3A 4J6IA 1EO8H 1Z3RA 2MPAL 1JVOA 4ODXB 4RDBA 1CR9L 4WI0B 3RUGB 4KZEH 4MHHI 1JPFA 1H15B 5FX3A 5KSUA 3VQ2C 2XZZA 1LO2H 4GAGH 5C0DA 4ZUTB 5LCVH 3MV7E 1EUUA 3WUWB 3UYRH 2VDKL 5HDRA 5B7MA 5IKCB 3TNMA 3J27A 1Y6NR 4Z8FL 5LVEA 1U0QA 3ZE1B 3S8GB 4MDJA 1ILUA 4XGZA 2D8KA 3DETD 1OAYL 2OPCA 3M88A 5AVYB 5AZ2L 4K3EL 1NWPA 1GJWA 2IAAC 4YHKL 1DL7L 4U1MA 3K81A 3GKWL 3BCDA 5F9WB 2A4EA 5J0BA 2H0FA 1B4LA 3DSFH 1LO4H 1PKQE 2ZUUA 2DQJH 1DBJH 2QTEA 5FWQA 3CTTA 3LNHA 3MV8D 4HXBH 4MDIB 4EQ3A 5KSBB 1E8WA 5JT9E 1W6WA 1NFKA 1QSFB 3IAQA 3HG1A 3H9SD 2A77L 1F4YH 4IHOB 3X3GH 3KBFA 4F8TA 3ULUH 3DOHA 4GEIA 1HYSD 3LD8B 4EIUA 5FCUL 1F6LL 4LVNC 1R9FA 2JKRM 3QBTB 4MRCA 4Z5RB 1N3NB 3IMBA 5F6IB 5DDHA 4M00A 3D4GA 3RWHA 2DAVA 4NN7C 2EDNA 3VDBA 1A7OL 1HCZA 2ITCA 1CZ8H 3QO0B 4KK6D 4BFGA 3W38A 3ET9F 1TQVA 4HZAA 4XHQA 1NDGB 3L95B 5EU7C 1HL5A 1JD7A 2DWXA 2XFGB 3GBML 5C0BD 1RAMA 4IBTA 4OF0A 3A3YB 3BP4B 3QDME 4DVBB 5DRZB 1JUFA 2DQDL 4PV9A 4JM2C 6CGTA 2IPTH 1KTLB 1M7DA 1TTAA 2D0GA 2X4RA 3B8YA 2N56A 3CNKA 5TMNE 3HMWL 4Q14A 5AOMA 3ZHNA 2APBA 5DJCA 1J9RA 1AMXA 2B59B 4H44C 2ZKHH 4ZO6A 1BLIA 4KKAD 3CCHA 4PEEA 4BSWB 2YGOA 5GS2H 4NWUH 3SZKC 1IGYA 4GIAA 3CN2A 4IDLA 4QHNB 2N1KA 5ACLA 4Y2OB 1DJWA 1MW2A 2FEDC 1CI3M 4PRIA 4UQCA 4TSAL 5LBSA 1KN4H 4KXZI 4JRYA 3C5ZB 3D4ZA 3HC3H 4PJXF 1K8IA 1S5HB 5MERB 35C8H 5JW5A 1CFNA 4J4PC 3RYMA 4P46B 3VI4A 1WIUA 4PJBA 3NESA 4K2UH 4JFOB 2GFBB 3WFHA 1A4CA 4FYRA 4YE4L 4HG4K 1G4MA 2HJKB 2WZ5A 1TVBB 1SEBA 3CZJA 8CGTA 4C58B 1WRFA 1HVXA 1R3IH 1W0VB 1UM4H 5CKGA 2P7TB 3HG1E 5FYKH 3BE1L 2YZ8A 4RMRA 4OJDH 1YEHH 5H2BA 3S96B 4KVNH 3ZHLA 3KR3H 1OCOB 1XIWC 4NHCH 1RIUH 4Q6IB 4RVBA 4ARFA 3MGOB 5H37G 5DWUH 1BQ5A 1ML0A 5FB8A 4UTBA 3RVUC 1TJGL 1SDDA 4ZMVA 4WW2A 3EDJA 3QDJD 2H41A 4WK0B 1S8DB 5HVWA 2MOGA 2PYFB 3F2PA 4Y89A 2H6PA 4C4KO 3CLFH 2XZAL 3SOBH 4DIXA 2EH8L 4KZ0A 4V1DE 5AD0A 3OTTA 4I77H 4X4KA 4DCQB 1EZVX 5JPMA 1G7JB 2VN4A 4NPYB 1UH4A 3VWJB 1SBSL 3CIQA 2ID5A 4FLSA 2JKTM 3UACA 3VWKA 2KT6A 1AQMA 2X7LB 1KIUB 2W9DH 3FCTB 4R4FH 2Y5EA 4NYLB 4S2SA 2QKIC 5DA4A 5T5FH 2RAMA 2V17H 5DK2B 5F1OB 5AOKA 5JUEH 3ZW3A 4RMVA 2FCBA 1P7KB 4TPRL 4DGWC 3E9TA 1OP9A 4XAKE 5MP6L 5DZOA 4AC2A 5KTEL 3N1QC 1NFAA 2C3XA 1ZS8A 4K15A 1F97A 1AMYA 4OCYH 4QHLB 5ID1B 1OZTG 2A6IA 5ICZB 4PRIE 3TJEL 3T2QA 1T5WB 1UFUA 1U3HA 1MIMH 3B9KC 4KUZL 4XWOC 4E9WA 4JRFA 4X4XA 3QIWA 5AKVA 3ARQA 2X3BA 1TYEB 5C0CD 4N9OB 4BZ1H 5A2JH 2Y23A 2XWBB 3VI4E 4CBZA 1EO7A 2MQGA 2A6KA 1RZJH 2NY5H 4PJBE 1RQ5A 3KPRA 1VKXA 3JT2A 3CDZA 2J44A 3E6FA 4R2GB 2PXYB 4ZS7H 3RX8A 3B2VH 4F7EB 2CAKA 1HJCA 3TEUA 1JWSB 4X0KA 3PAZA 2K4AA 2CXGA 4GRLA 2WLYA 2Q7YA 1MOEA 2WQUA 3KPQA 1JFHA 2WXIA 4DQOH 3NGBC 1I85C 5DD3H 3IE4A 4M65A 3AT9A 3ARZA 3QQ3A 5HHOD 1AZRA 4XPHL 1TQCB 3G7TA 2W0KA 3TBCA 1SGKA 4S1RL 1TPXC 3MRMB 2Y1YA 4PRHB 2E9BA 4U0RB 5EEWA 5BV7H 4WO4D 5SWQA 1UQSB 5DF0A 4P04A 2PLTA 1SF5A 4LCWD 1HZHH 2NT1A 3RWJA 1X9QA 3D3VD 2AMUA 2GTZB 3LJ3A 5JHMA 3DVGA 5HJ3B 5CSZA 1OTUC 5H4YA 4JZNB 2WI0A 4W9HC 1I1RA 3HHSB 4EUPH 5LXGL 3QXTA 4JKMA 1TENA 1W0WB 2KPWA 4QY8B 2FE0A 3HI6L 3FOLB 4XZUA 1EHLL 2ZXWB 1OGTA 3M07A 1OO2A 4POYA 4UNUA 1FYHB 4HIXL 4LFHD 4FQHB 4OIFA 4QR7A 3B7RL 2J6EA 2FBJH 2IDUA 3K4ZA 4CSPA 2DIAA 2EQDA 12E8L 3FT1A 2LU5A 4P3CH 1KGWA 3DV4B 5IG7B 4JKNA 4H40A 4N3UA 4WV1A 2FJGB 3BSHA 3PGFH 4DKDC 3MNDA 5HVHC 3RZCA 2FIRT 4O2CB 3QWRA 3HE7A 3M1BB 4LESA 1M56B 2ZXEB 1GZPA 1QASA 2JB5L 5DHYB 4G9FD 4EBQH 1JZ7A 3OKKA 4WGKA 3I6KA 3RDJA 1GGTA 4RESB 4RX4D 5HVGB 2X0WA 3CQPA 2O5ZH 4N8CH 3KJ4C 5I8CA 1FAIL 3SKJH 3KPRE 4TMNE 3CH1A 3X13A 3KYKH 4A68A 5DFVC 1YEJH 2QPUA 4KUCF 4YSDA 2X1PA 5DQJA 3U0TB 1O7DE 3HRZC 4IMKA 4HAGA 4WEUD 4I18C 2IFFH 4FQXB 1OAQH 4YZFE 1A66A 3WHE0 1OOWA 1IFGA 1CBVL 2X1XR 3FFDA 4XCFL 1U93B 5EC2B 2O6DA 1DDHB 2XG5B 4B5EA 4L2LA 4YBLC 4G8GA 3O2DL 3NA4A 4CMMB 5LNGA 2AQSA 5I1AA 1CU4L 3U30C 1TTBA 4KKBD 3G6AB 4U3XA 3EO9H 3U4BL 4HU8A 1KEGL 3D0AA 3O6FC 2VLKA 4XCYA 5DUBA 1UZ8B 3FUHA 1HINH 4G5ZH 4KROB 3SQOH 4HHAB 2HB0A 3O9WA 1OAZH 1IEAB 2NQCA 2NY3D 4R4ND 4NBXB 4OLXH 2B4CC 2QDVA 2R4SH 3P73A 5CD5D 1FZKA 2GITB 2ZIDA 3N85L 3ESPA 4X6EA 1BMGA 3G5ZB 4GXUN 4O5LL 5IBUB 3NCXA 2EIDA 5KYYA 4YWGH 2WLLB 1GC1L 2ROXA 3UPCA 1HSAA 2XOTA 1NPCA 3TX4A 3ZDXF 3ZTEA 2V7NA 1JNJA 3IMUA 3P7QE 2EE6A 1H3WM 4OLUL 4H88H 4NPKA 3P9MA 1JVKA 4OGYL 4XCCL 2EEFA 3RIKA 1N2RB 1NCUA 2D31A 3GIZL 3ILDA 5CU5A 3E3QC 3CN1A 4MKTA 4HJJH 4LDCA 4K8RD 3IRPX 4AIZB 4G8FA 1G0DA 1OB0A 3BAIA 3KCWA 4UIKH 1N19A 4PGCB 5I5RA 3FO0L 3GMPA 2NZ1A 3FDWA 3BWUC 1G6RA 5HHPA 3WAJA 1KCUL 3TZVA 3QGOA 5TQ2H 4HUCA 1FG2B 3EJYD 4YPGA 5D72L 1P7QB 3L9YA 2OSWA 3L5XL 1LO3L 4PJGB 1XR9A 1IC5L 2PCPA 3AS1A 2DI8A 5F7LB 4AMWA 1PZ2A 3DKHA 4MXQD 1PS3A 5DWPA 3SKOA 3UZVA 4FXTA 3TVMC 3GJFB 2P24A 4UQEA 3JV5A 1MFUA 1E28A 3HMXH 4PCKA 4IRZL 4DAGL 4LEXH 3RHWK 5CBAA 5EZOL 5L2JA 3EOTL 3FH5A 2A3TA 2ZD0A 5IHHA 3JT0A 4HX1A 3BPCA 4LOUC 3B43A 3LXUX 4YHLH 1NCJA 3T2HE 2VR9A 4QI3A 1RULL 4FFZH 5I30L 2FZ3A 1UGNA 3EJPA 5C0JA 1B0WA 5AVSB 3B4NA 4MX7A 2CBMA 1KGUA 4U49A 2B1HH 2EO1A 3K1DA 3IETA 2OMWB 3MRJA 1DJSA 1EHAA 2VLKE 2OCFD 4JHWL 3L5HA 3OKDB 4J3OG 1JWMB 2VDNB 2J1KA 4XRCA 3MNWB 4XNMB 4QPEA 4HWBH 3N91A 2FR4A 3QZWG 1QSFD 1RIHL 3S4SB 2JJSC 2FLRT 4LK4A 1HEJC 3MOBL 1JDAA 5IQ9B 3OZ9H 4HYTB 1CGWA 1RJZB 4QYOB 1EIBA 4P49A 1NANH 1BVKA 3LZNA 3RWFB 3I84A 2EECA 4M1DL 3OMNB 3TFBA 3LV3A 1WIOA 2YWYA 3WTSA 3X14A 5EPMA 2PPFA 2VABA 4P2YA 3QUXA 1MFNA 2D73A 3P77A 4LSRH 4MB5A 4OKVA 5KSVB 4GERA 4AGOA 3TT1L 1RHFA 3WLBA 5I6NA 3L3HB 5FHBH 1S7QA 2DQCL 3U7YL 5J4MA 3TA3C 5JHDD 4FQQA 1C5CH 3Q1SL 2ICEC 4Y19A 2B2XH 3ATDA 4UM8B 4Y5VA 4A2FA 4UIMA 4M5ZH 2V9RA 3MRPB 3QJHA 3ZY7A 3GGWB 4ZJ9A 2UY7A 3B9VA 1J1XL 1R24B 2ATKA 5LIFE 2QBWA 2Y3AA 4J3SA 1G1CA 2ZOWA 4CU8A 4M5YL 3HFML 2DQMA 3FO1B 4FP8L 1RSFA 4NQUA 1QLFB 2EJ1A 2Y1ZA 3RPKA 4FJ6A 4LRIA 2RFXA 1KTCA 3RVXD 5F9OH 1HHIA 5F93C 3HG5A 5JQ6H 3DI2B 5D55A 1S3KL 2IGFL 1SN0A 4PVMA 3WXWH 4M7JL 2WLHA 4BE6A 4ZG1A 5IB2A 2XVLA 3C5ZD 2D3NA 3WEXA 3CN3A 4AYFA 3B5GA 1W6LA 2IALA 1FZMB 1RP8A 4BFFA 4ZTOL 1IZJA 3AXHA 4OT1H 4P46D 5L0QB 5GZOC 2C1PA 4YDIL 3G04B 4PCSA 1JZGA 2F1BA 5H37H 4EPSA 1N5YH 2IXQB 1W72H 4AH2B 3GEWB 1KR6A 3HPJB 4HIEB 4AYGA 4UM9A 1JYXA 1J1PL 4WW1B 3U9UB 4PJXB 2CHZA 3IK2A 2FHBA 2COQA 1CDHA 3FCGA 3HE6B 4FJYA 1XH1A 1QBAA 4G80B 4X5LA 2NTFA 4RMTA 4HGMA 3V79C 1FJ3A 2D2OA 2GHWB 4BE5A 3MLTA 2EDHA 4D94A 4HA1A 4N5ED 2AGJL 3S37L 1YAIA 3IJ7A 3QXDB 1ULVA 1QWHA 3RVWC 4AMKL 4MB3A 2OJZL 4RGOL 3TEYA 3LKQA 1J0YA 4RMQA 5GSVA 1Z7JA 4POZC 1UACL 1UKTA 1VFBB 2JQZA 3DV6B 4U1JA 4Y2DB 5ENWA 4C83B 3V0AC 1SXAA 1T1XB 4Y19E 3RX7A 4G6MH 4DN3L 2PWGA 4HISA 4J6RH 4WU7B 5G5DA 4ZZFA 1I9IH 4PJFF 2W94A 2WWMD 3SDDA 2WINB 1P2CA 1A6VH 4QJ4B 2XX0A 3S34L 4P5KA 4PV8B 5EOQH 2WLIA 2YLKA 1HCVA 2QSTA 4TUOA 4AY0A 1SOKA 3DRTB 3KDMB 2H32H 1YYMH 2H26B 3DNZA 2CA3A 2Z31B 2EUVA 1PF3A 1CICB 1SMOA 4AL8C 1QFHA 1NCBL 1XGQA 2WHVA 3A6CH 4JFFB 2BNUA 3RILA 1FFPB 1WUZA 1E4XI 3NACH 5AG8A 1TZIA 1H8SA 1T21A 2F5BL 5B39A 1J88A 1CGSH 3PAYA 4ORGA 3DIFA 3HEIB 3ARTA 4HCRA 3ZQXA 2JI1A 2AQTA 1WFIA 5GSRA 5MEOB 5EU6E 4MCYB 2B4CL 2OYMA 4BK4A 2F8VA 5K5YA 3T0EA 2XV2A 2VIRB 2ORBL 2EDDA 4R2GD 2PXYD 5E2UL 5MEQA 4QRQA 4ZMZA 2Y25A 3HG3A 3MUJA 1XF2A 2EDYA 4FNSA 4TVPE 5IF0B 2ARJB 4NQEB 3ZKSD 3EYVB 2WVVB 3VXUD 2WBJC 1RK0A 3HOGA 2A0LD 5AUMA 2GJRA 4OCSL 3H3PL 3UGEA 2HA1A 1G7HB 2A6JB 2YPLB 3GMQA 3OKNA 4HIQA 3C8KA 1ES0A 5BO1L 1EEUA 4XO3A 1NAML 2QLYA 3NK4A 3FTGB 4KQ4L 1OANA 1A4KB 2F0CA 2ILLA 5JW4Q 1XBRA 2ZF9A 2DDQH 5BJTA 1GR7A 2Z0UA 5DJ0B 5DO2C 1JG9A 1Q90A 3NSFA 3T6ZA 1LQBC 1MNUH 4U1NB 2ZOKA 1P4IL 5E56A 1TR7A 5HDLA 1SLUA 4W9KC 1YRKA 2AQ3A 4UBDD 2Z65C 4XMXA 4QTIH 3MROA 1S7VA 1FFOB 4XP6L 4Y16C 5ABZA 3MXWH 3SDCD 1NGZA 4M03A 3VFGH 2Y9RT 4RWYL 4Y5YA 2NDFA 5F1IB 2LOEA 4ZFOA 4P5TC 3A47A 4IU3B 5DJXA 2EUXA 3KXFB 5C0ND 2V3EA 3WNOA 4A6YA 5CN2A 5K69A 1MF2H 3VFWB 1BBDH 4KK8C 1X9RA 2EZ0C 3GSXA 1WTGT 5JOFB 2R29L 1LK2A 3ZZ1A 4Z76A 3BMWA 3KPSB 3ERXA 5I76A 4KO7A 2J72A 1BX2A 1OSEA 4CDGC 1NOFA 3DHJA 1P4LA 3QPQD 3EYFB 4HXAH 1BWWA 1AANA 3PUCA 3P9WB 2CLZA 1XSOA 4L3CB 3RVTC 3SPVA 2X4NA 4D0DA 1IGIL 3T0EE 3K6DA 2AJSH 2L4OA 4IDJL 1L9OA 2G5UA 5IJCC 3R7RA 2ITFA 4K5MA 3VTAA 3LS4L 4M62H 2WWNA 5DC9B 1XF4B 2N1TE 3BPOB 1A6ZB 4UB0H 4XNXH 3ZVVA 1F90L 1J18A 4FQXD 1GOGA 1IBGH 3AWFA 3QULA 3MRGA 1UXWA 2HUEA 4M8QA 4NQSA 4R6UA 5D1XA 3ATBA 2PCYA 3WXVH 4ENED 1IBYA 2YPKB 3V0IA 1RZ7L 2XPGB 2DQEH 1EO5A 1F4WL 2DIEA 2PP7A 4MA1C 5FR3A 5J11B 1NCCL 1NL0L 4AKQA 5HGBA 3K6SB 2XFXB 4Q6KA 3TJHC 4Z3EA 1P5VB 1VAHA 3BD5A 1P6FA 4ONFH 3UCQA 4ODHH 2O72A 2OZ4H 3O3AA 3AGWA 3X11B 5GISH 2EEBA 1G5AA 3PCYA 4MMZA 4ZUSA 1EMTH 1S7WA 4WK4B 1MFAH 2VERN 1U91B 4OF5A 2YC1B 4G6KL 4R8WL 3NP4A 1J8HA 4YHZL 2OX5A 4PN6A 4NQTA 2VDRL 4OGXH 5FXNA 4Q9RH 3ARUA 1OLZA 4IKIA 1F3JA 5BS0B 3OAUH 4LIQL 1R34A 5J13B 4WZ9A 1L9MA 4K55A 5EOTA 5CJXA 2W8CA 4UT9L 3HNSH 4H1LA 3QCUH 4GB9A 1LNCE 5C0RL 2J1ZA 3FHEA 4L9DA 4JR9L 1MHEB 4MZ3A 4QHUB 4D3CH 4KOCA 2G4EA 1CD1A 2IEPA 1AS7A 5HSFA 4PJAB 1D7FA 5I5MA 3QUKB 4XVOA 5F9JA 3APFA 3ZDXB 4MAYB 2G2RA 3MFFB 4KVCL 3SCMA 4TNEA 3GM8A 3ZKND 4LDEB 2J57A 5A2IH 3NCCB 5JNYB 4KDTA 1P7QD 4X7SL 4BA0A 1BM7A 5FKAB 3H6AA 4WFFE 4OIIH 3WFBL 3BSZH 1E27B 4UU9A 3KPPB 4JRXB 1EXUB 1JRHL 1OW0C 1R46A 1G7PA 2JWYA 4P23B 2WUCL 4IOIB 5CP3H 3AWEA 5D1XE 3N21A 4LPWA 1RJLA 4PJ8A 1MQ8A 1JHTA 4Y4KB 3VH8A 5T3ZE 5JPMC 1ETJA 3QORB 3UJTL 1G7MB 1VZGA 4K4KA 1NCTA 1N9PA 1OZUA 1XSIA 1DBKH 5ECGA 1MWAB 2EH7L 3EADA 4B9FA 5DTFB 2HMIC 5LCVA 3VWKC 1BQHB 3CVIL 4X7TB 2Y24A 3FU7B 2R1YB 3DX8A 1C08A 1GJIA 2GQHA 1F6FB 2ZYHA 3FN3A 3LPGA 3IDJA 3I9GH 3AUWB 4JFQA 3V0DA 5AW6B 1IAIH 4KJPC 3DBXB 4PWHA 2PWFA 3BAEH 4X6FB 1OP5H 3AREC 3PIQA 4WFED 1HH6A 4OAWB 4WSJA 3O0RH 2VDQH 3WIHH 2VE6B 2Z4QA 4N4EE 4LNRB 1O6SA 2IPUK 4KH2A 4WK2B 3KYOA 5GS3A 4AK2A 4AL8L 4UAHA 3O3BB 1UTDA 4UINL 4G9DB 4Z3GA 5E9DB 1KROA 4Z7UF 1U3HC 3U4AA 2C3VA 2I9LB 3LH2H 1MHHB 3BH8A 5BZXA 5BOJA 5EDXA 3TH3T 3VA6A 1KCVH 4ONGL 1KFGA 2IWKA 5EO9A 1PQZA 2BSRA 4HHGA 1NGPL 4OLWH 4I1PA 3Q6GL 4MA8H 5DD5L 3VACA 3S48A 4GUQA 4YMPA 5D7KD 1R3KA 2JE8A 3GM0A 1QO3A 4H5SA 2I60H 3PWJB 3Q01A 3MBWB 5KBLA 4XNZC 1MCWM 5D7EA 4NBZB 1IRAY 4P2OB 4Z7VF 4LRNL 1RZFH 3STLA 4QXGH 1NFDF 3TT3L 4HD5A 4ZBJA 5AKTA 3FMGL 3HC4L 1BG9A 4I2XB 3VD0A 1WWCA 3ZHKA 1D3CA 3BPNC 4RGNE 4DK6A 2I26N 4PRDA 3NZ8A 3PNWA 4QXVA 4C4KT 1MCIA 1OT1A 2IGLA 5J12B 5CZXC 6TMNE 4CDHA 2P5PA 2HXAA 1OF2B 2A7GE 4XXDB 3QUGA 2DBLL 4WNSA 4WUUB 3FULA 3JWNG 5CLXA 2IDTA 1P53A 2FB4L 2AHIA 1A5FH 2ZG3A 4IKNA 2RJMA 4WF7A 3P2DA 4A38A 5EG6C 5BZZA 4JRWA 2PTVA 4K71B 2AV1B 2XTSA 2CO4A 2VL4A 3V7AG 3Q6FB 2OK0H 1MFBL 1QFPA 1TVHB 5EMYA 3F7KA 3ULVD 3DX9A 1IMHC 1E5UI 5DS8B 4K9EH 1ODUA 5K59E 3OHXB 1J86A 5E2WH 3QUZD 3DOSA 1NMAH 3MDJA 1ZA6A 4PJEF 4BDVA 3UYPA 4G7YL 2CRYA 4TUKL 4Z7WA 1TQWA 1CDUA 3UP6A 1DZ0A 5C0AA 5GRJH 4A63A 1N6QH 5KUKA 5H94A 3F28A 1TG8A 3IFLL 1Q9WA 3JYCA 4PJDF 3RIAK 3V5DB 5C6WH 4TRPH 4X8JB 1Q9KB 3OG6B 4Z18A 5A1AA 2G9HB 1GXEA 2NNAB 5HYFA 4MJ6A 3ULUE 1HILA 4GYBA 2AV7A 3BKML 2GABA 4E9QA 5LBGA 3V4VA 5IR1B 4WJKB 3VFOA 4Y2DD 4NZUL 2QGCA 2MQ3A 3TBYB 1JVLA 2BSED 5B1AB 3UG4A 1SYSA 3TBVA 5F7DB 2YPVL 4WI3A 4FGMA 3SD2A 2AQ2A 3Q43A 1BVZA 4XBEL 2MCPH 1U8KB 4PVBA 3F05A 4WI4A 4X6DA 5A3YA 4WI7A 5IK3B 2CZNA 3K6IA 3EO0B 4IK7A 3CDGA 1IGCH 2Z31D 5FYKU 2G3MA 4NNXB 3RAJL 2QADB 1N0LA 3ESNA 1J87A 1CICD 4K3JH 3WFDL 4JFFD 3EDDA 3F6JA 1FFNA 5T5FA 4PJFB 1PY0A 3FCQA 3FO2B 3MMEA 3QFDA 4LGPB 2EO7A 5D7LB 4HKXB 2YK1L 3FB7B 2FX9H 2CUMA 3H85A 4JPIB 3GBDA 4NJ9L 1BZ7A 3H7LA 3UJJL 5E6ZA 3RX5A 1A14H 1S78C 1BFVL 2IH1A 2VAAB 3O45B 4LU5H 4PY8J 3SEPA 4HWZB 1H3GA 2GSGB 5LBSL 3MSNA 2XQBL 1RH8A 2IH8A 4BSVA 1SVBA 4BZ1A 3W2DL 1I8UA 3LN5A 4NHUA 3QHFH 2DWDA 2KDGA 4QRRA 4KZDL 3BP7A 1F8TL 4ALAC 4RGMB 4FCHA 4Z7WE 2OW6A 2YPLD 1KLFA 3WKYA 3LSOA 4NRYA 3UC0H 5D4JA 3MRIB 2WAHA 3MCLH 4N0YH 5CUSL 4YHPB 2B3IA 5C0GA 3U7WH 1N5AB 5FYKE 2XWTB 1PG7H 4PBVC 1EAOA 4L8SC 4M6NL 3GMOB 1GCFA 3UH8A 1DSFL 4Y5XC 3SGKA 2VSCA 5D4QA 1ZLUH 3S98A 2OMXA 3VXRA 2E74C 1FSKC 4GW4A 1ZVHA 2V4LA 4HV8A 2VZUA 4M1CD 5T1DL 5K9JL 3CDCA 4L5FL 1KCWA 5E0FA 1HXYA 1DVFC 2GI7A 2VC2B 4JRLA 4X6DE 4Z0XA 1VACA 1ZRUA 3NZHH 3TCLA 4XTRC 4LP4A 1MIEL 3FN0L 4EUPA 1S9WB 4FMFA 1EPFA 3PRZA 2P5WB 3G5WA 3LMJL 4ZUWB 4XN7A 1A02N 3I75A 4KTDL 3IJEB 2XJKA 4AZ8B 4PCTA 2YQGA 4D0CA 1H6FA 1J5IA 1D5MB 4J27A 3KPSD 4KJYB 4XOBA 2VXTH 3GMRB 2RALA 5AB0A 4AQAB 2P52A 3BO8B 1QF0A 2Y2WA 3AFLA 4K8RH 3HS9A 3CSGA 3U6XA 2YKKA 4ZW5A 3T2IE 2HYMA 5G4MA 4G7QB 3CFBA 1J8KA 1JGUH 3NTCL 1XCTB 5LGJB 2D4FA 4N5PE 4Y4HB 3FT4A 2OTPA 1NGXA 3HB3B 1PZ5A 2GBUA 4GKLA 3QUXC 4QRRE 3ZMRA 1PMYA 2OZNA 1CXEA 3MBEB 5FUCE 4MNHA 1JV5B 5INDB 3Q8FA 4BKLB 1YJDH 3FXSA 4NP4L 1CBJA 4J8RA 3E8UH 4JVUA 5JW4R 1CE1H 1MRDH 3VG0H 3LAFA 4TQIA 2GKIA 1Z9SA 2DLGA 4KUCD 3VYNA 5JOPE 4KJWC 4YAQB 1UWEL 3OG4B 1YEGL 3RDTD 3ZTNL 5EN2B 3KEDA 3EGDB 5IHZA 4EOWH 1YAZA 2GK0A 3QNYB 2O1AA 2BINA 1VADA 2NRDA 4IYKA 3VXRE 1DJXA 4Q0XH 2VH5H 5SV4A 3GSNB 2H8PA 3F7VA 1EBAA 2E6PA 2X70A 4L4TB 4LL4A 3W9EB 3QIUB 2FTAA 4F15B 3P7UE 1UD6A 2Z34A 4N1CA 4EVNB 3H3BC 3EIMA 4GSQA 5BS0D 4BIKA 5IFHL 1M1XA 1DSWA 1XGTA 1BGXH 2GJ6B 2HPTA 2A1WL 1WC7A 2YBGA 3D18B 3JTTB 4HD9A 3ISYA 2M1KA 4UV4H 3VMPA 3UPRA 4N68A 4YXHL 5IBLC 2P4AB 2VLRB 4PJIF 5IOKA 3VAEA 4HUVA 3W57A 3HNTH 2P8MA 3KPLB 3LRSA 4OR1A 4ES9A 2RA1A 3MYJA 5CF3A 2HRPH 3GINA 3O6LH 4ONOA 1BXXA 2LAGB 2HJFA 3L1OL 3TMNE 5C07A 2J6EL 1GGIL 1URIA 1XSKA 4POUB 5T1JA 4MAYD 1Z5LB 4IM8A 3CC1A 1MZZA 4F20A 1I9RL 5BXFA 4IQHA 4YUEL 4KTEL 4MA3B 1UEMA 2WGXA 1E8YA 3LNIA 2CBTA 1L9NA 4JE0A 1XGUA 2OMNA 1EZSA 4YHNA 4YXLH 2NUTB 1UVQA 1H19A 3WKMH 4GG6A 3LX9A 1QFUH 4P23D 2C4XA 3V8OA 5CINL 5LXVA 4KK5D 2IADB 1ZOXA 4NQVA 4Y4KD 3HI1A 1C12A 4HIIA 2EDLA 3FB8A 3MGTA 1AFVH 3QORD 4NFBA 3VI3A 3ENEA 3DJSA 3MA9L 3TO4B 1OVZA 3SGJA 3O2VL 1PG7W 4PP1D 4O02B 3FONB 1OQXA 3HMXA 1JNNL 2OCCB 3LKRB 3LXCA 4UYQA 1GGCL 3HZKA 4YFLF 2VM3A 3DYMA 4GSDL 2EE9A 3US9A 2E6QA 2AXHA 3PV6B 3V5HA 1T0OA 2AC0A 5GJTL 2VXSL 3IJYB 3BKJL 4BINA 1A9EA 1U2HA 1OSPH 1YNTA 2NXZB 3F7LA 3PWLA 3CX2A 1A7NL 1GYAA 5A2FA 8FABB 1ERNA 2A9NL 5GS0C 1E65A 1KIRA 1PEZA 2V6HA 3ZMNA 5HDQH 5E5UB 3D87B 1X5ZA 3ARDC 5HI5D 5B4MD 5IGXL 3I02B 3NBNA 4W9JC 1A3ZA 1TSRA 4EI5B 1O0VA 4LKCB 1PDKB 2AJVL 3VDAA 5TE4H 1UEYA 2KPNA 4HWBA 2LTQB 3C2AH 1CLOH 5CEZH 2HKHL 2IDFA 1UD8A 2ZP9A 3EJCA 4TF4A 4ATTA 3RTQC 1WGOA 5E7BA 5JXNE 3QI9B 1TZHA 2MKLC 4M5SA 1HOCA 1R5VA 5F7FA 1C7SA 5KYXA 2ZWZA 3D69B 1F3RB 2WXHA 5C07E 2BERA 1H3VA 2X4SB 1ACYL 2YGNA 3IGAB 4OUUB 5FUOH 4ZMLA 4Z7UB 1YPZF 3TN0A 3U1PA 4NQCA 1ONQA 3S5LB 2HN7B 4L1HA 3VX0A 3SY0A 2VDML 4N3TA 1BVLB 2WTRB 3HZ3A 5J56B 4LMQE 1QFWM 1U3YA 4P2OD 5AAMC 1XO8A 5FDWA 3JWNH 5I24A 3RNQA 1GPOL 1F13A 1H8NA 4LHUB 4NSKA 3AGVA 4GG6E 1KJPA 2PTTB 5D70H 4BZ2H 5I1EL 5EIVA 1SDYA 3MV7B 3LTVA 5CZXD 4W1TA 2QTVA 1A3QA 1HYTA 1ORQA 1QNZH 4WY7L 4GW5A 3VI3E 4GJTB 3B9AA 5TE6L 1ID2A 3BIKA 4WUUD 2YD8A 5ABDE 4NZRH 5T33L 2GVYA 5FFOA 5BUAA 1N4XH 3FB5A 3QGVA 1GRWA 2WXKA 4LCCC 4NO0B 3WEBA 3QZOA 4OM1H 4Y5YC 3RVVC 4H26A 4B9KC 1U8NB 2AITA 3UMTA 1H8LA 1KPUB 1SXCA 3OAZH 4AVJA 3DTDA 4DP5X 5F3FA 1L7TH 4N5UA 4NJAL 1K72A 4Y8AA 1QRNB 3DX6B 5E94B 4XVTH 4YOKA 1XWVA 1D6EA 3S8FB 1E6OL 4FNPA 5H37A 5EV7A 3FYEB 2I27N 5SWSA 1W72A 4A2EA 2CCLA 2PW1A 1GCYA 5E9AA 4KWUA 4JY5H 5D1ZA 3FU6A 4IMLA 4DETA 2DYRB 2VMEA 4XMZA 2O6FA 3PHQB 4NNPH 3P7PE 4MD4A 5CILH 5T1LB 3SDYH 5C9JB 4JJOA 3ARGA 5I19H 4XPTL 1YG9A 4GBXA 3CXHJ 2DIBA 3CXFA 4PJEB 5GJSL 1FPTL 2YJQA 2JIXB 4NBYB 5DMGC 3CFCH 2IF7A 5HQDA 1TCRA 1LVEA 4TV3A 1QQDA 4JVWA 4QHPA 1JERA 2IBBA 3QIBA 4LARH 4NQCE 5F0LB 1JPTH 1JPSH 1OAUL 4PJDB 1WHPA 4YHIB 1PE7A 1CD8A 5F96H 1XX9C 5I1IL 3D0LA 3FT3A 3BVXA 3DGGB 4HUMB 5DZPA 3MHZA 3MRFB 1XEUA 4YHOH 3PL6C 2QADD 3U46B 4LSSH 3S3CB 3NAAH 3BGMA 5FO8B 2H2PC 5KSUB 5CN3A 4X50A 5ANHA 5TPWH 1OCRB 3VG9B 3QYMA 5E1IA 4ZAKA 2CK0L 5D7LD 2H32A 3MRDA 1AOHA 2H1PL 1PE8A 2L8AA 1R47A 2VW7A 4MDJB 1EXHA 2C34A 2ZJSH 3MLZH 4XGZB 2DLHA 4OLVH 4DKEL 3GNMH 2H7WA 3JUYA 3CVDA 3T0BA 3AM8A 2GK2A 4ABWA 1A7QL 3RIAF 4YSUA 3EFFA 5GGUB 3V7MA 3EFDH 2HP4A 1GIGL 3BKCH 4F27A 1ZLDA 2F74B 2PW2B 1T2XA 3C60C 5CJXC 1L9PA 2EXWC 2E7MA 4UQBA 5DMIL 2WUBL 3VM7A 4TL4A 3A0OA 3BMVA 1JFQL 1M9SA 5HGDB 3BEVA 5I8OH 5SWSE 5J7CC 1TYRA 1Y3GE 4OCNC 5MEPB 2ZICA 3SCMC 1TTFA 3O6KH 3OC5A 4E42B 3HC0B 1S9KC 4NDMB 2NY4C 4JFUA 2BZDA 3UO1L 5L6YH 4P9HC 1YN7B 5LG1A 3RWHB 4BK5A 1I75A 1VZIA 4DP2X 1V7NH 2RHEA 3MUHL 1C8PA 5J6HB 4Z0BH 1ZA3A 3HUJF 4KRMB 1GGBH 1AS8A 5KN5B 4RGNC 3DX7A 5A2AA 4PV9B 5TE7L 3VD4A 3JWDH 4PJ8C 3SPCA 1Z9MA 6PCYA 2X4RB 1YQVH 5KJRL 4MB1A 3GDCA 3GMMB 2VO8A 5C09A 4LLVB 2X2HA 3CVBA 4EZKA 2Y6SC 3FTUA 4K89A 1JNLH 1LYQA 5ECJE 5ILTL 4IIQA 1Y6KR 3IMWA 2UXTA 2P5WD 5ESVB 5KBPA 3BDYL 5DQDL 3UAJD 4N90D 4R83A 1WBXB 2VITB 1D5RA 3ARBC 1VGEL 1XVSA 2DBJA 3PP3H 1FE8L 4ZOAA 3QUMB 4M93B 1EVTC 3OPUA 5EU5A 2WV3A 5IT2H 4TSCH 3L13A 3T2NH 4DOHB 4JRYB 2ITDA 4G1EB 2ZONA 2CJSA 3NQZB 1HC1A 1W15A 2EC9U 1Y0LB 4S1QH 5DD6A 5D6CA 2NSXA 4RMWA 5GS0L 4GAAA 3FXIC 4XC3H 3C08H 1GZHA 4LLDA 3BUYB 5ESQB 3WFCL 3WN5B 4Y4HD 1QTSA 4AIEA 5JA9A 3P69A 4O4YL 1TZGL 1VFAB 3PGDB 2BMKB 4PH8A 7TAAA 4ZSOA 1AYOA 3BVNA 5EBWA 1WAEA 1MCHA 2NYZA 3MBED 3GJFH 2ZOUA 3ZK0A 4FG2A 3EHBC 1MZYA 5FO7B 1I1AB 2DLFH 4NIKB 3HI5L 1S7UA 1NBZB 5G55A 1EZLA 1HT6A 4GIOA 3B37A 2EYSA 4UT7H 3T74A 4JFZH 3PUUA 3EAKA 5DT1L 1D5ZA 5DJDA 3WD5H 3B8SA 3QJQB 1EZMA 1WF5A 3EF4A 3PXLA 1OCZB 2H6PB 4IGBB 4CN6A 1AH1A 2QQNH 5HYSG 2XRAH 5E08H 5LQBL 3UBHA 3SBWC 2PWEA 3DRQA 5T5NF 1L7IL 3ZDYF 2UVEA 4IBWA 2XKUA 1C5DA 4QTFA 4NUMA 1QR1A 1U8HB 3FAXA 4L4TD 5IBTH 2OZ4A 1CXIA 1MCNA 2VDNH 5B21A 3QIUD 4X5WB 2EVIA 2CO7A 4W6XB 5D1QB 3MLUL 3UTPE 1DCLA 1CG9A 5C09E 4LEOB 2GJ6D 1P4UA 3KG5A 3ECVA 4X80H 4I13B 5IVZA 5DLML 3VFPA 2VLRD 1M3JA 5AYQA 4FA8A 1LE5A 2DV6A 5ADPL 3MV8A 3G3LA 2ITEA 2EVGA 1WT5A 3P4MB 5E4OA 1KY6A 3SB3A 1KTOA 5F8QC 5DI8A 3H9SA 5KOVC 2XHNA 4FFVC 2A6DA 3KGSA 5I18H 4YEFA 1EAPA 3VXSA 3QIWB 3OPZL 3TO2A 3UROR 2K70A 1GYWA 2AJZA 3JSSA 3V52L 2UV3A 4PJIB 1F1AA 3LEXB 5I8KH 2IAMC 3E6FB 3L3KA 2EINB 3MNVA 3WIFB 1I1FA 1MCPH 3TYFB 1CTMA 4M43H 4ZSOE 2JFCA 1KULA 4DPAX 3SPJA 2NR6A 3H0TA 3BSZA 4OLYL 3TO4D 3EO1A 3D85B 3RB7A 1TJXA 1WZAA 4OD3H 3ILQC 5L2KA 1LEIA 4HQQL 4KRPD 5CP3A 1T6VN 2Z35B 4NRZA 3RL2B 2ZCLH 3QQ9D 2H5UA 3ROOA 1J8RA 1D5BA 4N0FA 3RWGB 1N68A 1RURH 4RNRA 5T3ZL 4MZ2A 4K7PH 3AS3A 2W38A 5I71C 4MTMA 3NJHA 1BBJA 3CZFB 2HJLB 1SHXA 5GRUL 5CCHE 4HAKA 2WIMA 3KLSA 1PZDA 1TYJA 4F33B 2YZ1A 3LDBC 3VFMB 4JN1L 5AALA 3EXJA 1IB5A 4M3KB 5HD8D 5ICYA 3D07A 2DPKA 3HG2A 3ECWA 5F72S 1IKNC 4EI5D 5ACZB 1LWHA 5I15H 5E8EB 5DR5L 1UT2A 1O9ZA 4DGYH 4OGQC 1S2EA 3U0WL 3WIHA 4OFQA 5TH2B 2WWKO 3UEZA 4U1KB 5EEUA 4L8BB 3MV8E 3P4LA 3W0WA 4AG4L 1HWGB 2OL3B 1EJFA 3B1TA 3PWPB 1LDSA 3O0LA 4WV1B 4FTVA 5JXAL 2EIBA 4J3TA 1CC3A 3RZCB 1AQKL 3H9SE 3A67H 3F7YB 3QC5X 2FJFB 1HXMB 4N9GA 1F6AA 2WC7A 3VXSE 4XPBL 1T5XA 2ZXAA 1AC0A 4F92B 1IC0A 2W91A 3V0WL 2JJWA 4IIZA 1NZRA 3M1OA 3UABA 4KY1L 1KENL 3TH2T 3L7FA 3NCYP 3JUZA 1S46A 4PY8I 3U0PA 3QDJA 5LB1A 3X13B 4DTGH 1KCRH 4S1DD 4JM2F 3LY6A 4LHUD 1UURA 4HZLA 5AZEL 3ASWA 4XMWA 3BGFB 1DVQA 4KMLB 1ORSA 5GRZA 3U36A 4UYPA 5ALCH 1GYVA 2J4WL 2WNWA 4KHTL 3L54A 2SEBA 3MV7D 3OF6D 5F7EH 5KYUA 3TWYA 3SD5A 1K6QL 2Q8AL 3F7PC 2FWLB 2P46B 1RUPH 4G8GB 3NN8A 3NFNB 4OW6A 1GGUA 4DVRL 4ELMA 2I07A 3RWCB 3KWWA 2D7MA 5L2KE 2K7QA 1HHHA 2DMBA 4LOEA 2YFOA 4ZPTB 3WS6C 1HSBA 2X1WL 3DO2A 4PUBH 4MMXB 3P4NA 4ZQTA 3PDOA 4PWJA 1ZLVK 1EO8L 4KZEL 2BVEA 3P54A 5B7EA 3H2WA 1JV2B 1KGJA 3MSAA 1LO2L 4HP5A 3FAWA 4GAGL 4FA7B 3O9WB 1S9XB 5LCVL 2FSEA 1M05A 2BVQB 4F7TA 4UUJA 3NZUA 4WGWB 3UYRL 4HLJA 1LNDE 3DK2A 3E80A 4XBPA 3ZYZA 4B7LA 1A1OB 4QRSB 2DL9A 2V7HB 1XB3A 4MS6A 4QNPF 4WNQB 1F86A 2XA8L 3QNZB 4IOFD 2V7NB 3GK8L 4R0LB 3QHZH 2HRHA 2OTUB 4YN3A 5T1LD 4G1MB 2YARA 3J7HA 3KYMA 4HUWB 1QAWA 1E5CA 4KXBA 2D31B 1KXQA 3DSFL 4L0PB 3W0WE 5DEFB 5LGHL 2DQJL 1DBJL 3GUTA 1JGEB 4FTVE 2ZX7A 2PPAA 4HXBL 5HHOA 1UUNA 4LCYB 1ZHNB 1G9NC 3QDMD 2CGRH 2DQHL 4XN5A 3QWOB 5IVOA 3IFNH 5IVXA 1U4GA 1MKFA 2Q7NA 2W60A 2X5PA 4OGAC 1X44A 2I9TA 1T4KB 1U4EA 1HDMB 2M8XA 4WO4A 3QK0A 4E41B 4GAYA 1FG9C 1TQBC 3CSFA 1LD9A 3QDJE 4UAOC 4A66A 1KPRB 2Z6FA 3D3VA 3SKOB 3V5KB 1DQKA 3TF7C 3O11B 3MN8A 3V4UH 2P24B 3DX3A 4U7MA 3GRWH 3F5WB 3VGAC 1OOAA 1MN4A 4P2QB 5L2JB 2BIOA 4HJEA 1YY9C 2WVSA 4M7ZC 2DQGH 2XV6B 3AWGA 3PFQA 4HX1B 4MJJA 4FKKA 1IAOB 4WAFA 4YQXH 1JGIA 1JGLL 4NUQA 1U36A 4HFUH 4IBSA 1CFTA 1SJHA 2G0LA 3CWGA 1ZT7A 2CBQA 1NEZG 4JO2H 2ZUTA 3ZOAA 2WSDA 4LSQL 2D03L 5J1AB 1FVEA 1JZDC 1VA9A 4QEGA 5E8PA 2ZKHL 5F88B 1M57B 1OEZW 2DYPB 3SYAA 43CAB 3SGEH 3PP4H 2VQXA 1EH9A 1XF5B 3MRJB 3R06B 1JZ5A 2CHDA 4PJ7F 4JG1L 4E0RA 4NWUL 3VSUA 2Z92A 4TTGA 1IQWH 4R7VA 3F12A 4JDZB 3DVIA 5TD4A 5HI4C 3E1ZA 4XPFH 4LOFA 5DJ2B 1NIBA 1FI8C 4H8WC 2FR4B 1LWJA 2X6AA 4YDJA 1NGQH 4R9HA 4G9FA 5CEXA 2J8UF 4RX4A 3RKDC 1BVKB 4U3SA 4IS6B 1E3FA 2WSKA 2AJ3A 5F7WC 5PCYA 3T3PE 5JS3E 2IMMA 35C8L 4X2UA 2KKQA 2PNDA 4DPRA 3AXLA 3HHRB 1MLBA 4YDLC 3MUGB 2CO2A 3QG6B 1KXQE 3P77B 3FFCB 2A83A 4OKVB 5CNHA 4TTDD 2V2XB 3MVSA 1EQWA 2E7HA 4OCXH 4LL1A 4PGEA 1JXKA 3P4OA 5HHOE 5DVNA 3KVPA 4R5XA 1UASA 1ZSDB 1T22A 2XN0A 2HPOA 5AW2B 4CKVX 2YIHA 4HIJA 5CGYC 5FYKL 5IVXE 1D5IH 1QTYT 1YEHL 5I1LA 2D7OA 4KO6A 3QH5A 4KVNL 2XQYK 2F7OA 2UY6A 2AZUA 4A55A 1ZTMA 3UTSB 3QG7H 4U1LB 1IE5A 3O3DB 5DWUL 4LSTH 3WS3A 2FNWA 2OQJB 3D3VE 4TNWF 1MUJA 1CF8L 4U4BA 3LZRA 4HEPG 2GIXA 1Q0YH 4UNVA 3UG5A 1ZTXH 2IQAB 1YMHA 1RZPA 3HUJB 3WDJA 4IRSB 4LHQB 1P9MA 2VR4A 3CLFL 1HHIB 4QD2E 3U48A 1XCWA 3ABLB 5I1HH 5FHAH 4GSXA 1QP1A 4XNBA 3CU1A 4PRID 4TNFA 3UBXG 5BRZE 5FFGA 4MQSB 2EO9A 5I8EA 2DQFA 1XGZA 3HN3A 4JRYD 1P7BA 1RZIB 1WGVA 2WYHA 1G1KA 4L9LC 3KS0J 5EZPA 3ROLB 4BUQA 2DMHA 4APQC 2NY2C 4QJ5B 1J9CT 2XU9A 3L3DA 1AKJB 3WL9A 2V17L 1TKWA 2MH4A 2DQIH 2QMKA 2Q9OA 4HK3J 2VLLB 1PX3A 3IAPA 4NCC1 2E59A 4YC2C 1Z9PA 1W0YT 1IAMA 4TSBL 3WTVA 4J5VA 4BH8B 1BFOB 1WBYB 2EDBA 2J71A 1I1AD 1MEXH 3GKZA 3PAVA 1FLTX 1JWUA 2LU7A 1MIML 1X4YA 3L3JB 3MNMA 3R18A 4G9FE 4KKCC 1CL7I 5J8OA 1MHCA 2VR6A 1CGUA 2DWYA 1INEH 5L8PE 2J73A 4K94H 4Z3IA 1T04A 4JCLA 4JGNA 1HHKA 4ODXA 1ZPLA 2Q0ZX 4WI0A 3RUGA 3T2JE 3TWCH 2WMPB 1WPCA 3DYPA 4H0GA 4K3DH 1CURA 3HAEG 3LYRA 1MRCH 2MIZA 1MWAH 1OB1A 1UJ3C 1USZA 4IGBD 4ZUTA 4ZS7L 3CG8A 4XP1L 5GSVB 2FRGP 4TOYL 1ZY9A 5IKCA 4DQOL 5DD3L 4BQCA 4A7QA 1XZ0B 4KKLC 2PPCA 5IHLB 5CZVH 1HN1A 5DVPA 2CE6A 1WS8A 4PVNA 3SPIA 1ZK5A 3GS4A 1ADQH 1RVFH 2WLIB 4ZS6C 1FVDB 5J89A 2YQ2A 4XP9H 2CRMA 3VQLA 5BV7L 3D2UB 2EC9T 2TMNE 2XQ0A 3FRPG 4W9GC 3AY4C 1HZHL 3FUJA 4W9LC 2FHCA 4MDIA 3ZDYB 5HYIA 5KSBA 4LLUB 1QSFA 2XWRA 2CUAA 4Q9BA 3QXWA 1ODAA 5DPEE 4IHOA 4K7PX 1VB9A 1T21B 2NY1C 3WO3B 2X42A 2KYIA 3IDUA 3QIWD 4WSGA 2HVJB 3DIFB 4R96B 3V8CA 3BQUC 3B3IB 3GXMA 1Q0XH 2QPDB 4P06A 3HC2A 3NSCA 1DLFH 1NCDH 4HJ0D 3L3OB 2EDFA 3FW6A 5CP7B 5CEYA 1BF8A 1BYOA 4Z5RA 1N3NA 3BWUF 2ROYA 4M02A 1LWRA 1U8JB 3QO0A 4AWJC 4ANXA 2HTLC 4GRLD 3KWXA 1HWWA 2R27A 1Z3GH 2HFTA 1A7RL 4JG5A 4P3CL 1NDGA 3L95A 4TQ8A 2HT2D 3V9FA 4S1SL 3SDAC 1G0YR 5I73C 2VYRE 4DVBA 1OTSC 5DRZA 2NY7H 4PYHA 2HZHA 3PGFL 1KTLA 1GAFH 3DV6A 3NRPA 5E5LA 1PLGH 3R8BB 3GMQB 3IT8D 4D8PB 4HJSA 3HBGA 3C8KB 2CCVA 2B59A 4X6CF 3S5LG 3CBRA 3QIBC 2OSXA 1YYLL 3T2LA 4EBQL 4TULH 1KB5B 3RUGE 4BSWA 4N8CL 2O5ZL 1H3PH 1YEFL 3TIEB 3SKJL 4QHNA 3HN5A 3KYKL 4Y2OA 1G9MH 1YEJL 4LHUG 4CSSA 3MJWA 1K3IA 5DGRA 4Z7QF 4CRPA 2IFFL 1OAQL 2Y06L 3ZE1E 1IGJB 2OMVA 1MJUH 1S7VB 4EN2A 2RACA 3FUEA 5MERA 1QKZH 4ZAKC 1NGZB 3US0A 4P46A 4ZFOB 3OM3B 4TUUA 5DJXB 3TASA 6FABH 4OBRA 2IBGA 1Q0EA 3OLDA 3VFVB 2HJKA 4DK3A 1CXLA 1TVBA 5KSBE 3ALPA 1AGDA 1KNOB 3PWPD 4X98B 1HINL 4G5ZL 1LK2B 1QSFE 2NYKA 5FYLH 4Z76B 5I76B 2P7TA 1GL4B 4FNUA 3RZCD 5FAAA 3QWRD 2J88L 2EDMA 1P4LB 4H57A 2NOYA 4OLXL 2R4SL 1A4BA 1NLDH 4U7KA 1XHHA 4H8WL 3MGOA 2J12B 4MWFB 1ZWIA 2X4NB 4JFDA 1SY6H 1P1ZB 2PETA 5F1NA 3S35H 1S8DA 5I17B 2GIYA 1CF1A 2YKLH 4F7PB 2Q2EB 9PCYA 4H88L 4DCQA 4OM0H 3LQAC 4LVNB 1LE9A 2DMKA 2O4EA 4ZT1A 2YOAA 4HJJL 4PWFA 3HZVB 4NPYA 4EAEA 5C08B 4NN7B 3VWJA 4DH2A 4NIYE 4U6XB 3FCTA 3FQRB 1KIUA 1U2YA 4G8GD 2EXSA 3BWZA 3P30H 5IB3B 2UX7A 4X8XA 4NYLA 3U1SL 1FNSH 5DK2A 3QAZC 4OZFG 5HHXL 1EX0A 3HS0C 4WUKH 3DO4A 5CSGA 4BZ2A 4JM2B 1P7KA 2CSPA 3CZEA 4JM4H 4QRPA 4F37F 5AKSA 5IROD 2ADFH 3LN4B 4JGJA 3WTYA 4QHLA 4ZUSB 1F02I 2JH2A 5ICZA 1QATA 1OGAB 4AEIL 1Q94B 4ZO9A 1T5WA 3O9WD 5CFAA 3K8KA 3MSPA 4UQIM 1J8HB 3MLRL 2KS0A 1KJVB 2HUHA 3RI5K 3HKZA 5D7SL 5AKRA 4HSQA 5EUOF 5IQ7L 3S88L 1U42A 4YHLL 1JMZA 2XWBA 3KWVA 2K6ZA 1DN2A 4FFZL 2MHAB 4HALA 3HLAB 5EIIB 1CFBA 2PXYA 3CK0H 4HK3N 4F7EA 4YBQC 1FNFA 1QWUA 1JWSA 5EOTB 5D2NC 1BM3H 3WTTA 3MX0B 2I25N 1GZHC 4AQ1C 5EUKB 3ZL4H 4PJ9C 1DCEA 2MJWA 4XHJD 2E7CA 1UCTA 1QUPA 4NO2A 4G3YH 5CEZE 5J06A 5EORH 4FXKC 5FO9A 4CKQA 5IV2A 3MRMA 3QRGH 1BJ8A 4DEPC 4PRHA 2WD0A 4FEMA 5BVPL 3Q06A 1YEKH 3OZ9L 4LEEA 4P07A 2C4FU 4E41D 1UQSA 3AQYA 5BZDA 2YUWA 3RL1B 1KSRA 2MNJB 1XIWB 4GQ9H 4FEIA 4QO1B 3JV4B 3MXVH 2GTZA 1X5XA 5HJ3A 1SDAB 2QVFB 2VC2H 1LEKB 4JZNA 5DK0A 3O8XC 5HHVL 4E9YA 1G7PB 5DLLA 5AW5B 2V37A 1MCSA 2D3LA 3NCFB 4UMGA 4FQLH 1JPEA 1SN2A 1GW0A 1W0WA 5FHBL 1QNIA 4HAFA 3POHA 3WELA 3VH8B 3JWNE 1C5CL 1KYOK 2B2XL 2CGYA 4OW3A 5HXMA 5M94B 3DJTA 1ZANL 4R5TA 2X53A 4FQHA 3R0NA 4XPAH 1AS6A 3ZKXB 4RIRB 3V7AE 2YD0A 2C1OB 2DYPD 4QRPE 4U1GB 4I5BB 1KYDA 3DV4A 3WY2A 4OD2B 3IDJB 2BNQA 4RAUB 3QCVL 2FJGA 3MLVH 4ZFGL 1A25A 1RZKC 2ZZUT 1CL7L 1QX1A 2YRBA 5CGTA 2WYZA 5IM7B 1E4JA 4O2CA 3MJ8B 5F9OL 4DZBA 5JQ6L 3M1BA 3UL4A 5JYLA 3MOAL 3WXWL 5DHYA 1WFJA 3QZNA 5EEVA 1C5BH 4LCUA 3DTUB 4XBGA 2FECL 2W80C 2XN9A 1A9VA 1WDAA 5DD0L 1NUGA 3ZBMA 2DJUA 3BH8B 3T3MF 3GI9H 4OT1L 4KPHH 4PJ7B 3DNKA 32C2B 1HYSC 2Q7AA 1CFMA 2OMYB 2FGWH 4OQTH 3FTZA 2A74C 4JFHD 2JI3A 1FGVH 3FFCD 4HT1L 2BSRB 1JJUA 4FQXA 4DKFH 5HGGS 4F9LA 4QRAA 3MJ9L 4OQ1A 4KO5A 1E2VA 1U93A 3CGTA 4IK6A 4RAVB 1FNAA 1D9KA 4KK6C 3AC0A 2WXJA 5DUPH 2J8UB 3FB0A 1MXDA 5D7HA 3NH7H 5DQ9B 5EU4B 3NGBB 1FV1B 3F84A 5LWDE 4PRHE 3CFUA 1E4KC 1T0PB 5FM5O 3UBFA 1ESPA 3OSVA 3UG3A 3UTSD 3GLEA 3GSNH 4LLWB 1MSPA 4F7MB 1OAJA 4R90H 4W81A 1VERA 5D96C 1I31A 4HHAA 4YIQB 2FH8A 4IRSD 1JDCA 3D48R 1IEAA 3N06B 2JLPA 3Q9PA 2GITA 2O5NA 1EDQA 3C5SB 2VM9A 3G5ZA 5FA3A 5DJYB 3BW9B 4OH2A 4J6RL 3TIDA 3ZYIA 3MRKB 3VRLE 1HCYA 2W9EH 5LAXA 1A6VL 3FQWB 4O9HH 3ZZSA 1WQVT 3CZLA 5E51A 3L2MA 1KBGL 1FLRL 1N2RA 3GSUB 5KS9F 2YBRB 4FA6A 1RMFH 4AIZA 4XP5H 4CU6A 3ZRFC 4TVPD 4PGCA 3NFSH 1JP5A 3ARFB 4WEMB 4YBHA 5ID0B 3S36X 3A6CL 4BFEA 4ODTL 1GOFA 1UADC 1RY7B 1UD4A 1UH2A 3NACL 1FG2A 3GS0A 3SHSA 3FSVA 5C0AB 3UMNA 5HVHB 4N1EA 4PJGA 3EYQC 4DGIH 4QDGA 3F83A 4X4ZA 3K71B 1M7IB 3TJPA 4UNTA 4F9PC 3GJFA 4KTGA 4FLOA 1J05B 4O02H 1BQKA 1NWOA 3KJ4B 1AJ7L 1BZOA 4U6TA 5F7YC 2BJMH 5C1MB 2W92A 3NIDF 1KLUB 5TJWK 3V4VB 1XTMA 4BQ8A 1MI5B 2UWEF 5IJKC 2X4TB 3HRZB 4UQDA 3LQAL 1SYSB 4B9JA 4HUNB 2LFEA 1DBMH 3CFMA 4ADGA 4RRPM 4WCYL 2OMZB 1H6UA 3SDDD 2W5PA 3GLDA 3VXOB 5IESL 4YBLB 3W37A 3QJXA 3KYAA 4NN6C 4XR8C 3S7GA 4N6RB 3S9DB 2OMWA 1ZS2A 3D2UD 2LFGA 3OKDA 5DVMA 1JWMA 3CPUA 3MNWA 4XNMA 1TLPE 1MNUL 4JREB 1BQBA 3O6FB 1EUTA 4PREB 1WZKA 2WYTA 2DM3A 4JJHA 5IQ9A 4FI7A 4QYOA 3CLWA 3T0AA 3L9RB 1OD9A 3LRKA 2WJ5A 1E0OB 3KDPB 4KV5F 3UBXI 3BVWA 2H3NB 3QARA 4OI9A 3MXWL 4LAJH 3QWQB 5I82A 1ZDSA 1RERA 4PFEA 1ZHKA 3WEMA 2FO4B 4H20H 2BVOB 1YC8A 5KSVA 4KRNA 4G70B 3L3HA 4QLWA 3I3DA 1NOLA 4RQQB 1UM6L 3M7FB 2WWKT 3P7SE 1MF2L 4I88A 4LGSB 4QXTB 5DRNA 4BSVB 2Q1EA 3LN5B 1U3ZA 4NHUB 3PREA 1SXNA 1EJ8A 1U8QB 1BECA 3MRPA 3J8F7 1U6AH 4KFZC 3GGWA 3ESMA 1R24A 1TETH 1KBKA 3DXAB 1A65A 4HXAL 4D0BB 1NAMB 1PL3A 2BOBB 1T0MB 2AXGB 2IC2A 4PJGE 4XXCA 1KF9B 1JBJA 5C0GB 5CLYA 1QLFA 4RFNC 4WO4C 3N43F 5CCKL 3GSOB 2C9RA 3LRHA 2FYVA 4M62L 3S35X 4XNXL 1KELL 2CPCA 1FDLH 3TVMB 1P1VA 2ZTBA 3K80A 4MAUL 3CSPA 1IBGL 3S5YA 3DJRA 5HDWA 5FDYA 4LAQH 3F7RA 4X6CB 4XB3A 3WXVL 5EFIA 3KS0H 5B38G 2GCYB 4HV8B 2YRLA 5AWNL 3GXDA 1OSZA 1N0XH 3MA7A 2DQEL 2G3XA 5E1HB 1HXYB 3G04A 5SV3A 4H8VA 4Z0XB 2X6BA 2VAJA 5DZ9A 1UWGH 5E8NB 4MXWH 1ZKAA 1F1GA 1WD9A 3FF8A 1ZAGA 5DD1H 1RUQH 5JORA 4ONHA 3HPJA 4HIEA 4CBPA 1YECH 4Z7QB 2OZ4L 2A4ZA 4JEGB 2PN5A 4TNVF 4WW1A 3IJHA 4PJXA 3U9UA 5GISL 5GGRY 4YX2L 5C6TH 4IJ3C 1MCWW 3HE6A 4JZOB 4QAWA 1MFAL 2F15A 4AT6B 5IP4A 4G80A 1SXBA 1FRGL 1J5CA 2IPUG 1OTTD 3I6GB 4PB0H 1LTXA 1ECYA 1RZKL 2QVTA 4PRAB 1JXJA 4OGXL 5ELIA 3K4AA 3VD3A 4Q9RL 3KWUA 1JE6A 5DJ6A 3QXDA 4ISVA 4FNTA 3C6EA 1KGCD 3EOBA 1EEYB 4WFFD 1WICA 4WQOA 3OAUL 3MS3A 1ASOA 4JFEB 3HNSL 1VFBA 2PR4H 4Y2DA 4PR5B 3QCUL 4C83A 5D1XD 1S5IH 1IX2A 1T1XA 3OMIB 5D7KE 1FZJA 5C08D 2BSEA 3I3EA 4GKSB 4WU7A 4D3CL 4MNHB 1AQDB 4NM4H 2WINA 2QQKL 3TA3B 4I9XA 2DQUH 4H0HB 3H4HA 4PV8A 2ICEB 4XP4L 3WFEH 3ISRA 2YD9A 3BDXA