5C97A

Insulin regulated aminopeptidase
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
866
structure length
860
Chain Sequence
b'LFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-cystinyl aminopeptidase
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal Structure of Insulin-Regulated Aminopeptidase with Bound Substrate Analogue Provides Insight on Antigenic Epitope Precursor Recognition and Processing.
pubmed doi rcsb
total genus 263
structure length 860
sequence length 866
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 5c97A02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 5c97A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 5c97A01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5c97A03
5K1VA 2XPYA 4XN2A 3FU6A 4K5NA 4XMTA 4R7LA 3FUFA 3FHEA 3FTUA 3FTVA 1Z5HA 4XMUA 4FKEA 3CHSA 3PUUA 4ZX5A 4NAQA 3EBHA 4XNBA 4PW4A 4XN8A 3CHPA 4OU3A 4K5LA 4NZ8A 3B37A 3FUJA 4XO3A 1HS6A 4KXDA 3FUHA 4R5XA 4XMZA 4Z7IA 3CHRA 2HPTA 4RVBA 3FU5A 4J3BA 4ZW6A 4K5PA 4XNAA 3Q7JA 3B2PA 4XMWA 4JBSA 4ZX6A 5CU5A 4QUOA 3B7TA 3FUKA 4RSYA 3FUEA 2YD0A 3FU0A 3FTSA 3QJXA 1SQMA 4XN1A 4XN4A 4XN7A 3B7SA 1Z1WA 3FTWA 5DYFA 5C97A 4QPEA 4PVBA 3FULA 4MS6A 3FTYA 4K5MA 4FGMA 4ZW7A 3KEDA 3B7RL 5LG6A 3Q43A 3FU3A 4ZW8A 5BPPA 3FTZA 4DPRA 4FKKA 4HOMA 3FUIA 4WZ9A 3CIAA 3FUMA 5AENA 4KX8A 4KXBA 4X2UA 4P8QA 5LDSA 2XQ0A 4XN5A 5AB2A 2R59A 3SE6A 4XMVA 3FUNA 3B3BA 5DLLA 2VJ8A 5J5EA 3CHQA 5LHDA 4PJ6A 2ZXGA 2DQ6A 4KXCA 2HPOA 4K5OA 4XMXA 4XNDA 2GTQA 2DQMA 4E36A 4PU2A 4ZW5A 4F5CA 3FTXA 4FKHA 4ZX3A 4XN9A 3T8VA 3FH5A 4XO4A 4KX7A 3RJOA 4QHPA 3Q44A 3EBGA 3QNFA 4FYRA 4Q4IA 3FUDA 3CHOA 4L2LA 4R5VA 4XO5A 3B7UX 4R5TA 5AB0A 5FWQA 4KX9A 4FYQA 5J6SA 3FH7A 4QMEA 1GW6A 1H19A 4FYSA 4ZX4A 4KXAA 3MDJA 4ZQTA 3FH8A 3B34A 3U9WA 4MKTA 4ZW3A 3B2XA 4Q4EA 3EBIA 4GAAA 2XPZA 4FYTA 4QIRA
chains in the Genus database with same CATH superfamily
1DANT 1JRHL 5A6IA 4FQHB 5IW6A 3HAEG 2VXQA 3QWOA 3T6QC 2MNJB 2K70A 5HDWA 4NKQB 4G9FE 1PY4A 3ECBB 3F7RA 1WE5A 3KXFD 3MBED 3QAZB 4IBZA 3KYNA 1ORQA 1H6FA 1TQCC 1E30A 2F53B 2PCXA 3DIFA 1HXMA 3RVTC 1GA2A 5MEQB 5F3FA 1R75A 1YEIL 3IDXH 3L9BA 2L8AA 3ISYA 4JFVA 4IS6B 3E1F1 2VLRA 4YLCA 4CJ1A 5IW3A 3NCBB 3HCVB 3QUYB 3CC1A 3LEVH 4JGMA 4XBEL 3M6DA 2FX9H 4UT9H 4LSDA 1A7QL 1BQLH 4APXA 3V0JA 2WWMD 2H2PD 4JQXA 1LO4L 3PG2A 1FLRH 1YEFL 2DOCA 4E42A 4P2RE 1X5HA 3FQ2A 4IGBB 4MTWE 4M6MH 5EIIB 3P4NA 4L3EE 4CJ0A 1YEHL 2C9XA 1QR1A 1MKFA 4JPIA 1UFGA 4OR1A 5KJRH 2FHBA 1MG2C 3D4CA 2V9UA 4FQCL 2A6JB 3LZNA 4TL4A 4Y2NA 3O6LL 4M5ZH 4ZOEA 3CSYB 3PHOA 5T8IA 1S9XB 2RACA 4I3RL 4K3GA 4Y9GA 5K1JA 1FL5B 3V4VL 4TXVB 4GUPB 3VXMB 3RIAF 1FI8C 3KPNB 3GIZL 5JNYA 3FQRB 2NY3C 1YZZA 5E6ZA 1SN5A 2X05A 4LKXA 4ODWB 4G1MA 2MQGA 2VO8A 1QR4A 2IGFH 4PV1C 4LMQE 3MV8A 3V6BR 2XIDA 2VXVH 4E36A 4L4VB 2X38A 3T8GA 4P46D 1QSFD 1ZIAA 1MCCA 3LH8A 2BWIA 3ATAA 4JFOA 3MBXH 4EN3D 4FI6A 1G6RL 1J18A 2VDRH 5EO9B 5JHBA 3C5SA 4W68A 1FSKC 3G9AB 3KLAB 4AYMC 1EA9C 5DC4B 1KULA 2NRDA 1WFMA 1I9EA 3LHPH 4ABVA 3FONA 5C2UB 2Z7WA 5KW9L 5EF1A 5DMKB 3ESVF 4WI2A 5FW8A 4LAQL 2XN9A 2UXFA 4KK5D 4L8SA 4A67A 4BSJA 5T3ZD 2CO7B 5J6GA 4OIAA 2OJ1A 5AW3B 3LKOB 4OCRL 2W9DL 4K3EL 5KJ4A 4AIZA 2NY6B 2QTVA 3RFRA 3CN4A 3T2LA 1MRCH 4M5YL 4LLUB 1DZBA 3RVXC 3S36X 4Y2DA 5KUKA 4Q2ZA 3V4PL 4KQ4H 4A7UA 5L2JA 4PS3A 5KYWA 4HUVA 1Q9WA 1GGBL 1AR2A 1PG7L 2VXSH 3OV6A 1BAWA 2R29H 2AQPA 2OZ4L 4WUUD 2AXGB 1ZJAA 1YAIA 1TEFA 4YO0B 4B52A 1S7RB 2QVFB 4KVPA 2FE0A 5FYLE 1LNAE 4WWOA 1FFNA 3WI9A 3SKNB 2QKIA 3U0TA 3AMKA 4NZJA 4AYFA 1CICC 4HEME 1QFUH 2UWEA 4FZ8H 5TH2B 4QKTA 3IGFA 2W95A 2XWDA 3OHMB 1KL6A 1IIIA 3IVKB 4NRZB 4ZZKA 1R9FA 1UXWB 3RTQD 4M65A 5H94B 1NAMH 5GS0D 2ROYA 3T8DA 1HFUA 5T5NG 3VU2A 1PQZB 3T6ZA 4JK0D 2YQBA 3VTTA 1J7VR 2ITDB 1T7ZA 5D7KE 5A2FA 4YHOL 2DI9A 2FK9A 3FOLA 3D0LB 5EA0L 3NACH 4FXLA 4PR5B 5T1JA 3NP3A 2X2YA 3I6SA 5E8PA 1IM9A 4LCIL 1NEZG 2J4WL 5CN1A 5I6KA 2RFXB 3QI9C 2IOOA 1ZE3H 1SHXA 1L5GA 3QJRB 2VDOL 4GEIA 1QFUL 3BH8B 1MY7A 4OCXL 3VD1A 1LNUA 2QQKL 1IBGL 5I8CB 1CIDA 1IC4L 3MFFA 3CUPB 4XCCH 2KI6A 1H0DB 2VMEA 2WN2A 4NQDB 3MCLH 5DMKA 4NS0A 5FYLD 4DZBA 3CBJB 4EDWL 1DQKA 3UBHA 1K85A 4BFIA 3QPQD 4BZ2H 2YBRA 2DKSA 3DHJA 3G04A 5TF1H 2BNQE 3ARQA 3QWOB 4TYUA 1TKWB 5GGVH 5ITBL 4ORGA 5F21B 4JJ5A 1P4IH 2CGZA 4RMVA 3GXTA 5BZDA 4GINA 1T66C 2ED6A 4KROC 1OARL 4GP4B 4K89A 2HT3C 5CLYA 4M7JH 3KH3A 3B7UX 2LFEA 2QMKA 2Y5EA 1AXIB 3ARGC 3ES6B 4TVPD 2DWYA 2QVKA 4HLEA 2R29A 4TV3A 5H37G 2Q10A 4LCYA 1OSEA 2E7LC 3WXWL 1O9WA 2XQYG 3AU1A 4K7FB 2E4FA 2VLLA 5AOMA 3ZDZF 1IGJB 3FH8A 3F58H 4K8RH 5CSZA 4YHYB 1EJOH 1UJ3A 3U9WA 1URLA 2KBGA 4I0PA 5T5FH 3ZKNC 1DLFL 3SDCA 3DUUB 1WSST 3PYCA 4GW4B 3U0WL 3BLPX 4JKNA 1ZT7B 3E80A 4YPGB 4Q52A 4ACPA 5L2KE 1CPUA 2BP5M 4L9LC 4WTQA 1AGEB 5J6HA 4QYOA 1NCCH 1DUZB 3OQ3B 3HFMH 2J25A 2HWZL 4GEJA 4XNMA 1I1YA 5IGXL 1U3YA 2VUOA 3EYVB 2IGFL 1EBAA 3WGVB 1TCRB 4YLBA 5DZLA 2AJYH 4U3SB 1DVFD 5TDNA 1I53A 3T74A 5EEXA 3FUHA 4U6XA 5HI3D 1GC1L 4LPXA 3KPQB 4OUUA 1B9ZA 4RMQA 4HIHB 2EC9T 1QATA 3HC4H 3K4DA 1P4UA 2DQTL 3PP3H 2YGPA 4N20A 1NIDA 1B0IA 1HK6A 2A73B 1B0RA 3I6KA 2C3VA 4OF5A 2GTZA 2YZ8A 5C1MB 4FC3E 1BF8A 1IKNA 1IBYA 3G7TA 5K39A 3RNKB 2G30A 3PWNA 4H88H 1C5BH 2DQGL 2QPDB 5L0QC 5C2BH 4DKEL 3LZRA 2H1PH 3M45A 4FMVA 4Y16A 3FSOA 4L8SC 4GXVL 2XTLA 3VFTA 1FL3B 3FB8B 2E75C 4GO8A 3MO1B 2F5AL 4WW2C 1A7QH 1BQLL 4J28A 7PCYA 5JHDD 3MRRA 5IROC 4O2EA 2N7SA 1JGEA 4HX1B 2ZCLL 2K3HA 4YK4B 2EDOA 1JYNA 1BZOA 1HX0A 1F90L 1BAFH 3MJ9H 5KSBB 5MEPA 5TPWL 3MSAA 3FQ1A 3EYSH 5IEKA 3VD0A 5IVXE 2X6UA 4ODXA 5AB2A 2EYSA 1ZLWK 2EDYA 2EDTA 1UM6H 4RA3A 1A6VL 1FC1A 1T0OA 2ADIA 2R15A 3B9DA 3GZPA 3EJYC 3P3UA 5I26A 1YNKL 5BV7H 4KK8C 4M9PA 2HLAB 5ANMB 5HHMB 1RZQA 3QCUL 2IOIA 2BMKA 4PJ8A 4PJAA 4PRPE 4M8RA 1W72A 3ME0A 2WB1A 3P7QE 1DCEA 3NCMA 1MPAH 1UKTA 1ZV5A 5ENWA 1KPVA 2DWEA 2F8IA 2DB8A 2JXMB 4AYGA 4ADGA 4XTRC 1S7WB 1S7TA 3DRTA 4PJEA 5DJ8B 1UD6A 2DMKA 4PBVC 2F1AA 3RA7L 5ID1B 1SVZA 1OF2B 4HBCH 4GERA 4GI9A 4YE0A 3BSHA 5BMFH 3C87A 2QV4A 1R6VA 4PJCF 1ZT4A 2CXKA 4LSSL 4PJDB 1G4RA 3SO3C 1Q1JH 4ZJ9A 3TJPA 5HJ3B 2Q86A 2X1WL 1L4IA 1ZEAL 3PPSA 3ARGD 4ZPTB 3RIFK 4QRPD 3LKRB 4U6XB 4OKDA 3O3EB 1NMCC 2B14A 3VSUA 1K4CB 3G6JF 4DKTA 1NGQH 2NY1D 4ISVB 4TL5A 3QIWA 1T4KA 2P5EE 4BH7B 2BSBA 1BZ7A 3Q0HA 2IH3B 3O6ML 4U1HB 2IALB 3Q1EA 2BZDA 4JAMA 1L9OA 3EG9B 2G3MA 1G9NH 5J4MA 5E1AB 2OX5B 1KOAA 2XACC 1TVHB 5DJXB 4IRZL 3EBAA 3MV8D 5IOPA 4ONOA 2DQDH 4P23A 4TUJA 4DVBB 2QQNH 4XPFH 5DD3L 3QUMH 4OGAD 4FNTA 4HIXL 4Z23A 2BSTB 3O3DB 1U8NA 4UDTB 3VXTB 4OBSA 3EG9A 4M6AA 4MA3B 3T0WA 4F80A 2VN7A 2MJWA 4Z95L 2MTAA 3B9EA 4AC2A 5T3XH 5JW4Q 4IBSA 4DGUA 1ICTA 1DVFC 4RMWA 2CALA 4ORGB 1Q0EA 2Q2EB 1ZHNA 3VNZA 5CN2A 4LRIA 1JI1A 3DPBB 3GMLA 5A2CA 3ULUC 1HVXA 2EE6A 5BW7C 4NFBA 2ADJA 4W81A 4ODVH 5I8OH 1G0DA 5IB2B 2JB6A 4AITA 5ALCH 5H4YA 5TDPA 4TVSa 2EVGA 4Z7VF 3ISRA 5HDRA 1GY2A 2C4FT 4HVBA 2BIQA 4JFFE 1K8IB 4KK9C 4R4FH 3S36H 3T1FA 2WZAA 2CIIA 1U8LB 1JE6A 5D4IA 5KANG 1RERA 2EEAA 2WVTA 3UH8A 3W39A 3CMGA 5C92A 2EKJA 1K8DB 1EVTC 3O2WL 2GAZA 3N04A 1R5IB 3U6RA 1WAAF 2YPLB 1E5BA 1EZVY 4Y4FD 2IEPA 4HT1L 4OGYL 4I9WD 4JN1H 4Y5VC 2D7QA 5KS9B 3V4PB 2NZ1A 4L4TB 3LIZA 3CHOA 2WQXA 5DVMA 2HTLD 3S34H 2PMZA 3OB8A 5H94A 5TE4L 3E8UL 2DYSB 5ALCL 1I7TA 3V55A 4O5LL 4JFUA 3PAYA 4Y5VA 4LEOA 2V7NA 1V7NL 3WJMB 3UTOA 3G3LA 4R84A 4QMEA 1INDH 4NNYA 3U6RB 1YN7A 3CFMA 1D5IH 3NA4A 1NLDH 2GJZB 4WW1A 1EXHA 3SGEI 3WJLC 1LO2H 4D9QE 4ZMPA 5I1IH 4NZTH 5DVOA 3T0VA 3GBDA 5T1MA 3KXFA 3MBEA 3ZLQC 4UZGA 5F1NA 1YY9D 2VR7A 3Q8FA 3BAEH 3QDJE 2AQRA 3VXRE 2RFXA 2WZPA 1A7OH 1OV8A 3HE7B 4CNIA 3MA7B 1JV2A 5DD6A 2CA3A 4GKZB 1R4XA 5I76B 1DBJH 4ZFFB 1U8MB 3MV7B 5JQ6H 4P9HL 5T1LA 3ZZ1A 4ZMLA 3UJIH 3FZUC 5DUBB 2ADGB 2ROXA 4KKAC 1KCVH 1HTYA 1ZV9A 2ED8A 2WXRA 3OR6A 2E4TA 2JH2A 4Y4KB 3WFBH 4G9DA 3QFGA 2DPKA 3WHE0 3AWEA 1JHTB 4YHML 1NUDA 1QASA 4P3DB 5BS0D 1PZDA 3K8LA 1MRFL 1XCQB 3HZMA 4PTTB 1IBDA 2K0RA 2RTTA 2ODHA 2VE6A 3O6MH 2MCPL 5B3JF 5BNXD 2OK0H 3UC0H 4NQVA 1T21B 3FPXA 3R19A 2X6VA 2O6CA 4PTUA 3DTXA 3G6DL 3JWOH 4ZAKA 2WKOA 4KJWD 4R7NA 3QWQB 3Q1SH 3U2JA 1OTSC 2MKWA 3VE0A 3TNMA 5AD0A 5KVGE 4U4BA 3REVB 4K7FA 1BSIA 1OSZA 2A3TA 4HKXB 2CBTA 3D9AH 4JZJC 5K33A 1E4JA 5BMFL 4PRID 1YCSA 4AW7A 2K9UA 5FGCB 3IMSA 3U4EB 4YVNA 5D7SL 4MZNE 3SE6A 2P4AB 1MLBA 2NTSP 2Y07L 3BAYA 4JFFA 5EBGA 2OCJA 4HHAA 4OLYH 3A3YB 4FQQA 3NSCA 8CGTA 2BSED 2NOYA 1FIEA 4IDJL 5KJ7E 3KCPB 3UACA 2AK4B 2IJ0C 3WFEH 4AT6B 5ESQB 4D8PA 4M3JA 4N8CL 4QY8B 5HD8C 3VD2A 3HHRB 4J39A 2XZQL 2VC2H 3EO0B 3T3ME 1A6VH 1T4WA 5JXED 1AP2B 3O4OB 3CDGA 3QIUD 2AV7B 3CFIC 3WS6C 2GAZB 5INDA 4WI0B 3ABLB 2GJRA 3C09B 3VFVA 3BEWA 3Q5YA 3E9UA 5F3HB 1A6AA 5EO0A 5GS1C 4PJ9A 2Z7ZA 1P7QA 3MJ6A 4L4VA 1I85C 2ARJA 3D18B 4QTHA 4GG6E 4E9RA 1U42A 1KCLA 1P7KB 4IJ3B 2G2RB 4E41A 5ERWA 3WIIL 3WY2A 2RGSA 4B9FA 2WXQA 1RD6A 2GEEA 5MERB 4JHUA 1NCTA 3W2DH 3JXAA 3PWVB 4F7MA 4FTVB 1TJIL 3BC9A 2WBWB 3KW8A 1E6JH 1CXHA 2BINA 1PIGA 2Z0UA 3BO8A 4ZO6A 5I0DA 2BXYA 2VN5A 4PJFA 2XZAL 2OS7A 4K2UH 4NZ8A 1YECL 5BV7B 4MSWA 3IFLH 2P7TA 4X98A 2CWRA 3P4NB 3ECVA 2ZYIA 1P1VA 8TLNE 5HYQB 4C4KT 4YPJA 3MLXH 4XGZA 4MXQC 3TM6A 5CD5D 5BUAA 5GSRB 3S5LB 4LHUB 1OS0A 1EO7A 4F8OA 2V3EA 2QMJA 2IH1B 3I9GL 3VFTB 3CCHA 1VGKA 2G3ZA 4I3SH 4NJ9H 1N6QL 4PS4L 5B1JC 2XOTA 2ZSWA 3QG6A 3FRUB 1I9RL 4RMSA 4WF7A 2XA8H 5I71B 1W16A 2ZKXA 2ZX9A 3SPVA 3FTWA 1MFCH 3OSVA 3PL6D 5HDBE 2ICEB 4K3DH 3U0WH 4PP1C 5ITFB 1KC5L 5CEXA 3QYMA 1CGSL 4HUUA 3HAEH 3F58L 4K8RL 1ORSB 3IJYA 3CSGA 2J71A 4G8GB 3H9SD 2XWJB 4QAWA 2F18A 1DN0B 1T22B 4FFYH 3WMQA 1QLFA 2PYEE 3CLWA 3WS3A 4B5ZA 4HH9A 3N6YA 3TURA 5C9JB 2ORBL 3ZR5A 3E6FB 3H9ZA 4HDIB 3T4AB 5C6WH 1WITA 5JSSE 4QRSA 1DP0A 2ZAIA 5GS0L 1FH2A 3MUUA 1D6EB 3HMXH 4LF3A 4XHJC 3L4XA 2QDWA 3BPOC 1KWKA 3AC0A 2OAAA 4ATWA 4LLYB 4QHUA 2Y7NA 3HVNA 4FQIH 4Z0XA 1RPQA 4MBOA 2WWKT 4ELMB 3I75B 2NZIA 4GQ9H 5SWZA 3DO4A 4MXVF 2VCOA 4Z7OE 5I1JL 3MR9B 5D2NA 1CE6B 4LCWB 4K07A 2XTJD 1R5WA 3FQUB 3EDEA 2V3DA 2VC2B 1MIEH 1EXUA 1W0VB 1PLAA 3AU1B 3IU4L 1HXMB 2X4SA 4N8UA 2AEIT 1JGUL 4NT6A 4LSRL 4P99A 3NCXA 4XMPH 3VSQA 1YYLH 5DURD 3SO3B 4TUOB 3FQWB 4PYHA 4XMKL 5I1LB 3QVAA 1F4XL 1J1OH 4FTVD 4B9GA 3I85A 4IYKA 1Z0NA 1SMDA 3FH7A 5KSAB 1KN4L 1G1OA 4CMHB 4LSVL 3ZT6A 1TJGL 4EN3B 1UB6B 2IALA 2VDPH 3QQ4A 1BVNP 1JPTL 4UOQA 1OHZA 2VLKD 4GAAA 2ZKWA 4H5SA 1WCBB 1W8OA 2N01B 2CBMA 3V95A 3N85H 3BPLB 3VMOA 1CYXA 4A2HA 3L9RB 4NXSA 3IM1A 4AX3A 3UZVA 1H0DA 4OJDH 1ZVSB 3B5HA 4FOMA 1IRAY 2AEWA 4CGTA 4LEXH 3F12B 2FIKB 1U92A 4Q14A 4U33A 1BV8A 3M1OA 3UYOD 3AQDA 2I32A 4MB1A 2ICEA 1LMKA 1J9CT 3BDXA 2V5YA 2R4RH 4LNVA 3VWKB 3VSVA 4D7PA 1J8RA 4OM0L 4G59C 4DP7X 1G7QB 3NH7L 4G8IB 1K6QL 1P84K 3MJ7A 3MJGX 4RISH 4WUUB 3ME0B 3ZE0B 1MQ8A 2BNRD 3W0WE 4PVLA 1PLCA 3RZWA 3I6GA 4EZLA 1D5ZB 3QJXA 1LEKB 5FO8B 3NCYS 1SRDA 4HAKA 2JQZA 3JWNC 1Z7JA 2ZOKB 3LD8C 3FF8A 2LHAA 1SXZA 3LHAA 3LS5L 4HS3B 5IHUH 3BH4A 4WNSA 4KJYA 1WHOA 2OMNA 3P0GB 4K3EH 2YA0A 4AEFA 5C0CA 3KS0J 1UB5B 2Z4TA 3G5ZA 2FTAA 1AGEA 5AAWA 4X80H 4BH8A 4MB5A 3FQ4A 3O6KH 3E8VA 4QRQA 4Y4FA 1CTOA 3FW6A 1Z3GH 4AV5A 2Q2LA 1J8HD 1REIA 3FT4A 3AITA 4ZMVA 3UG5A 2BOBB 1CR9L 1QSVA 1KGIA 1IM3A 3T5WA 1U3HB 3UZQA 1XGPA 3NTCH 4MQ7A 4BUHA 2EUZA 2R8SL 4BRJA 2IVFC 2ESVD 3RYMA 4LHJB 2OW7A 1M56B 1LK2A 4F5CA 2UYLB 3V0AC 3E0GA 5KVEL 1MJUL 1O7SA 3L3OC 3V52H 1E65A 3F62A 4P0DA 1T89C 5FFLA 5FLUA 2DYPB 1PKQE 2IIJA 4HQQH 5FHBH 1TLMA 3UTSD 1SQ2N 5E1HB 1U6AH 5IV2A 3MXVL 1LK3H 2K3TA 4RFNB 2Q86B 3UCQA 3WFCL 5M94B 4OGXH 3EJZC 4YQXH 1BWMA 3HZVA 2WBJB 2GI0A 1LWJA 1LO0L 1SYVA 3X3FL 1FUNA 3RUGE 2K4WA 5HHVL 2J2ZA 3PQYE 4R26L 2HX7A 5ISZA 2V2WB 2ZSVB 1MNNA 2XPZA 3HVDA 2GB2A 3O6FC 2QPFA 4JDEB 5I76A 5IKCA 2V2TB 2NT0A 3ZDXB 1MW2A 3KYOB 3FTUA 1U2YA 2WIIB 1W0WB 4P23D 1XMWA 4AWJC 1JGVL 4PN6A 3T0XA 4XVSH 2PWHA 5A2LH 3IDGB 3ABMB 5CF3A 1VKXA 4L9LA 2Z35B 4HUXA 3PWUB 3RWJB 3CSYA 3PHOB 3G5VB 2P8MB 5IFJB 4AEHL 1FFPB 2FX7H 3D6GA 5IHZA 4G7VH 3QR2A 5IF0B 3P0YH 1NGWB 5KEZA 5BO0D 1TEGA 2ZF9A 2IDTA 1NAMA 3D34A 4WV1A 4ZFGH 4KK9D 5L8PE 1C5CH 2WJ7A 3KPMA 1OAYH 4OIBA 2XETA 1DSFH 3IK2A 4HX1A 4L8CA 4TULH 1X5ZA 4JDTL 5EC1A 4NOBA 4NNXA 4PGJA 4O51A 2PABA 1U8QA 4YNYA 4KI5D 4GRMB 2Y06H 4BFIB 2YXMA 4NUMA 3WBDA 3IGLA 3V4PA 2IWEA 4M8QA 4BWUA 5HHXL 4Z3FA 2P47B 2VZOA 3DVGB 2WBKA 1ZLEA 1XTMA 5CN3A 2Y3AA 1MI5E 5CJ5A 2OMBA 3K6SA 2GBUA 1HL9A 3K4AA 5FV2A 1P7QB 2FYYB 1A6ZA 3D8MA 1QFPA 3FTZA 4X6CB 1F8TH 3V5DA 1I1FA 3C60D 2I9TA 4X5QA 2BVQA 4MJ5B 5BCAA 3IGAA 4ZMWA 4KK6C 1CZ8H 2C9PA 4LRNL 2APSA 5ANME 5HHME 5KANI 4XN5A 4GIOA 1T5XA 4IBQA 3EYUH 3M1BB 4UV4L 5EBLB 1E5YA 5IW6B 2BHUA 5JDJA 3EJQA 4I18B 4FQXB 1QO3B 4QTFA 2WOBA 2A2QT 1UXLA 3EYOA 3NOIA 4ZI8A 1GTFA 2B1AL 1SYSB 4UQDA 3IJEB 2XQBL 4GW5B 3VA2C 4PJIF 1N4XH 3VXNB 5DK0B 2DM3A 4CBPA 3OJ2C 3JV6A 4U1LB 1KPUB 4KWUA 1UWXK 4HJTA 4NFDA 2HRLA 3K72B 3MO1A 3DGDA 3FFCD 4LHQB 4L4TE 2D9CA 5EU6A 3HBPA 1IKFH 4O2EB 2WZ6A 2XN1A 4FYRA 3L2NA 4L8DA 1QF0A 2A7GE 2J3SA 1C5DB 5F7WC 1RPKA 2ZPKL 3ELQA 5AKVA 4F9LA 3L13A 5E08L 1OP3K 5E24E 3DX8B 1IE4A 1KTLA 3T0EB 1M71A 2ZF8A 3MV9A 3JVGA 3DC0A 2NW2A 4M43H 1B0RB 3I6KB 1TVHA 4YHKH 1MCWM 1OTUC 4GMTH 4KROD 3L3HA 1GZHC 4MMZB 3PGDB 4DQOL 3VGFA 3K6OA 3RFZA 4QIRA 4UB0L 2A6JA 4D2NA 1JZJA 4JN2A 4H40A 1OGAA 3BUQA 2YPKA 4PJAF 2WYZA 3BDBA 4LOFA 4HOXA 5DMYA 5BRZE 5EC1B 3UZEC 1SEBA 2GJPA 1U2HA 1KXTA 1ZHKB 1SN0A 4K5LA 2DLIA 4GMSH 4Z76A 5I1AA 4Y2OB 1XCXA 4Q58C 1NC4B 1WBZB 1A7NL 2VW6A 5K59E 1A5FH 1ZT4B 1U3HC 2AZAA 3SOBH 3VW3H 3N40P 2NW3A 1L9NA 4CVZB 1ETB1 3WNLA 3ARBD 1RCYA 2PO6C 5D1QD 4W6YB 5AOKA 1I1FB 1UVQB 2F15A 4MDRA 5ITFA 1EEYA 3UERA 4TLSA 1JNHA 2CKBL 4YHIA 1WEJH 4WSKA 5FYJU 3TEUA 1JPST 5TE6L 3L3IA 1XGRB 2MWCA 3N2JA 3MCKA 4P5KA 1OCCB 4WJ5A 3QO1A 3S4SG 3UAAA 4DEPC 1H6UA 1BQRA 2OFQA 3QHZL 5BZDB 1BVLA 3O3AA 2HFFA 3OLGA 5I5MA 2JJSA 1QBMH 2YD6A 1DBKH 3PJLA 1A4KA 1PD0A 4PTTA 1FBIH 3BZ5A 2WYTA 3G08A 3QNXA 5K9JH 1EUTA 4EUPA 2IQAA 2DLFL 4LCWD 4X5WA 5IVZB 4ZUTA 1I1AC 1FRGH 3FFCB 1F6LL 1NOFA 1R3LB 1A14H 3Q06A 1HQRA 2A4CA 5LGHH 2Y1YA 3CDYA 1M05A 3GRBA 3PWPD 3FT0A 5F1SA 1IEBA 4WLCA 1ILSA 1Q4NX 4NQQA 3FCUB 3WV0A 3C6LD 1RJLB 3X11B 3T0ED 2YD7A 5FHAL 2ZP0T 3BVTA 1KLGB 4XP9L 4PWGA 1WFUA 3MREB 4HJIA 1FVEA 4YEEA 2VLKB 3LPWA 5F8QC 4BINA 3D2UB 2XV0A 2FQEA 1ECZA 1RSFA 3H0TA 4IIZA 4KGLA 1TYEB 3BGAA 1X3DA 4LNRB 4R5TA 3T0BA 4OUUB 3STZA 2Y24A 5ESVB 4YZWA 2FATL 3L17A 1X5AA 4ODSH 3SKMA 2UZIH 2YPLD 3KCPA 3SGDH 5FYKH 4ZQTA 5L3UE 1A0QH 1MJ7L 3T8HA 1KCBA 2W0FB 4BA0A 1UA6H 5BO1H 5KYYA 5GRVL 1X44A 4WTXA 1IAIM 5E03A 3NVQA 4LPUA 2Q8BL 2YPVL 2NX5E 4DQOH 3WLBA 4N1EA 2OL3H 1NIBA 1HI6B 4U6HA 3SD5A 1I82A 3MLTA 3Q48A 1E9OA 1KACB 1FNFA 1AKPA 2C8NA 1FGVH 1EDQA 1FG2B 4F7EB 1HXYA 3T0EE 1P7BA 1U8IB 4ZG1A 4JFQA 2PETA 1E8YA 4G6JL 1GW0A 1NBVL 3PY9A 5DDHB 1Q90A 5BUGA 4KPHL 6PCYA 1SJHB 3CZSA 3QPXL 1X6LA 4IGBD 4IMKC 5M7QA 3ULVL 5IESL 3DK0A 5D8JH 4AMKL 1E8WA 2A6IB 4BGLA 1N4XL 1R46A 1ZTMA 4N5EC 4YSUA 1ADWA 1JV5A 1UASA 3HNVL 5LBSH 4YK4C 4HHWA 4JHAH 3T71A 1QHQA 4GQZA 4DAGH 4UINH 5CIPB 3SJVD 5E9DE 3IJ8A 2FO1A 5KAQG 3DECA 3RNQB 3B7SA 4IBLT 4PRPA 4WSJA 4HULB 3MYZA 3GLDA 1CZ8L 2BVOA 3HZVB 4UF7C 5ADOL 2Q1EA 3WOVA 2A77H 1D5XA 4F33B 4JRXB 3BVWA 4DP6X 2G5BA 2EECA 1P69B 1ZANL 1QI5A 1RZKL 3L2LA 3GSXB 4OZGB 1JBJA 4L3AA 3QW9A 3O4LE 5DRWA 4U7MA 4O9HL 3FRUA 3TN0D 1NM4A 4N3UA 1AO7A 4G8AC 1JNLH 3RX7A 5FK9B 1AXTL 4KAQH 4Y5YC 5A2KH 1PZSA 4N66E 5HHXH 2WSPA 2H41A 3PPEA 1KCRL 3MR9A 5D2NB 3F6IA 4L1HA 1XF3A 3ARTA 3DXAB 2APBA 3HE6A 5AVUB 3I50H 1MCSA 2W65A 2HTLC 3FQTB 1WZAA 4KVCL 2I27N 4XT1C 2FJGA 1J9RA 3V6ZA 1KG0A 3WHXB 1FJ1B 1XCTB 3MRKB 2NY6D 1BOGB 2FX7L 3OKNA 3RWHB 4Y1TA 4IGBA 3BUYA 5FCUH 1GOHA 1AR1B 1JZ2A 2BC4A 5K9OA 1N7ML 1FNLA 2QZQA 3HG1E 3MCYA 1JOIA 3S8FB 1CICD 1N9PA 3GS4A 2XWJA 3X12B 4DIXA 4JFDE 3V0VB 1T5WA 1MZYA 4DSYA 1RJYA 1NIAA 1OAQL 1JCVA 1RK1B 3HRZA 4YHIB 2P45B 3NK4A 3HLAB 4ZAKD 2UUDK 4EPSA 3POCA 1P53A 4I48B 4NDMA 4H20H 3C8DA 5GIRB 5FDWA 2WWOA 5KBDA 1INQB 3EUUA 5ESAA 3QA3A 1Z5HA 2E8ZA 4KOCA 1PG7X 4JFPB 3BPOB 3ISWA 5I9QB 5DSCA 2E3VA 3VH8G 4KO7A 3MVSA 4LCCB 3PXLA 3OR7B 3MCG1 4MNHA 4JO3H 3S6CA 3MNVB 4U1IA 3WEMA 4BE5A 4ZFOL 3HOGA 5DJYB 3VRLF 2ADIB 1WCBA 1OGAD 4JM2D 1H15B 1S9YA 1I1YB 3APMA 1CYWA 5IZ7A 1X5XA 1WWWX 3L7FA 2WTOA 2PCYA 4G71B 4NBXB 3L81A 3MUGA 4HIEA 3OMAB 4QUOA 5IJVA 3BKCH 5D1ZC 4FQQB 1CL7I 4KMTL 3CX5J 5JW3H 4J3SA 1MWAB 3B2VH 4NFCA 1T2QH 2QFPA 1RURH 2IWGA 5F7LB 2ZWKA 5DVNA 1TLPE 3LKPA 3LNHA 4OD1H 2VNCA 4LBAA 4E68A 3LH9A 4GBXA 1Q0YH 4UIKH 3LEYL 4Z7WE 5F7EH 5LLIC 2FQGA 2X2UA 2D3VA 2CU9A 1G9MC 3NA9L 1PG7W 1A3ZA 3C8KB 1BD2E 2ZG2A 2ZCKH 3X1GA 1XZ0B 4MKMA 4PJ9B 2BCKB 3UL4A 3BVNB 4XC3L 2ZOLB 3L6FB 3P2DA 3L4ZA 2Y6TE 2Y3NA 4M5SA 5IHUL 3H3BC 4RCAA 1HNGA 1CD8A 1BM7A 4C8XA 2QPEB 5HD8D 4B41A 4WO0A 2R2EB 4FMFA 3DDFA 1MVYA 2Z31D 4X6DE 1G9HA 2AABL 2GPZA 1ASQA 3FAWA 1ZSHA 3RJQB 2HKHL 2EUWA 3ARUA 3LXBA 4FQLH 4URTB 2MCMA 3U0PA 4X7TB 1LGVA 1ZHKA 4YHZH 4E42B 4PY7B 3LS4H 3DJRA 5IM7B 3PHAA 1UWEL 4YFLI 3KE0A 2ID5A 2OL3B 2R7EB 1QFWI 4ZMAT 2CJUL 4QRRD 4KROB 3IFNL 1RHHA 1JS4A 1JTOA 4LLWB 4AKOA 3DJSA 1YMMD 2PLTA 4WI5A 3TCXA 4UI2A 5JMOC 1X9QA 4PJ5B 2EEDA 1KN2L 1PKQA 1X9LA 5GGRY 5T3ZL 3ZRSA 1T7VA 5ICUA 1SXBA 4FQLL 1O75A 4M1CC 3UPAA 1M6UA 4WW2F 4G1EA 3SODB 3UEQA 1N68A 3I2CH 2J73A 1PX3A 4Y4FB 3U7WH 3QAQA 2KL6A 5I18L 5SWQA 1NEUA 1G6VK 4JMNA 4HWEH 4YL9A 3FU0A 4FYTA 1EV2E 4U6TA 3ZKXB 32C2B 1I9JH 1TJGH 3BSZA 4K5NA 5IVOA 4Q9CA 2AJSL 1UFUA 2BIMA 2JLPA 1QZNA 2R4SL 3O2DL 1A4KB 4QDGA 3F7YB 2R56H 1YYLL 4W9GC 5ADPH 1ZDQA 1CFSA 3G04B 4LVHC 4ES9A 5HYSA 5AW8B 5C0BE 4DH2A 3KEHA 3GSUB 3QULA 1LJMA 3IF1B 3ARDD 1TJXA 3DX4A 5AVQB 3VWJB 5JIMA 4PJ7B 1DQLH 2CJ3A 3O41A 1F6FB 3S5LG 2C1OB 1MCLA 3HAEB 4S1SL 4ZBJA 1FJUA 1S9VB 3STLA 1KLGA 3SPJA 3C5ZD 3BLBA 3JV5A 2FQDA 2JCCB 2OQJA 2PUQT 3QJZA 1GCFA 3IMWA 2X70B 4JW3A 1MIMH 3QIWD 3ZKMD 3HG4A 1KBBA 3MXWL 3T1WA 4K5MA 3BE1H 4UBDD 4KUCF 5I1GH 4EUPB 1OSYA 1UKQA 2Z34A 4MA7L 3L3DA 4PGBB 3SE3A 4N2CA 1MZZA 1LM8V 5LDUA 1FJWA 1IGIL 3M7OA 4KJQD 4C54A 5B8CC 1IC5L 1MFCL 1FG9C 3MLUH 2UV3A 1XB6A 3MJWA 2CNZA 1NGWA 1B4LA 2WQAA 2G0KA 1TYJA 1ZJBA 3HPLA 4N1CA 1QRNE 3UC2A 8TLIA 1XCWA 4GRLB 1I8MA 2BSTA 4ZW5A 1WAAE 2YR3A 3AABA 2I24N 5HVHC 1OLZA 4POZC 1JPFB 3HG1B 4AH2B 1J8HB 3UYPA 4TM9A 2CO2A 4XN9A 4UAOC 1E27B 1YUHB 3G5YA 3CVHB 1QFWH 4GUPA 1NMAL 3VJ6B 4CC1A 2W60B 4HISA 4DOHE 2NW3B 2GSIA 1BEYL 4YHPB 3EBGA 4RNRB 1HJBC 3SBQA 2HH0L 3GI8H 3LDBC 5A2JH 5IKCB 2V2TA 1VRSA 5C0CD 4BD4A 2KZ1B 3K80A 3RDTA 4B50A 1GHFL 3NCJH 2BIHA 1FJTA 4NZRH 5BOJA 3CFQA 3WNKA 1DQQA 2GJ6A 3D0AA 2XBZA 5HHQB 3A67L 4OLVH 1NPJA 3K8MA 4ZFZA 4UTBA 4QXGH 2ZUUA 4IOIA 3I6GB 1BECA 2R0WH 5CZVH 2BCMA 4AXWB 4FFZH 5K1VA 3OZKA 3ZO0A 1ZVYA 3QDMA 3AREC 3CVHH 3IDYB 5I66B 1LQSR 1QX1A 3HCVA 3GUTA 3MV7E 4KV5F 3EGDB 3K1KC 1EUUA 3ARFD 1F4YL 1MUJB 3QEHA 3ARPA 4P5TD 3CN0A 1AHWC 4AL8H 3AREA 5ADOH 1W72B 2EDEA 2GG1A 4MXVE 3VQMA 1R3KB 3P7RE 5MEOB 1PD6A 4JY6B 3ECBA 3C8HA 1EO5A 3MA9L 3MJ8A 5EPMA 4XMWA 5FUCC 1NCNA 4NP9A 5C71A 4XVJH 3CGTA 4MXWL 4JM4L 3HNVH 5LBSL 3GNMH 2OP4L 3J8F7 4JB9H 4H5SB 3QFJB 4PJXB 4NNYB 2NUPA 1UACH 3AVEA 1XB8A 4NUQA 2OMXA 4EI0A 4L23A 3HMXA 4H25A 4G6JH 2QADD 1ACYL 4JDZA 3OAUL 3EXJA 2DH3A 1UWFA 1W8NA 4WEEA 5A2AA 4PBWD 4RIRA 4JKPL 4OUOA 1M1XB 4A39A 2CCLA 5I6XC 4UUJB 4P59H 3NCCB 4KJQC 5ECJE 5CJOL 1ACCA 3WKYA 1G0XA 5JO5A 1P7KA 1XBRA 2FR4A 1M4KA 2A99A 4ZFQA 1TSRA 4PWEA 2JB5L 3MUY1 2X9XA 2C3VB 3TWCL 2IPTL 2F6AA 3BRGC 1VB9A 2OK0L 3OAYH 4ODSL 3AG1B 4RDQF 3FORA 4XODA 4UQCA 3QUMA 3TV3H 1K5NB 1WC7B 3DO7A 2J5LC 3BZFA 2G60L 3NFNB 3QDMD 5TFSL 2PO6B 2Q6WA 4AMKH 4JPVH 1T6VN 4AIZB 3T8VA 2WGXA 4OJYA 2CKBA 2Z1PA 4HCRH 2GIYA 3GHBH 4Q6YA 1VDGA 5I15L 4BK4A 1CD1A 3UJIL 2VIRB 4BKSC 1NBVH 3FFCA 4BIKA 5LN8A 2J21A 1BA9A 4JY4A 1EAOA 3B8YA 3SDAA 4D0DB 1G87A 1EHLL 2H0FA 4GG8B 3ARDC 2I60L 1N19A 3UGXA 1IQWH 4OJEH 4FFVC 4MZ2A 2JKWA 2BY3A 3RWGA 1F58H 4YHPA 3HZKA 2MH4A 2N59A 1A1OB 1WPCA 4AUJA 2Q76B 2XTJB 4JFOB 1UUNA 5CEZD 3U7YL 2BSRB 4XR8C 1MAMH 5JS3E 2CIKA 5KUMA 1NLDL 5T5FA 2PR9A 4KKQA 4F37F 1DR9A 2BSSA 3U1QA 2Z8RA 3ZKSD 2XPGA 3E3QE 4L18A 3FB6A 1DVQA 1NCAH 4JHVA 4A2GA 4AKPA 1YEDA 4D8OA 5TE4H 3T2NL 3RWGB 3VXPA 5IQ7L 3I3BA 2AEPH 2D7NA 4XAKD 4YL4A 2F9BT 2AQQA 3ASNB 4HIEB 3P9MB 1BQ5A 2CSPA 4R6UA 2Q87A 4OGYH 5E8OB 4S1RH 1OD9A 2WBJA 4JPIB 4J3UA 5HHNA 3FU5A 4IBWA 1BFVL 4J3BA 3TGXA 5HHOA 4TMNE 3KPSB 4FX5A 4GRLC 4ZDHB 4DGYL 3T09A 1B4TA 3BH9A 4P2OC 2VZUA 4NQCE 4HF5L 4XNMB 3EYOB 5F88B 1WV7T 4HK0A 2WM0A 5AZUA 3WO4B 2XX1A 1BFVH 1U93B 5D6DC 4KQ3H 4QT5A 2UYLA 2GYSA 2X40A 3S36L 4YBLC 4NZUL 3BWUF 3FTYA 3I02B 4Z8FH 1IGCH 4KK8D 4EVNB 3PXJA 2R0ZH 4TS6A 5F7BA 3PGCB 4XZ4A 3DURB 5BOZG 1PY9A 1HINH 1QBML 4U1NB 3K91A 1T5WB 3ELAT 2G3NA 3S5YA 3BIKB 4JR9H 1T3FA 3JZYA 3DX8A 1JNNH 1I3RB 1RK1A 2DKMA 4NWTH 3DYMA 1IZKA 1I3GH 4CN1A 2F53A 5A3YA 3RURA 2VLME 5T3XL 5KYXB 1AD0B 2H3KA 1FGNH 2AEPL 1RMFL 4M43L 4O51B 5E8EB 4ADIA 3RQ3A 2A6DB 3CFKA 2DIJA 1FFOA 1IAKB 1DFXA 1SXCA 1CTMA 5D71L 3JV4B 2J88H 3BUYB 1RVFL 4NLAA 2K78A 2WNKA 2WCSA 1KYDA 1N8OE 5H35A 1VFUA 1QSEA 2NY1C 2QV2A 1HYSC 4P2RA 2M83A 2X4RA 3ULSB 4L2LA 2DLGA 5J06A 1GYWA 1HZHH 1L3FE 1JVKA 1KGXA 3GJEA 2FBJL 4JM2C 2XLLA 4KY2A 1S9VA 3S97C 3STLB 3WUZA 3S98A 2E27H 5FUZH 1FVDA 3VB8A 2CIIB 4OQTL 4Y2DD 3VDAA 3O81A 4XOBA 5DT1L 3V5HB 3C9NA 3KL3A 4P4RB 3ESMA 5FSPA 4PI2A 3VDCA 5HYJE 3AGVA 2X42A 5BS0A 2K9FB 5IR1B 4FCHA 1KBPA 5HDLA 2OR9L 4YHKL 4ONHA 1SBSL 2PYFB 3VFUA 4CVXA 1CL7L 1EERB 5IMOA 2YS4A 2OI9C 4UNTA 4M61A 4OV6F 1OTUD 5DUPH 2LU7A 5C0IB 2Z31A 2W59A 4AQ1A 3QYNA 3F83A 4EMZA 4QYOB 1IKFL 1TTAA 3IFPA 5LWYL 5SX5K 3RWIB 2EJ1A 1YEEL 4TSBL 1Y6MR 1BBDL 1IBFA 4L1SA 1UACL 2ZICA 3VXPB 3T0EA 1MHCA 1S3KL 1PBYA 1V05A 2RJMA 4OLZL 5LGJB 3FQRA 1E28B 3FB7A 1MCJA 1JPFA 2YAHA 5DEJA 1M7DA 5IP4A 4LL9A 3DIDA 5EEYA 1E4KA 4HK3N 2G4EA 1KTDA 4N0FA 4M7KL 1HWHB 3NGBC 1B3JA 3QXWA 4OFPA 5TF0A 3BD5A 3MRNB 3JV6B 4U1LA 5DR5L 4LRNH 2F61A 2BVPA 4K71C 5E95B 1EHXA 3T8CA 3LVTA 4U0RB 5J11C 3L7FB 5KN5B 2A6DA 2N0MA 1QHPA 3BZ4B 5I1AB 4GRLD 4F7MB 3OKEB 1J0HA 2B3RA 3LAFA 4M9OA 5HY9B 2F5AH 4Y9FA 4KJYB 1NGXA 2OCFD 4X5XA 3ML9A 2F58L 2VERA 1K72A 2HFEA 4FFZL 4NQDE 4HS8L 5CZVL 1VA9A 1HAWA 3LYRA 1G1CA 2QKIB 3U0TB 2WO3B 2WZ5A 4YR6B 3DX6A 1IFRA 5GZNC 1OF2A 4LVNB 1INEH 4L4TD 3JWDH 1G7QA 2FJSA 4XMXA 2N7BA 4JDTH 5I0XA 1PZ3A 1JYWA 2BOCB 3TYFB 1BYPA 1JSYA 2J6WA 3GRWH 1DVYA 4X4XA 2D31B 1AY1L 1UOKA 1XGPB 2ZSWB 3QG6B 5FEBA 2E7MA 4ZOAA 5ANMA 2BVTA 1IU1A 1OO2A 5HYSG 1KELH 1NMAH 1GGCL 1RHFA 1F1DA 2BMKB 3MZTA 4PJ7A 4MNGA 3GKWL 2GK0A 5D6DA 5L8LB 3EJRA 5JQIB 2IV8A 3OKMB 4Z9KB 2OLDA 4ALAL 3RZCD 4ZUTB 4L4JA 3MV7D 4Q6KA 2EEXA 2R83A 3NEXA 1QR1B 2AERT 2OJEB 3UP1A 4RLDA 1YQVH 1EJOL 4G11A 3BKYH 4TMPA 2Q7YA 4L4TA 1WF5A 3MHZA 3A4DA 4GPVA 4N8PA 4HWUA 1H8OA 1MHEA 1IVTA 4L5FL 3EZJB 3LEXA 1AQDA 1Z9LA 4G1EB 4D91A 1BLIA 1NUGA 3QWNA 3O2VH 1FNGA 4N86A 3ZYZA 1J8KA 1MCKA 3OMZA 5KVMC 2OMVA 3BYTA 4KTDL 4KJWC 3BEWB 4K8RC 2Q7AA 2F19H 3TT1L 1BFTA 3ZTNH 3DYPA 3Q2WA 3BVUA 4FEMA 5DEGA 3TX4A 3CHRA 2NLJB 3ROLA 3L3OB 3AQZA 4J8QA 3QE5A 4LASL 1IARB 2PKDA 5KVEH 2ZXQA 4X50A 2B4CH 4YDMA 4KKPA 4PJ7F 3AS2A 4HU2A 1CE1H 3W0WB 1HKLH 3VX1A 1BIHA 3L3GB 5E99H 3K4ZA 4XB8A 3KPQA 3ZIMA 3GMRB 1GIGL 4IGBC 1MVUA 2VXUL 4PLJD 1X7SA 4XZUB 1S78C 4AVHA 2QQKH 1MG3C 3OKKA 4W9JC 5D1ZA 5DUBA 4JM2B 2F68X 3D39D 3UPCA 4ZQKB 3L1FA 3MRKA 2KLSA 3HG5A 4N2HA 3U4EA 1MELA 1DCLA 3LRSB 2HA1A 2QHLA 1Q94A 4YXLH 4UOW0 4PHZA 2A4ZA 3ZQWA 3H6AA 3MRMB 1CJYA 3FN0L 3K71B 3P7UE 4R90H 1RZKC 3NRQA 4EQ2A 4JFED 3WSQL 2PW2B 1T83C 4P49A 1X5IA 1XH0A 2HAZA 2WVSA 3PGDA 5CJXC 1SOQA 4ZPVA 2QPUA 5EA0H 1QA9B 3UTQB 4CU8A 3TEYA 3X17A 3MUHL 5AAWC 4YHOH 3SD2A 4HALA 5D1XC 1GR7A 2E59A 4GB9A 1RJYB 5E4IA 3TL5A 1CFTB 4D7BA 2YO3A 3FN9A 2YLKA 1UXMA 3G5XB 4GKNB 3WKMH 4OCSH 2NYYD 3HNSL 4LEOB 3IGKA 1BQBA 2VR6A 2EXWC 2APTA 2GTWB 3QXVA 4KK6D 3QQDB 1OAXL 3IFNH 3QIUA 4OV5B 4JFDB 2C7FA 5HHQA 4PRPD 3I2CL 4OZ4B 3HUJB 5DWUH 3T2HE 4WNQA 4B3EA 2X89D 4GQPH 4FQIL 4AEEA 5AB1A 3T0AA 3V4PH 5FOBB 4PS8A 1RZIA 3P40A 5TK4A 3AADB 5AW9B 2Z8SA 3PWNB 3ARED 5CJBA 2NLJA 5DHYA 5L4IA 5DC0A 1WG3A 3QEHB 1J86A 1RUAL 1GCYA 1W15A 1JYXA 4HLZH 3QIBC 4GIAA 1OGTB 2V6HA 3L3KB 4AR9A 1KBKA 2TSBA 3OJVC 3I84A 4BFGA 3WJMA 1CD9B 5EIVA 5G55A 2I9LA 1JGUH 3KLLA 3ZE0F 3ARGB 1GZQA 4FAAB 2BS9A 3BOVA 5DUMH 3MC0A 1UXWA 3DX7B 5K9OB 1G6RH 1N0LB 1HC1A 5CUSH 1OZTG 2PF6A 3FT9A 3G6AA 2VSDA 1P5UA 1TRLA 2VTFA 4XC3H 4FQHA 2VDLL 2WMPA 4XCNA 2X6AA 3ZDXF 2EH7H 2ITEA 3I9GH 4J3OG 5SWQB 4XNQB 3IS0X 4A37A 3HMWH 1YMHA 2X7LA 4G5AA 1D7BA 4RFEA 3TH4T 4WSGA 3WN6A 2GY7B 1F3JA 2PYEA 3JT0A 4BHUA 1YQVL 3UBFA 5LO7A 4XHJD 2HTKD 1MEXH 5DZ9A 4KMLB 4NKIH 3U36B 3V4VH 3BFOA 5I73B 5DZJA 1KB5A 2H0PA 3U7AA 4PJGB 2WXMA 3BKCL 3KYOA 3K2KA 4WFHE 4X6DB 2A6KB 2ICWB 2XBTA 4TQIA 1IBZA 1K2DB 4G7SB 4BXVA 4I13B 1CGSH 1GPOH 5J1AA 1MHPH 1XSKA 1OGSA 2FL5B 3QULB 1ADQH 1KXTB 2J5LB 1VJSA 3TBYA 4I2XA 1FLRL 1YEFH 2BNQD 3QUKA 1OAQH 3QXUA 4MB3A 3FCGA 1BD2B 3MRGB 5T1KA 2WLHA 5LQBL 1KEIA 2HX8A 3OC8A 4G43A 3I9AA 1GTNA 2CM6A 3ULUH 4NHCH 1TCRA 3EXLA 4F7TB 1JZ8A 4EI5B 3RAJH 1KSRA 3WFDL 2G4ZA 3QP3A 5I0WA 1DVUA 5I8KL 3PFUA 4K9EH 2VKWA 3JVFC 3K2UL 3BKYL 4JRXE 4F91B 2EEBA 1ODAA 2ZAHA 3WAKA 5I17A 4IJTA 3IDXL 4KDWA 3DETC 1EDHA 1ACXA 2EINB 1KZQA 1JV5B 4G8EB 5DYOA 5FX3A 1E8ZA 5F1NB 1MH5A 5HYEA 1E6JL 2C7UB 1TYRA 1LXMA 3UIYA 3IJHB 1T89A 3HBZA 4RWYH 5IUCA 4TNLA 3W2DL 3BWSA 2BOBA 2EIBA 2JK5B 3H9SE 3S37L 1QI4A 3CFUA 1FC2D 5FKAA 1KELL 5A16A 3RTQA 4Q4EA 2EDQA 1RZJC 5L6YH 2VSKB 4KMQA 2D8KA 2H8PA 4W6XB 4PJFE 3V7AE 4GG8A 4AQ8A 5C0EB 2VUYA 1QO3A 4KVCH 1FN4A 1HE7A 1B0WA 4X6DF 3EBHA 1QFOA 1XCQA 3DMMC 3IS1X 4OM1H 4U6VL 3WLBB 3C09C 1SUHA 2HKFL 1L9MA 2B1OA 4NRYA 3VU1A 4CRPA 4K23H 3QZMA 4RSVA 4KKBD 4PMEA 5DJZB 4V1DA 4HS8H 1E5UI 4E9SA 5LWYH 4HUUB 2PP8A 4PIRF 1N8ZB 3BT0A 4RFNC 1U8MA 2XWXA 4N85A 1BWWA 3GJFK 1Q9WB 3MV9E 3WDHA 1MRFH 1RZKH 5FB8A 4I0KA 3IJSA 4IKJA 3SDCC 1Y0LB 2EXWD 1CL7H 4X7DC 2NY0B 4KKCC 1FO0A 5E8NB 3ZOAA 5D8JL 5IESH 2GBVA 1AC6A 2W9EH 3TS8A 3N44F 1AR1C 4FQJL 1JZ3A 1BQKA 5LB1A 3MLPA 4P9HH 3DJ9A 4AM0B 2E46A 4JQIL 4YDLB 1S9WA 2X7LB 3KGUA 3D7PA 2J6EL 5T33L 5HHOB 1DJYA 4IBVA 3DXAE 3H85A 1HH6B 4IHOA 5AALA 2NR6A 3C5ZC 3HR5A 3JWDC 5F9JB 2DAVA 3FC8A 3FUIA 3VYPA 5I1EH 1IEHA 2DRUA 3BAEL 2FBJH 4P46B 2VAAB 2OZ4A 2CDEA 1QFHA 1IM9D 5LDSA 3AT8A 3JTSB 4NZTL 1BVNT 4II7A 5EHFA 4NI3A 5GZOC 1A3RL 1T2XA 1WFOA 1SDDA 3D2UD 4LKCB 2MEJB 2O30A 2DJMA 5E4EB 5F7MC 3VXQB 3GEWB 5IHWA 5TTRA 2RAMA 5I1KL 5B3NA 1V7NH 5BRZD 1JK8A 2HRPL 3P73A 1OOWA 1UVQA 2WPGA 3DOIA 5ALBH 2V2XA 3EGDA 1NJ9B 5C7XL 4XPTL 3D33A 4MS8D 4KOBA 3KJ4C 2BIIA 4HAGA 3U79A 1E5AA 1O6TA 1L6ZA 1RLWA 1VPOH 1GYCA 3A22A 3GPEA 4NNPL 3WIFB 3R8QA 4DKDC 5HI3C 1HNFA 1NEPA 3IKCB 8PAZA 3TO4C 1P4LB 4I0PD 4F33A 2FBOJ 4PW3A 4V1DD 4G9DB 3A21A 3L5HA 3DGGA 1B9KA 4L3ED 1H19A 3DSNB 2Y36H 4KI1A 3UYRH 3MODL 3B2UD 5D4HA 4XX1E 2FDBP 4JPKH 1A14L 1JWMA 4JG9A 1P0SE 4R97B 2H9GA 1KJ2L 4HS6A 3G9VA 4JE4B 1CURA 2DLFH 2IXQB 1CDHA 1XR8B 4GKSA 4XP9H 2XPYA 1HILB 1NMCB 3E9TA 3GB7A 5PAZA 5EF0A 4KQ3L 5IT2H 2FT7A 1CB4A 1INDL 1MLBB 3ERXA 4JFFB 5FA4A 5FHAH 3BUDA 5L7XH 5G5DB 43C9A 2DLEA 2ICCA 1V8HA 3KLQA 4ZX5A 2YXVA 1G7LB 4HIIB 5DMGD 4PW4A 3S34L 1T0MB 5IROD 4JO4H 1AGFA 1FGNL 1IGJA 5CSZB 4MZRA 4AVKA 3B37A 1XGTA 3HHMA 4Y2LA 1ZAGA 2DF3A 3FO2B 3N9GH 4NC1E 4TQEL 3FOLB 2MRYA 3BEVA 4ANWA 3AUWB 1QF2A 3TEZA 2ZNWA 3P0VL 5E9DD 4FXGB 5ISZD 3DX9B 2HRGA 3SE4A 1UB5A 1FBIL 3G5ZB 4JO4L 2UWEE 5HYJB 3CZUB 1L3WA 1MNUH 1OW0A 1QYGL 3CFEB 4JRXD 3FXSA 1NFDF 3DJTA 2FJHB 4P46A 3V79C 5CM1A 5HYQA 4WGVB 4JRYA 5DHVB 4AQ1B 3D0VB 2X4PA 1C9SA 4AEIL 3FBQA 2CLRA 2WZ0A 4NZUH 4FFTA 3TVMA 3KLHD 4LGPB 1T20B 3WY3A 4ERSH 1JPGA 3IDIB 2QGCA 3PE9A 1ZLVK 4W4OA 5FGCE 3SCMD 3KPSD 1ZIBA 4DERA 3W9EA 2IGLA 5EU4A 3QJTB 1OLLA 2W5PA 5DFWH 1QMUA 3W5MA 2IADB 4J8RB 3WL9A 4A7TA 1MWOA 2Z91B 4DZ8A 3PABA 3QHFL 4MD5B 4KXBA 1KGYE 3H2WA 3ECQA 4LCCA 2YKKA 4WHYH 4OKVB 1XTLA 4JFSA 4S1RL 2DWDA 3RWDA 1M6OB 4Y16B 4C59B 3FUNA 1AMYA 2CDGB 3CFBA 2ZUWA 1U8CB 1G7HA 4MCYB 2TRHA 3GS0A 4HJEA 2XG4B 3EZ8A 3MSFA 3W9EB 3V0DA 2HFTA 3V0HA 3D85D 4JFDA 4A6YB 1I8LA 5JT9E 2WSDA 2ZPKH 1KEGL 1FN4B 2LOEA 1UB6A 4NGHH 4HMCA 1TFPA 2JJVA 3WG7B 2X9ZA 2BRQA 3L2MA 1MAML 3HBGA 5IB5A 2WLIA 1P5UB 4MJ4A 4D0CB 4TSAL 1G7IA 1WD8A 4J3VA 4MXQD 1H3PL 1T3FB 1G9NL 4H4NA 2EH8L 2YAEA 2UWEB 4FN0A 2IOMA 4HG4K 3AXHA 3LXAA 1EXUB 1W0VA 3QR1A 4K94H 5I19L 3APFA 5KWYC 2AGJL 1EHLH 1U21A 2C3HA 3SYAA 4DCQA 4N9GA 1OGTA 2XCMC 2VDQL 1LP9E 3L3KA 4YSTA 2X9WA 1PKQB 5EOQL 1JRHI 1G9MH 3CVBA 3NT0A 4QT5B 4JPVL 2NY2B 5CHNB 5F9WC 3HE7C 3FUFA 1C7TA 1PZ5B 2WHVA 4QJ3B 4TUKL 2J2ZB 4TSCL 2DEWX 4Q9QL 3FO9B 1YY8A 3H9YA 4TTDC 1NBZB 5CNHA 1SY6H 4HS6B 3OF6D 3N41B 1HILA 2VZ3A 3RI5K 3L9RA 4M6NH 2JB5H 2ILLA 3OJMB 1CXKA 4WKZB 2HCZX 1A8JH 2P8PB 4RVBA 3FHAA 3LV3B 1NC2D 3UDWC 2CO1A 2XY2A 1AGCA 2MFNA 3SHSA 3W11D 3MFFB 1UKSA 3RUGB 3X14B 5ILTL 4Z3HA 3C9NB 4P4RA 3TVMC 2FSDA 4R2GC 2VYRE 2A9CA 4DESA 5B1CA 1BVLB 3O3AB 3F85A 2CRYA 5B38B 2A4EA 4U6YA 1K4DA 3LN4B 2OBGA 1UHVA 5DZAA 1NWPA 1S6NA 4M4RB 5E6IA 2DWSA 3ILEA 2Y06L 4XNUH 5BOPA 1F90H 3GNML 4JB9L 2IBZY 5LGYA 4D9WA 1A9BB 1OAUH 1NCUA 1AANA 1YJDL 4X6FA 4EIGB 4K15A 3TF4A 4X99A 2YEZB 1WH0A 1JPGB 3FFDA 2LU4A 4LEEA 3Q6FA 4NSKA 1AS8A 2EDLA 4QAMB 3RIAK 1PZ2A 1D2OA 1R3IH 2WKLA 3D1MC 3GXUB 1G7PB 3L4VA 4MQXD 5EUKA 2C9RA 4BH8B 1J1PL 3RPIB 1HSAA 1U8PA 5C2BL 3VQ2C 4R7DB 1QFWL 4PV9B 3EH4B 3K2UH 4JVWA 4J3OH 4R97C 5I24A 4X4ME 5DLML 1DE4A 3X3FH 3WFDH 4DP8X 5TK2A 4NKOA 4I88A 4RGNC 3TZVA 2I9LB 1OOAA 5KZCD 1VSCA 2WNWA 2XKSA 4UM9D 3WYRA 3V6FA 4ZNEE 3GIVA 4KH2A 3WFHA 2LE9A 4FKHA 5IQLA 1M9SA 1HL5A 5MEOA 1JXJA 1A6TA 2KT6A 3BAKA 2ISDA 1XZWA 5C70A 2R1XA 4AQZA 5DQ9A 3UBXB 3Q2NA 4IS6A 1AGFB 3OMNB 2C34A 1L7TH 3D3VB 1TLIA 3FMGH 1MJUH 3OKLB 4NQSB 4KQ0A 1LO0H 3KPRA 4QOKB 1R24B 3C2AL 1CGTA 3MX0A 3NCFB 4M8VA 4QHMB 3GIVB 4KXAA 4MA7H 2WQ8A 5AW0B 1X5LA 2JMRA 4XRCA 4XCYA 3WFCH 2MQ3A 1WICA 4YLQT 1JF1B 1QQDB 4QRPA 1R5VB 3QS2A 2FECI 5KG9B 2MOGA 1AKJB 4N2NA 4JFXA 4TLIA 2FB4L 2YEVB 1Z3GL 3NJMA 2YSSB 3GSNL 3PLYA 1T20A 3WXWH 2GC4C 1T22A 3CHSA 4UZSA 2FT6A 2XZCH 2BVPB 1TT6A 3FU7A 3PDOB 3QORA 3QUXD 3WHXA 5GS1B 2EH7L 3QXAA 1GXWA 1KT2A 4PJDE 3SDDB 3RL1B 2JCWA 5KVDH 2EVJA 2VDLH 3CHXA 4LPWA 5DA0B 5B1BB 4U3CA 2LVCA 2JE8A 3PQYB 4GLRH 4J3OD 3OPZL 2GK0B 1U8JA 3E6HA 3HS9A 4KUZL 1IGIH 2B8OT 3C6LA 4F37K 5ES4B 2YUZA 4KVNL 3NSFA 3SZKC 5E8DL 2Y6SD 2ZD0A 3QFDB 5DRXB 2P49B 3D30A 1ET8A 3WNMA 3QCTL 4FL4C 2I9TB 2NY0C 4C55A 3ULUE 2QL1A 2JCCF 4HGWA 1RPUA 1CE6A 4LCWA 4LBEA 3QH5A 1H3UA 2LT9A 4HJJH 2EXYD 3BE1L 4HJSA 1E6OH 4W9FC 5B1JA 3S88H 3IDJB 1MIML 1UGNA 4QYAA 2Y4SA 4KI5C 1Z9SB 4W9EC 1KYAA 3U7WL 4GFXA 3E6FA 4HDIA 3RGBA 1JIBA 3ZRCC 3VNYA 1SLVA 4K90A 2VXQH 4IRSA 4S10A 3DGGB 5GZND 2GBTA 4MJ6B 3NJIA 3KYAA 3NMEA 1DQLL 1PDKA 5DJYA 5EBWB 2FO8A 1HEZA 1U33A 3VGEA 1ONQB 1VEPA 3N85L 4UYPA 4UTBH 4UTAA 2VDRB 4OT1L 2P26A 4NO2B 4HCIA 4JMXA 4JY5H 1AZBA 4B9KC 5CBEB 3GBMH 4Q0XL 1UH4A 2B08A 1JPTH 1EX0A 5DZOA 1R34A 3VFOA 4Y88A 1NAML 4BSWB 1EFXA 1S8DB 3ARFC 3KMDA 6TLIA 3MRCB 4OF8A 3LD8B 3ABKB 4YHZL 3ULVE 1BZ9A 1VFAA 4HKXA 2R2HA 1W0WA 2F7PA 4JNXA 2NZ9D 3MV01 1FLTX 4L3EB 4O02L 2O6FA 4QXUL 1KJ2B 2XXFA 3ZHNA 3S5ZA 3VAEA 3N3EA 3RJOA 3CMOH 4LSQH 4AR8A 1E9OB 3O8XC 3LSOA 4MX7B 5CLZA 4MMYA 1F18A 3FOMB 4ZODA 3P7TE 3HW7A 1OB1A 1UOVA 2DEYX 3SBWC 1B0GA 3LVEA 1LYQA 4R90L 3D69A 3ARWA 1S7VB 3HJEA 4UTCA 4ZFOB 1KGUA 1L9TA 1W0YT 4WWNA 3RDTC 3MGTA 4FABH 1LWRA 2H32H 3MSNA 1YEGL 5EZLB 1DTUA 3D85A 4JFDD 3QQ3B 3US0A 2PCPB 3GJFA 4KH9A 2LLGA 1ZHBB 4UT6A 1RURL 2V5RA 5E9DB 5C0BB 2VXUH 1B88A 1PEZA 4JFZL 4U05A 1L6PA 3NIDF 5IMKA 4ZUVA 5DPEE 2NXZB 2C7UA 3SJVA 4QOKE 3WUWA 1LNEE 1HKLL 2H1XA 2WXKA 1OEZW 2XXGA 4OFKA 3BAIA 4PV8B 2ARJB 4QTHB 4Y2DB 1DQMH 1ZMYA 2B4CL 2JI2A 3CSTA 3L5XH 2HT2C 4W9KC 1ZGLB 3GTTA 4GRWH 2IMMA 4Q74A 3TO4D 3QQ9C 5TDPB 2JJTC 3DTXB 4U1GC 1WJ3A 2C26A 2F19L 2BP8A 4WNQB 5EZLA 3ZTNL 5EN2A 1IIKA 2H0EA 4B9YA 2VOTA 3KWVA 2CLRB 3K2MC 4JBSA 3EO9H 1RIHH 4HPOL 1YN7B 4RZCA 4E9XA 5ABDE 4FF9A 4H0LC 1OE1A 5E8OA 4PJDF 1PZAA 2ZUSA 3QJQB 3SKOA 2PPEA 4NKOB 1HNYA 4YJZL 1E5CA 3DTDA 1X4ZA 4PBXA 4PRIB 5I1DB 4ZTPL 3TBYB 4K3DL 2VRKA 4NRZA 3PAUA 4WFFD 2FT8A 1FAIL 1OGPA 2X2JA 1GAFL 3QQDA 4K8RD 4A04A 3CVIL 2BCKA 3VFSA 1WAEA 1XH3A 4K2UL 4AGMA 4JS7A 4GKZA 5L4FA 4DPRA 3KDMA 3O6LH 1FL6A 2BIOA 1JHLH 3GMNB 4FQCH 2XWEA 4G5ZH 3VFMA 5L8JB 1GS6X 3SZ6A 5KBKA 2YJQA 5KJRL 3WEXB 3VFNB 4P06A 4PREA 3ZIYA 2J56A 3DUUA 3V5HA 5IEHA 5E2TH 2UZPA 1FJQA 5AG8A 3PGCA 5F70A 4Z0XB 5LAXA 5K9QG 4MRCA 5A2BA 3WN5A 4BZ1L 3NIFE 3MRPB 5SWZB 1KGWA 4K4KA 2XZAH 2BY0A 4LSUH 4ODHL 4OZFB 3CZFB 5KOVC 5D72H 3KDMB 2Y7LA 4KKRA 2GTQA 1TJIH 2DQEL 4W6WB 1IMHC 1BW8A 3BISA 5HJDA 4TNFA 3IFPB 4HH9B 5ABAA 3UG3A 3BZEA 3NZ8B 1P4LA 1DJSA 1QLRA 3QI9A 4PSPA 1Z5LB 3PP4H 4Z7QF 3ARGA 1KJVA 1V10A 2XWCA 3FUDA 3FO1B 1I8LC 3VUAA 4WUUA 4NRXB 3FO0L 2ESVB 5FWQA 1DBAL 3OR6B 5JIPA 4UANA 3S8WA 4JANB 1QPXA 5CKAA 2X1XR 1JK8B 1PYWB 2ERJB 3P73B 4BCZA 1N7MH 1WUZA 3SE4C 1A1NB 1RUKL 2LLLA 1CFTA 3K1DA 5JO5B 1ZOXA 3DO2A 3K0YA 1L3NA 4AQEB 3MV8B 2NCMA 4TOYL 1R1CA 4EKJA 4OI5E 5JLZB 5JUEH 3SB3A 1RH8A 1NINA 1LE9A 4PJ8C 3SQOL 3RPKA 1IL1A 2KLTA 3QJHA 2D73A 5CP3A 4BWTA 3QJFB 1Q94B 4MBRA 2PCPA 2CGRH 3GJFB 1H3VA 4ODXB 4LLQA 4W4OC 5GJSH 4D0BA 3MLVH 5DHMC 3U6XA 1K3IA 2CLZA 3DMMA 5AOLA 3A4EA 4FG6D 3JV0A 1JNLL 1TF4A 5FA3B 2X6MA 1SYSA 2VGLM 4XNAA 4LCCC 4MAYB 3P9LA 4WEUD 4ENED 4N4YB 4IBYA 2X4TB 1RJZB 3QDME 2CO6A 4EI6B 1I8IB 4YDNA 2YIHA 1ZPLA 4GIPD 4CMMA 4ZD3H 2HX9A 5DQDL 1LLAA 4NKMA 3MV11 4ODTH 5MHSE 4OLWL 3VI4F 1QUNA 3OKLA 1XV8A 1SEQL 3S37X 3FRPG 1UT1A 5FYKL 1UXSB 4LDLB 1JF5A 1OCRB 3V0FA 3CH1B 4JG1H 1AZVA 2C1OA 3MOAL 5SWSE 3EW3B 5JOPE 4NCDA 3TBWA 4MCMA 3GS7A 1AYOA 2Y1ZA 1U3JA 5E23A 2F54A 1QLRB 3NJFA 1LO2L 3QI9B 3TZVB 3ARXA 3UCRA 2W0LA 5CEZE 3FNKA 3DOSA 1AGBB 4YGVB 1FNSH 3PU7A 3DARA 2P48B 1U4GA 2B0SL 2UZYA 4HSAC 4Y2DC 2BLFA 4QF1B 1SBBA 4YBQD 1TTRA 4DPAX 3O4LB 3MLZH 2NXYB 2Z35A 4HUXB 3VFWA 3DBSA 1JXFA 4OW6A 4LOUD 1U91B 4OI8A 5ICYB 1FDLH 1VHPA 1RMFH 4XB3A 1WT5A 4R4NC 4F8QA 3NQKA 1WISA 3IDMB 4XMLL 2XJKA 3FBKA 3HE6B 2WO4A 3LH2L 4JKKA 4ZS7H 1R47A 4IIQA 1PIFA 2WXHA 4FQXD 2MQCA 3CE1A 1FNEB 3GINA 4Y4KC 1SHSA 3UO1H 1ZTXH 1JMZA 2Q7NA 1JNHB 3FSVA 4X6CE 2F74A 1KUMA 3HS8A 5I74B 5DLHA 1PJ9A 1IGML 4OZGA 4FNUA 5LBSA 2ESVA 1NBQA 4XBPA 4FP8L 1YC8A 5E2UL 3GRWA 4HT1H 1NH6A 5IV2B 1XL4A 2A1WH 4JVPA 4K7PY 4PRPB 5EEZA 3MLRH 3KH4A 1H3GA 3O2WH 4AM0A 2XBDA 4JO1L 3BJLA 1ZTXL 5C8JA 2Y7OA 3R4RA 3U1SH 3EGXA 3WTSA 5GRJH 4XI5D 4DHLA 2VL5A 1KIUA 4FNQA 2OQJB 3IXAA 3GMPA 3CXFA 1D5MB 4XPBL 3CFNA 4JFPA 3T04D 1CFBA 2JJWA 4S1QH 4QHKJ 1T03L 1FDLL 4BCYA 3OGOE 5J3HD 3C8KA 5FM8A 3ULVD 3KVQA 1HZKA 1GZHA 4IKIA 1BGXH 4XWGL 3P7PE 1ORQB 2CHXA 3FT4B 3QUML 3MRHA 1ADQA 2WBJC 3X12A 2W1NA 3P3RA 2EXTA 2VISA 3HIZA 3TZVD 4QY8A 2NUTA 5F3BA 5J89A 4HD9A 4OZHE 1RJZA 4LLAA 3B7RL 2Z7YA 1A4JB 4Z5RB 4Y5VB 3ET9F 3RWHA 4GQRA 4L1TA 4IU3A 4Z0BL 3BUPA 1QTSA 4A6YA 3NSYA 5GGTL 4KX8A 3PWPE 4AYFB 1VZIA 3IRCA 5CJQH 1NIEA 3QFJA 2XQ0A 1AIZA 3BXNA 3U9PH 2VN3A 3I6LE 2N3JA 2C1PA 3FKUS 3HS0A 1A7NH 1GRWA 4OJCA 1P6FA 1A02N 1Q0XL 5DLLA 2Y5TA 1ZEAH 1ZK5A 2W94A 3SGEH 2TMNE 1KB3A 2A7BA 2HSIA 1I75A 1IAOA 1RI8A 3HPJB 3C08L 4WI9A 4XOAA 1JV2B 2D3LA 1FVEB 1F5WA 5L2JB 4ANXA 4JG5A 4PU2A 5FYJD 1ZGLA 3T4AC 4NUJA 2BVQB 4MJ5A 1NM9A 1OY3B 4PJ9D 2GTZB 2B9AA 3HA0A 3TO2A 1LE5B 3U2SB 2VKXA 4UQ9A 3VYOA 1TTBA 2AP2A 1AVAA 1MCBA 3CNKA 1X7QA 1FNHA 3O8XB 3RNKA 4EKXA 3F12A 3E38A 5B38A 4LLMB 1ZLWH 3EYUL 3F6JA 4KFMA 2ZUQC 2BWQA 4WFFE 4JO8A 5D1XE 5E5RB 1I7RB 3OG4B 4R5VA 1TETH 4BGDA 2BO0A 5SWSB 1LNCE 5CJOH 3BSGA 1CFNA 1TFHA 1DO5A 4XVTH 2NYKA 1IEAB 5LBVA 3BZ4A 4AK2A 2YMOA 3VG9C 3VGBA 2ICES 5AB9A 4OLXH 2HMIC 2NX5A 4Y4HA 1SOXA 4EDXB 3QT2A 3CUPA 2ZOLA 3L6FA 4OFYA 3QDGD 1ERNA 3R1GL 2IH9A 4M8UA 3VTAA 3QFJE 1U3ZA 2HFFB 3A6CL 4B96A 2BH0A 1QUPA 1MAJA 4JRWA 4M93B 3SKNA 4PB0H 5E56A 1NMBH 3DX3A 3ZE0E 1HQ4A 4PGCA 4Y5XB 5D7JD 4FKEA 4RAUB 4JGNA 2GCYA 2V7HA 4AJ0A 1DBAH 5E8PB 2WNXA 4ODUB 3US9A 5LAXB 1A1OA 1DQJB 1IAMA 2X4RB 4BELD 4JE0A 2JKIS 1GJUA 3KPLA 3F64A 4HUCA 2QGBA 1PLGL 4F93B 3TFBA 5DU7A 4LSTH 4DKEH 1U93A 3MJ9L 3H7BB 3QEGL 5EOCJ 2VL5B 5L9DH 3TBTB 4NAJA 4ZPTA 1XVSA 2CHNA 4ODHH 5E2WH 5CFHA 1S7XB 3QZPA 2FUTA 3VXUD 3R06A 1H5BA 4MJ2A 5E9AA 3C6LC 1CLZL 1RUQH 1XFPA 4HOWA 4GXVH 4XRCB 3FULA 4TLKA 3BFWA 1NC2B 2BFGA 3ARZA 3ILQD 4KO6A 4BSVB 4LP5A 1C5BL 2DQGH 5DJDA 3GSRB 3H42H 3SE8L 2JCCA 1F3DJ 2Y7SA 3UG4A 3VO0A 2E76C 1TTCA 3GSNA 3CK0H 3GSVA 3MRDA 3R0MA 1T0NA 3NCJL 1OAYL 1AQDB 4KHXH 1HYSD 3CVIH 12E8H 3PWPA 1LK3L 1KB5B 1DDHB 1U6AL 3P0YL 1OT1A 5DVKA 5EU6B 5DD0H 1M1XA 5JOFA 3GI9H 5C0FA 5C0BA 4DUWA 4OLEA 3DO1A 1C5DA 4B53A 4N0RA 2DQCL 4MAUL 4NNXB 4PR5A 5EC2A 1T83A 2H2SD 3CZEA 2AS5M 4ADJA 4RIRB 1OHQA 3NIGE 4X9GA 3EO9L 4KK5C 4PJFB 1EO8L 1I7ZA 4UAOB 2VDMB 3MKKA 4IKNA 5E6ID 3T2QA 2ZZUT 3DRQB 4UZUA 3S3SA 4KX7A 4MXJE 1TZOA 2ZYSA 1CFSB 1K3ZA 3OTTA 2FNBA 2PP7A 4HPHA 2DN7A 2F8VA 4PJ9C 1RZ8A 5HHVH 2W0FA 3ILDA 4Y5XC 2HFGH 3VFRB 2J1YA 2VQXA 35C8H 4H26A 2GK2A 2VUKA 1L0XA 2JJTA 4TLTA 4X6BA 3V6OA 3F00A 4JFZH 4JLRA 3MCLL 4FYSA 1BJ8A 4OGXL 1SN2A 2HT2D 3W38A 2GHZA 1IC4H 2CDGA 3NQXA 4I9XA 5F3HA 5I6MA 3TCLA 1IBGH 1DUYA 3VFSB 4HOZA 3W39B 1JP5A 4HUNB 2R0LH 2CKNA 2DL9A 3FT3A 4YIQA 5AZEL 1G1YA 3H1ZA 5F8RC 5AW2B 4RGMC 1RZJH 3TYFA 4HXAH 4BRVA 5I1CL 2O5NA 4KY1L 3CQFA 5DZPA 2XWRA 2VLJA 3BIBX 5TF1L 3VFOB 3ZYOA 1SHWA 4LCUA 5GQBA 4G43B 1DBML 4PGEA 4OZIB 4L29B 3N5AA 1PE5A 1K6QH 4HZAA 1E2WA 3VXUB 4Q6IA 2APVA 1QNZL 3LNIA 3LIZL 4GLRI 1AGBA 5EIIA 1W72H 5I5RA 4NI6A 4P3WA 1TOXA 4ZSOA 3GSQB 2P8LB 4NO3B 2AXWA 1EEZB 5K5YA 2HVJA 5KSUB 1BXAA 1NIFA 5E0FA 2OMYB 3HE7D 3P9MA 4N5ED 4MQ7B 2OMTB 2R56L 1JZ4A 1NJ9A 4HYTB 3BRDA 3FPYA 1BMWA 3GBEA 4FZ8L 3LKQA 1PJWA 4OY9A 2E74C 3O3BA 3RRQA 1E8XA 1W72L 3VFMB 4DUXA 4MS6A 4YFDB 4GAJL 5EU6D 5JNYB 2BNQB 3EO1B 3JTTA 5LG6A 5I18H 5HYJD 3FU3A 1KN4H 4CMHC 1GSKA 3DNZA 3OX8A 3AAZA 5CGTA 4CL7A 1B4JH 3DUHA 4L4VD 1FFTB 3P2BA 2OMWA 4XMKH 3TEXA 3ZMNA 4UNUA 4H25B 5B7EA 4F8PA 4YDJB 3O0RL 5AFAA 1VCBC 1VZGA 4ENEC 1SYVB 4YVUA 1KYFA 3L7EA 5CMAB 5AZEH 2DBJA 4C56A 2DYPD 4PJXF 3HR5B 1MSPA 3T3MB 1EWHA 5I8EA 4P3DA 1NGYA 3B4NA 3M07A 3NZ8A 3L1OH 2ICWI 1UWEH 2NY3B 2UWEF 4U1GB 5HXMA 1OP5K 1VFBB 4L8BA 4JFXB 5EPMB 3I9PA 2AVFA 2HKHH 5JPNB 5D2LF 4PCYA 4KVNH 3OHXB 4GP5B 3IETA 1NBZA 5DJCA 5KVDE 4TPRH 2HLFD 3TJHD 1FH5H 3OKYA 3BH8A 4Y16D 3E3QC 3VM5A 5DD5L 4MJIA 3T6VA 2EXSA 1XF1A 3BP5A 1JN6A 4KRMB 2W9DH 1YDPB 4H8UA 5C09D 4XO5A 1E43A 3HAEA 5DEFA 2M8XA 5EDSA 2PW1B 2ENYA 2YN3A 4FXKB 5BS0E 3GSNH 4NN6B 3CX5K 5JPMC 1MN4A 4CMMB 4ZK8A 3IXTB 4WUUE 2HVKA 2WY3B 3CBRA 2J8UE 4K94C 4Z77B 4MWPE 3LNGA 2DKUA 4O02B 4Q89A 3GI9L 4YHNB 4MS8C 3VFPB 4Z7OB 2O5ZL 5SV4A 4FLRA 2O61B 2XA8L 1ETA1 3HJ0A 4I77L 2YN5A 4HHAB 2FO4B 3PUUA 2VXVL 2HB0A 4WENB 3NUKA 3V7AG 1PGRB 1CDCA 1TO5A 5KVEE 2A83A 3QH3B 1WZ1L 3TYGH 4CA4A 1RUML 3MLXL 3EJYD 4YE4H 4HU8A 4UDUA 4HEPG 4WO4D 1LQBC 2YEZA 5L41E 4N22A 4IEFA 4RFOL 4RRPA 4EE2A 5L4MA 2R1YB 1UYWL 1DL7H 3IBOA 4X4ZA 1UJ3C 3VH8B 1GGUA 4I3RH 4YDIH 5JOFB 2X9YA 5CO1A 3BAWA 3RX8A 1I8MB 2EDMA 1FL6B 1Y1DA 3ZBMA 1RZIB 2P52A 1JZIA 2H3XC 2CNYA 4XXCA 1I9IH 5DEZA 4X9HA 5IQNA 3W9DA 4NO3A 1J1PH 5C6TH 3TT3L 4NO0A 2MOQA 1PL3A 2V9QA 5EU6E 1IJNA 3WIIH 2NTFA 3DSFH 4PSRA 1WYJA 1X5JA 4WWKA 1MJJA 1TZ8A 3Q5OA 2IQ9L 2AJ3A 4ECNA 1M9WA 1J0IA 4Y9EA 2E56A 1HWGB 1OAUL 3QR0A 1MXDA 1WD9A 4ZFZB 4PB0L 2VM4A 4ELME 1MCNA 1JK9B 3FQNB 5F97E 1USZA 5FO7A 4QLWA 1UH2A 2VLMD 5KN5A 4FL4B 4JRYD 3R1GH 5FCUL 4GT0A 1FVCB 4I4WB 4F1SA 5CHNA 1NTDA 1DBBH 3ENEA 2L3BA 3KPOB 1AZUA 5CR1A 2XZQH 3QUGA 1E27A 2CIKB 4G8GD 4M5TA 5AWNL 5ILTH 4JHWH 4ODUA 2PYEB 1BZQK 4Z7WB 5IMKB 4GG6F 1N2RA 1RUPH 5DJ2B 5EUOA 1U4EA 3SDDC 4DFHA 2PW2A 1CQKA 5D70H 1BFOB 3B6SB 1JRHH 2TRYA 3EOTL 1N6UA 1KT2B 3LXCA 3UTSE 4Z7AA 2ITDA 3VD4A 3Q44A 4MCZB 4O58H 2A9MH 3THML 5HI5C 3CU7A 4EJ1C 4OCWH 4NC2B 3N1QC 2HXAA 1MJ8H 3TFKC 1HHHA 1MCRA 4NQCD 1HEZB 1SY6L 3GSQA 4PJFF 3RVWC 5T3ZE 1DHKA 4TNVK 4TSCH 1EEUA 3C08H 1KBWA 3ZT5A 4AV0A 4FADA 1H3TA 1KJOA 4MNQD 1BD2A 1I3RA 4QRBA 1EAJA 4U2ZA 4C83B 2WGNB 2F53E 3G6DH 3JWOL 4ZMYA 1G4MA 2VDLB 5AZ2L 4R8WL 2BZCA 3H4HA 2CM5A 3VYNA 4TNWK 1J5DA 4AYDC 1BEXA 5JVIE 2Y0SA 3KVPA 1IAII 1KPRA 3CFBB 2IBGA 2J8HA 2GQHA 4UINL 2EH8H 5CGBA 2BJMH 3EDDA 4WRLA 3B7YA 3KPPB 2X89A 3NEEA 1WA0X 2AXHA 2QPSA 2X88A 3T65A 1HKFA 1CLYL 2ZXWB 2KUTA 4XPHH 4AGNA 4JHZA 1LHZA 1TJHH 3F7KA 5C0GA 1DE4B 4P2RB 1H5BB 5HGGS 3MRBB 5K59F 1RAMA 2MMXA 3VRIA 1MAKA 3QNZA 1E0OB 2F5BL 2WVVB 4PRHB 2VO5A 3CWGA 4YDLC 2D2OA 5DK0A 3UP6A 2YAQA 3P11L 4P5TB 2O4EA 4CVWA 4I1RA 5CFAA 5JYLA 1IAKA 5IEKB 4KDVA 4PRBB 5C09E 5I1IL 1PVHA 5FSJA 4EN3A 4XPBH 3PWVA 4B9IA 1T1WA 4H8WC 5C0GB 1UZGA 1BD2D 3QARA 2DIAA 5A6MA 3PWPB 4ZYKB 1W80A 4BFOA 2UZIL 3BMVA 2CK0H 4LMQI 2RCSH 2WQUA 3ZKXC 2O5XH 1R5IA 5F96H 3DJZA 1I7UB 1O7DC 4G9FB 2PN5A 3AXLA 4HIJB 3UABA 5E6IB 1JXKA 2DI7A 3CFJB 4DN3H 3VD9A 4Y4FC 1XQ4A 1KCVL 4BQ6A 4FP8H 1EMTH 1N8ZA 3MRMA 4WDIA 5KYWB 4AJYV 3FB5B 4JN1L 2DM2A 5JQ6L 2B3IA 1FYHB 3IDUA 4UTAH 1CXIA 2VLJE 2CUMA 4PJ5D 1NGXB 4X5XB 3SQBA 4NQCB 3BD3A 4XCEB 1MNUL 2A9NL 2HT4D 2VM3A 3VRLE 1AFVH 5IREA 2WXGA 5CR8A 4NN7B 3FQXB 4P4KD 3FFCE 2F08A 1YO4A 3REWA 2E7LA 1NL0H 1JUFB 4AW4A 4ANUA 2WTRB 1HESA 2J12B 1IGYB 2JKNA 3NJHA 2O93L 2FD6H 5DPFE 3AROA 3ZDYF 1FIGL 4GXUN 1NDGA 4WIQA 2I07B 4F5CE 1CIUA 1XZ0A 3SQBB 5IMMB 3Q05A 2NXYD 3HI5L