5C97A

Insulin regulated aminopeptidase
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
866
structure length
860
Chain Sequence
LFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Insulin-Regulated Aminopeptidase with Bound Substrate Analogue Provides Insight on Antigenic Epitope Precursor Recognition and Processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Leucyl-cystinyl aminopeptidase
total genus 263
structure length 860
sequence length 866
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 5c97A02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 5c97A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 5c97A01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5c97A03
4XMXA 3CHPA 4FYRA 4L2LA 4HOMA 4KXAA 3QNFA 4P8QA 3FUDA 1SQMA 4FKEA 1GW6A 3KEDA 4PJ6A 4XMZA 4QMEA 3FUMA 3Q43A 4ZW3A 4R7LA 4NZ8A 4KX7A 3FU0A 3FH8A 5J5EA 4JBSA 3EBIA 4XN4A 4XN9A 3FUNA 4KXBA 4MS6A 4RVBA 4FKKA 4RSYA 4XMTA 4K5LA 5AB2A 5K1VA 3FU3A 4MKTA 2XPYA 3FUFA 4XO4A 4R5XA 4E36A 3FUHA 3FUIA 3EBHA 4FYSA 3FUJA 4XO5A 3FTVA 3PUUA 3T8VA 3EBGA 4GAAA 4XNBA 2R59A 3FUEA 4ZX3A 4FKHA 4XN8A 4R5TA 3B7TA 4K5PA 3FTSA 4F5CA 3FH7A 4OU3A 5C97A 4XN2A 1H19A 4ZX6A 3FHEA 5BPPA 4QIRA 4XMUA 3B7RL 4XN1A 5DLLA 2GTQA 5DYFA 4XN5A 3MDJA 3B37A 3B2XA 2XPZA 4ZX4A 4FYQA 5FWQA 3Q7JA 4XN7A 2DQMA 3RJOA 3CIAA 4FYTA 5CU5A 3FTUA 4ZQTA 2HPOA 4QUOA 5LHDA 3FULA 3CHSA 3Q44A 4DPRA 2HPTA 4KXDA 4KX9A 3FTWA 4K5OA 4PU2A 2YD0A 4R5VA 2ZXGA 4PW4A 4ZW7A 4ZX5A 4XNDA 2VJ8A 4KXCA 4Q4EA 3SE6A 3FUKA 5AENA 3QJXA 3FU5A 1HS6A 4PVBA 5LG6A 5J6SA 4XNAA 4ZW8A 4NAQA 2XQ0A 4XMWA 4ZW5A 4QPEA 4XO3A 4KX8A 1Z5HA 2DQ6A 3FH5A 3CHOA 3B3BA 3B7UX 3FTXA 4Q4IA 3CHRA 4XMVA 3B34A 3U9WA 5AB0A 4J3BA 4FGMA 3FTYA 4Z7IA 3CHQA 3B7SA 4WZ9A 3B2PA 3FU6A 4ZW6A 4X2UA 4K5MA 4QHPA 4K5NA 3FTZA 1Z1WA 5LDSA
chains in the Genus database with same CATH superfamily
1JHLH 1USQA 2ICWJ 3BUBA 1EZVY 4NP9A 2WVVB 1QI3A 4UTAL 3SPVA 4PJ6A 1FFRA 4P2OC 3L08A 1RZPA 5D7KE 4LSQH 4EIBA 1KYFA 4AYGA 3JV6B 1ZA3A 2O5YL 1EXUA 5L2KA 3CVHL 4UAOC 3QDMB 1LNFE 1RJZB 1NC4D 1Z9OA 1E4WH 4ZMTA 2NY5L 2XVKA 2E27H 2V0AA 3DO4A 4EI5A 1P5VB 4WGWB 1S9KC 3CLFL 3DTDA 3LXCA 1L7IL 2BVOB 3KPRE 3INUH 3G5XB 5IJVB 3VQLA 3H9SD 5C0IB 4YHNB 3EADA 1YMME 3BUYB 3BEVB 5D1QE 5GRUL 3UGUA 5D9SA 3TJHD 4NHCL 5DHYA 3SOTA 3MU3A 4ZX3A 2FSEA 4UQDA 1IKNC 1R17A 1O75A 4WHYG 2IXQB 2H1XA 1I31A 2NNCA 5MHSD 5E94A 4NQXA 5HPMB 1VKXB 3WFEH 4AZUA 4E9WA 1EHLH 2ADIA 4EE2A 1YEFH 2J4WH 4GMTL 3M8OH 4YDMA 1FE8L 5HQDA 2Z65C 3JWNG 4XN5A 1QF1A 3RWEA 1E0OB 1UQSB 3QDJB 4HHAA 4OBRA 4FXKA 5A40E 5JZ7C 3TS8A 3PDOA 4F7MA 2YPVA 5C8JB 1JWUB 3HHMA 1NCOA 2WUBL 4DGWC 1AO7D 2L7JA 2OXGB 4EZKA 1ZLVH 1FE8H 2XQYG 1IC5H 3M8OL 1UZGA 2JIXD 1KCVL 1L4IA 1S3KL 4R97B 3SDDD 2JJTC 1XBDA 3O45B 3ALXA 4UOZA 3EO9H 1TCRA 3BE1H 1FJ1A 1UWFA 5ESQA 5E24E 3V8OA 4DVBB 1S5IL 1UXLA 2WJ7A 2C3VA 4UIKL 3W2DL 1PLGH 5D96C 3U36A 2I60H 1W0VB 1YEKH 4AIZA 1BVNT 4GFXA 4L3AA 3VXUD 4ODUA 1IE4A 4D91A 2GJ6B 5FCUL 3FW6A 1GGIL 4XCNB 5FLUA 4NPKA 4YBQD 4XMPH 3LQAC 4MXQD 3GHBH 2OK0L 4ZNEE 3C60C 4HLZG 1G7MB 1KG0B 1MH5A 3NIFB 3DVFA 2HVBA 4JG0H 4XT1C 1SBSH 1F6FB 5BVJA 1CICC 1UM5H 2WQVA 5I6NA 1ZEAH 1HINH 4S2SB 1HXYB 4Z7WF 3OB0H 3C9NA 1HWHB 2FZ3B 4NZRL 5C0CE 3ESMA 3F6JA 4EUPH 1DSYA 2GK2A 2IQ9H 1MWAA 4ELMF 3K81A 1D5MB 3DGGA 3G6JF 5FYKE 5G4OA 5GS0D 3DBSA 3N2JA 2WTRB 4OFYD 3PPSA 4W9ZA 1FZOB 1KCUH 4MD4A 5EZIH 2OYMA 3PP4L 1BBDH 2FD6H 4O00A 1W0WA 5E2WH 5FYLE 4KXBA 3FQNA 1NDTA 1MHHA 3BDXA 1RURL 3LKSB 4Q6IC 4EN3B 1KFGA 4L48A 3AWGA 2IG2H 5EIIA 4U1GB 4WI2A 3GLDA 2NPLX 3FUFA 2FBRA 3O8XC 3LB6C 4GSXA 3NACH 1AYOA 3QZMA 5A2FA 5DI8A 1OQXA 3L5XL 3O4LD 3SOBH 3AXHA 3K1DA 3ZHNA 1G9NL 3D51A 4PR5B 1ZIBA 5DMIL 3ERXA 1REIA 3L9BA 4DKEL 2YN3A 3SGDI 4A7TA 2OYLA 2W88A 1HSAB 3KW8A 4PJ8B 2CO7B 5F89B 1GGBH 1O6VA 2MOVA 3NTCH 1R75A 5KBLA 3VQ1C 2DZEA 1N3NA 5IOKA 3RNQA 3TBYB 1PU0A 5DLMH 5DR5L 1LNAE 2QGCA 2GTQA 3MOAH 4Q6IA 4BSJA 3D5OF 4KQ3L 5DD3H 2QLYA 4NENA 5C3IA 5DZNA 1AXIB 4BZ2H 4CUCA 3Q9PA 3RU8H 4HMCA 5CZKA 5F3HB 3QEQD 3TJEL 4OQTL 1NBVH 3BWUF 2IWFA 4R7NB 4KTGA 3ULVF 1OAQH 5TPWH 3UYRL 3Q6FA 3ESVF 4PRHB 5FW6A 2ZXDA 3CFKB 2DF3A 5AALA 5IW6A 2CD0A 3VXMA 1NLDH 3SIKA 1HCYA 2AEQH 1BLIA 1T89A 3MUGA 3HG5A 4PRHD 1R5IA 3FT4A 2IWKA 2QEJA 3U1SL 5KVEE 3NA9H 4EN2A 1PX3A 1CICA 4FQHA 4X6EB 3RWCA 1N0LB 4PRIA 3LTVA 5F7UA 5HHVL 4NAQA 3ZL2A 2VDPL 3GXMA 3PF2A 3GMLB 5FHAH 2HN7B 4U7MA 5JHDE 1DSFL 3MRLA 4QRPB 4BRJA 1IT9L 3T77B 4WIQA 3QG7L 4YWGH 3KJ4B 5DJ2A 2H2PC 2G5RA 1MAJA 3IGAB 1GR7A 3MODL 3MUY1 1AKPA 4QHLA 4QRPD 3D18A 1DANT 3KR3L 5T1KD 4JDEA 3WE6A 1PQZB 1WFMA 4WTWA 1LMKA 1MW2A 1T66C 3NFPB 3PJSB 1QFWM 4TNLA 2J72A 2JJTA 4LO9A 4FNSA 4X5LA 1XQ4A 2H3NA 1RUKL 5DT1L 1MFAL 2X4SB 4U3SA 4U31A 5E23A 5I1LA 1YN7B 5DS8B 4PG2A 3HLAA 2XWEA 4OZFH 5EOCL 4XMXA 1Y7VA 3BZ4B 4UYQA 5L88L 4GRWH 1J1XL 5HJGA 5IV2A 4AYMC 2KPNA 2ORBL 2Z35A 4N0YH 4R4BB 4XAWH 3ETBJ 4JG1L 5BO0D 4N8CL 3DLQR 4U6HA 1ZLWH 2CBMA 2CCLA 3V7MA 2DL9A 3EYSH 4I88A 4RDQF 3RVWC 1IGFH 3P7QE 2V9QA 3L9RB 3NCEB 1QZ1A 2CHZA 4PMFA 1G4MA 3CZUB 4OD1L 1UT1A 4OZHB 2ZIDA 4MZ3A 5I1JL 4LL4A 1P5VA 4LSRH 2DBJA 4FQ1L 5I1HL 2EDFA 32C2A 2HT2C 1JF6A 1DUYA 1VIWA 2KZBA 5K39A 1HILB 5AB1A 2NY5C 4JFHE 3WFDH 2XFGB 5I19L 4HKZA 3T0DA 4KTEH 3RWFB 1WBXA 4D9QD 5EUOB 4TLNA 4PV8A 4TUKL 3ASWA 2K3TA 3T6WA 4JB9L 4JM2D 2FX8H 3MO1B 1PMYA 3RIAF 4GXVH 3RPIA 3WNJA 3DV4B 4HFUL 3VI3E 4EI5C 4KMTL 3EKCA 4OI7A 4PV8B 3UMNA 3ABGA 1BV8A 4TVPH 1E5UI 2B9AA 2CLZA 2W80C 4NQEB 3GSUB 4H8WL 4TULL 3ARSA 4X42A 4Z8FH 5J12B 3VTAA 3TFKD 1BEYH 3U83A 4JN1H 4F3FA 4HHAB 1X7SA 2VN4A 4EI6A 1JVOA 4URTB 5F6HJ 2NX5A 4GQ9H 1WZKA 3FULA 3HG2A 4TYUA 4G8GE 4IHOA 4M5YL 4F2ME 1AD0A 2VLJB 8PAZA 1W0YT 1ZOXA 4CVUA 5AW9B 2CKBL 5IBTL 1M05B 4MNGE 4N9GA 3S7GA 1EGJA 1A25A 3U4BL 1UGKA 4JZOA 2GTWA 4CJ1A 3ZOAA 5GQBA 1NICA 3QI9A 3U2SB 3VWJA 3SJVA 4NJAL 4FZEL 2I32A 4Y1AB 5IGXH 4FNTA 3WNOA 2PTUA 5DYOA 1T03H 4I3RL 4AIZB 4XCCL 1X5KA 2BVPB 3BP6A 3F7YA 4E0RA 4PJ9B 4D9LH 1U95B 3B5TA 4DGYH 3E9TA 1HOEA 3GMOA 4PUBL 2OYPA 3WD5L 1XCTA 3AM8C 2FWSA 3SBWC 4TNVK 1Q1JL 4IJTA 1A6WH 1M57B 4UDUB 2WQ8A 1WD9A 2IEPA 3G6JB 3L3JA 5C7ZA 3KBPA 3SPVB 5IESL 3H6AA 1H3TA 1RJYA 5IFAL 2WBKA 1UWGH 1B9KA 3V95A 1QEWA 2N56A 4LFHG 5F7AA 1CFMA 3VH8G 4D8PA 4OCRH 2EC9T 4M3JA 2D7TH 4DZBB 5EOQL 4QHMA 3QJVB 1MHHB 4S1QL 5T3XL 4HUNB 4KHTH 1E2ZA 4PBXA 1EA9C 3OLEA 4CN1A 5I1EH 2FAUA 2IDQA 4Z7VB 3RPKA 1UZ8B 1FZOA 4TSAL 2OXHA 3MRBA 5DJZB 1R3JB 3J2PA 2G2NA 2XQBL 5LAXB 1F4YH 2WNWA 4YC2C 1SOXA 4UM9D 1LK2A 1RZ7H 3CFDA 1NFIA 1UFUA 2PXYB 3HEIB 3QJFA 4O4YH 3UG4A 1NFKA 4NRXB 4X8JA 2LW3A 1JPTL 4BKTC 3FYIB 4AXWB 4H8WC 4ZTOL 1UXSB 3VFUB 1CFTA 3ZO0A 3BGFB 1KN4L 3GMMA 3OR7A 4NQSB 3DX9B 3ILQD 2VR3A 2VN7A 3DX8A 1E42A 5C09A 4GAAA 4TTDC 2EH7H 4ZXBA 1MIEL 4Y2DB 2DJSA 3IJ8A 5BMFL 4GSDL 1UB6B 4HIEA 5GGVY 5AYTA 5T1DH 3RNQB 4JG5A 3IXAB 1E4WL 4XCNA 4HYTB 1J05B 2X4SA 1G7QA 3MJWA 1OK0A 4U3SB 4ELME 1H19A 4FFWD 3BAXA 1HCZA 3QVAA 4LNVA 4TQ8A 3TBWB 2OMWB 1KLGB 2BY0A 3MRMA 3PP3H 4QR7A 5AVYB 2XPZA 2PMZA 3NFNA 2IQAB 3NZ8B 2W8CA 2BIQA 3BIAX 2GSMB 5CU9A 1KYOJ 4PJFB 1VFAA 2X4OA 1UD2A 5IQ7L 4BCZA 1NIEA 2IAMB 1ZHNB 4LCCB 3T6VA 5HYQB 1JRHL 4BZ1A 3U9PH 1LO4L 2ZNXA 3MV8D 1HVXA 1O5DT 2V9TA 2ADJB 4XO9A 2HKFH 2KZKA 5DD5H 5E8EA 4YZWA 2JB6B 4YVUA 4HAGA 5D2LB 1NBQA 5IMOB 2IWEA 3H42L 3GSVB 1S7TB 3KPNA 4HS8H 2O5ZL 1FO0B 2WMPA 1CYXA 1UM6L 3NCJL 3QIBD 2R1XB 4QHKJ 3PGCA 4OCRL 4AT6B 1EO5A 3K71B 3OLGA 2NR6D 3V4PA 5D7SH 2CAKA 3MV7A 3KBHE 5AAMA 1R5VA 3CVIH 3WU1A 3GPSA 1AYRA 1S7SB 4LVHC 4MNQA 3AROA 3EHBD 4P23B 2CHXA 4N6RA 5CJOL 1RJCA 3KCPB 1ACCA 2J55A 5EOCJ 2FSEB 1I9IL 4HX1A 2XV0A 3BVUA 2IADB 3WMQA 3J27A 1BA9A 3H7BA 4Q52A 3V0EA 2ROXA 5AW2B 5GHWH 1IFRA 3L4VA 3BZ4A 2OL3A 4M7LL 4MQXD 4Q89A 5T1LD 4BK5A 4J5VA 5AW7B 3ARBA 4WKZB 3NZHL 3F5WB 1NCJA 2ICWB 4OLVH 1EBAA 1VFUA 1MJ7L 2OKMA 3QO0A 1L9NA 1RUPH 4HXAL 4DSYA 2BSTB 2Q87A 1ZHLB 4JFXB 4YHPB 2EAEA 3MRRA 3VXQB 5BUAA 5EC2A 3O45A 4UILL 2BOLA 5KG9A 1TFHA 4KGJA 2XJLA 3T4AB 4YBQC 1CFVL 2BOCA 4APQA 3LV3B 4LB8A 3UJTL 4EQ3A 4U6XB 5DEGA 2BVYA 4Z7UA 3F12A 4OUUA 1CLOL 2CQVA 2YPLA 3PV6A 1CI5A 1KJOA 1WZAA 1JTOA 3FSAA 1I8MB 4FQHB 3RWCB 2CUHA 4WSGA 3RKPA 3FB5A 4U4BA 1GSMA 3CN4A 2FQFA 4JHWH 1AJ7H 2R59A 1CU4L 4ALAL 4NJ9H 4YIQB 2DB8A 4RCAA 2FX8L 4JB9H 2X2YA 3MTRA 5DHVH 2YBRA 5KJ7E 5IOPA 1CL7L 5MEPB 1B4LA 2J57A 2MRYA 3MLTB 3T4YB 1TTUA 1DQLL 4RGND 1N26A 2QR0A 5LLIC 1KLFA 4KC3B 3L3KA 5DD6A 2YUXA 5IEHB 1KFAH 4WQOA 4CMHB 3VXOB 1LNUA 4Q6IB 5I1GL 3MZGB 4GG8B 4EOWH 3V4VB 1KTLA 1FPTL 1NGQH 4P23C 4WEBL 4BIKA 2HT4C 3KPOB 3D09A 1GH7A 2P45B 3CSTA 3ILEA 4P2QB 5FHBL 1FJOA 2ZCHH 4V1DE 1ADQA 1NSNH 1WA2X 2Y22A 4L4VE 2X4NA 4G7YL 1QSFE 3RFRA 2EDMA 2LHAA 4YJZL 1N64L 3QDMA 1WS8A 1I9JL 4QYOA 5D5ME 1CDJA 4Q9QH 2ORBH 4N0YL 2CDFB 3ZSTA 2DQFA 4FFYL 4KK5C 5KVDL 5E8NA 1KIUA 3IDNA 1IAMA 2Z34A 4IHBA 3I3EA 3BN9C 5JHLH 3F7KA 2OMTB 5F7WC 2R2HB 1BM3H 4YPJA 5K5YA 1WFUA 5AFAA 3S3BB 2ZWLT 5E1GA 5SWQA 1HEHC 1N0XH 4Y9CA 5DMJB 5T1MB 3QIBA 4XPGL 1ADWA 2NW2A 3JWOL 4NPJA 3VB9A 4N8VG 4X6DE 3VRJB 4K7PH 1N68A 3PAZA 4G5ZL 1BGXL 3ZKSD 3LKNB 1OCZB 4KK9D 3MODH 5GS2H 5D4QA 1N2RB 4QXUH 1XGRA 3MR9B 2OS7A 1MREH 4L4VA 1KIRA 1BG9A 4AQ8C 4H88H 4QNPF 4UOQA 1ED3B 5ICUA 1S9YB 4GB9A 1T1WB 4KK6C 3EH2A 3R8QA 3WG7B 5E4OA 4Q0XH 2DKMA 2IBGA 2L7UA 4AIEA 5F7HA 4JKMA 1MCHA 4WU7B 4P4KC 5EMYA 4HWBA 1UGNA 1OARL 2E46A 2IPTL 1J1OL 2CO1A 3T74A 3NK3A 5CP7B 3WY1A 1MZYA 3ISRA 5HDBE 1NFDE 3BP7B 3STBA 1E9OB 3UYRH 4MDJB 3QYNA 1KXTB 2XIBA 1U8MA 4LCWD 3AABA 1DQQB 2V2TA 5KANG 4KUZL 2XTJD 3L3OB 3EJQA 3Q8AA 3L3DA 1E3ZA 4UT6H 2EO7A 2OX5A 5ESQB 2X12A 3BXNA 1FVCB 3SKMB 1GJUA 2GUYA 3L3OA 1G4RA 2A5UA 3FCSA 5TH2A 4DK6A 3HCVA 4L9LA 1RD6A 1ZLEA 2B0SH 3CK0H 4NQCB 4JPWL 1DN0B 1ZJAA 4JVUA 5DF0A 1KGYE 4KI1A 5IHUL 5CZVH 3B4NA 3HB3B 3TO4D 2A73B 1UYWL 4TUJA 4RBPH 4AC2A 5FDYA 4PJIF 5GGTL 5JLZA 3TYFB 4Z7QF 2Q20A 2PP9A 3BW9A 5E2UH 4E9TA 1D5IL 4HKXB 1DFXA 1AXSA 2ICES 1YNTA 3CVDA 3BGFC 3HS0C 1T2JA 1VRSA 4DCQA 1ZVSA 3TEUA 4K7FB 3TOPA 2HFEB 1BQUA 4K3EL 4L4VB 3GS4A 4HJGA 5D7IE 5FGBC 2AEIT 3BEWB 2AP2A 2P24B 3RGVD 1HCFX 3IFLL 1RU9H 3DHJA 3G08B 2OYKA 3Q2LA 3BGMB 3LS5L 2DYPA 1FDLL 1QKZH 4YSTA 5BUPA 3BRFA 2A1WL 2A83B 3QNYA 4FQCL 1LO5B 3I84A 1KCUL 1X44A 2X2JA 3V4PH 5CCKL 1FVDA 1CFNB 4HQQL 4YHNA 4TSCL 1L7TH 4I0PA 1S9XB 1B9ZA 3TEWA 4XCFH 1B3JA 4WHTB 4F33B 4PD4J 1D9KD 4MB4A 4EXKA 3CFTA 4OAWB 3QJHB 2WBJC 4UYPA 1A7PH 2RHEA 3ZDYB 3BXNB 3H3PL 4A1RA 4XI5D 1FNEA 4KQ4H 1R46A 4AG4H 3SGKA 2ZZUT 1XT5A 4HWUA 5DUPL 4XBPA 2IFGA 4FQ2H 1BD2E 1AGCB 1WAAF 1XSOA 1X7QB 1QFWL 5HHXH 2EUWA 3GSRB 5F8RC 3CHQA 5CXPA 3RBGA 3M45A 5LO7A 2CGRH 5H37H 3RWGB 2BX5A 1KTLB 4GEIA 3KLAA 4BFOA 1B88A 3EOBB 3QEUB 3TF7C 4LDLB 5E4AA 3C5SB 3L3KB 2XWCA 1T5WA 2ATKB 3APMA 2WN2A 4N8VA 3CE1A 2RIKA 1ACXA 4NN7C 1ED3A 2ZXAA 4MMXC 3VH8B 4N9OB 4EBQL 1JZGA 4YHZL 1TQUA 4OQ1A 3HR5B 2VDLH 3UJTH 4HEMA 5D7JC 1I7ZA 4QRBA 5HJ3B 3D9AL 1LNDE 5EU7C 1NBZB 1RQ5A 4HIHA 25C8H 4QGTA 4RESB 5FGCE 2HYMA 5HI4D 1P5UC 1DP0A 3CMOH 3SE8L 3ZKMD 4FFVC 3EFDH 4PJGA 3NDZE 5JHDB 5DMGC 4Y1TA 3FB5B 5IG7A 2ADGB 1MXGA 5FFLA 1QWUA 4JM0A 5I30H 4IRSC 3ZK0A 2AJXH 4W9GC 5EUOF 5H37G 2A73A 1ORSA 4BQ9A 2SEBA 3MNVA 4LHUG 4YDZA 1FV1A 4G9DB 1RAMA 2TSAA 5TJWK 1GXWA 1NOFA 3CC5A 3EFFA 4IK7A 4JREB 4NQCA 4B7LA 1F97A 5HVHB 4WI6A 4HBCL 4KWUA 3TX4A 1BFOA 1EAQA 2CA4A 5I6XC 5FXNA 1J0IA 3K2UH 2XQYA 1Y6MR 1TU2A 2A77L 3MRJB 5I5JA 1FGNH 3N85H 1MY7A 1T7XA 4IBWA 1I3VA 4LLMA 3QFJD 4LSVH 5CBAB 5CD5D 3P4OB 5TQ0H 3IGLA 5E6IC 4TLIA 2AJSL 3ECUA 1WFIA 1RVFH 3PHOB 1QATA 3MLVH 2AW2A 4BK8A 2WBJB 2WAQA 2WXHA 3G3LA 5D7SL 1VACB 1YYCA 4Y1AD 4A2MA 4CU8A 5I16B 1P7QA 2C3HA 2B4CH 4Z7WE 4CBPA 2CRYA 4OGQC 2GITB 1FRGH 3QNYB 1RKRA 2I9LA 2FHBA 3CLWA 1P1ZB 4U33A 3C09C 4PWFA 1XO8A 5J1AB 1V8HA 2W9DL 1MCRA 4HIQA 5GISL 3UG3A 2D7MA 5SWSE 3U4KA 5FO7B 4AVIA 1O6TA 2J6EL 4JY4B 3GM0A 4GQRA 2ZXCA 5T33H 5CEYB 2W95A 1S7WA 1VGKB 5LXGH 1F6AB 2J56A 3RB7A 4QRFA 5KS9E 3MUJA 4GT0A 1XB6A 2NW2B 4YE0A 5IIEA 4B41A 3W0WD 3IK2A 4P49A 3DVNA 3B9KA 2UWEF 5BZZA 4N25A 1CDGA 1MI5A 5DUPH 1JDAA 2YAEA 3PU7A 4G7QB 4NQDA 4QRRA 3NH7H 2ITEA 1E6JL 2BWIA 2BS8A 1O9ZA 2COVD 4QXVA 1IZKA 2IAMA 3T87A 2VSDA 1KL6A 3HNSH 3L2NA 1Y0LA 4O02L 4IKLA 4QF1B 3DX6A 2BSTA 3NP3A 4AVHA 5I76A 2OMWA 4M8RA 4G83A 1OIOA 4P99A 3OKMA 3RRQA 4HIIA 4LL1A 3QWNA 4Y5YC 4NFCA 3RGHA 3H0TA 2QPFA 2W92A 4PV9A 1PZBA 1TNNA 1T0OA 1ZY9A 3H7LA 3Q5OA 3VDBA 2K6YA 1VGEL 5F6IC 1T2QL 4NQDD 3AGVA 1FZKA 4JRFA 1A1NB 1PJ9A 3MHZA 2MNUA 3GMMB 3BZDA 4Y4HA 3S36L 3CNKA 1FL6A 1RZJL 3AQZA 3G9AB 2Z1PA 2HTKC 1OAUL 4IRSB 4FQQA 2ZJSL 4ORZC 3G04A 2EIDA 1EZMA 4POUB 4R9HA 3F7QA 3FB7A 2OW7A 4MXQC 1FNGA 1HU8A 2NXZB 2VWEC 2XY1A 2AMGA 3ZKQD 2WLMA 3D0LB 4PJ8D 3EYOA 1U8LB 2KLSA 3G6JE 2QGBA 4MWFA 4XCCH 3SYOA 1N5YL 3W5MA 1YC7A 5BS0A 4ENEC 4PGJA 1WWCA 4PGEA 2GY7B 4AIOA 2DAVA 1NPUA 3ILDA 4U6YA 4XC1H 1SHMA 1E28B 4QUOA 4BFKA 1VFAB 2X4OB 3ZT6A 1RERA 3L9EA 3OGOE 1OD7A 4HCGA 4MJHA 2OI9B 5E9DA 5T3ZH 4DUWA 5JIIA 1DQTA 2CXKA 1UENA 1OP5K 3FXIC 1CXLA 1U8HA 4EZJA 4MAYD 2VLRA 1OSZB 4BRVA 4YXHH 4C56E 4WU5B 4IDLA 4DO4A 1JF1A 4Y8DC 3WY4A 5T5FA 4ZW5A 1BAFL 4JZOB 2ADGA 1ZPUA 5GZOC 4G70B 4ZDHB 4HUCA 2UXVA 4ONFL 3CHOA 3QIWB 4N3TA 4UQ3B 4YSSA 2P44B 3NSCA 4TN9A 4ADIA 4MCYB 4XPTH 2HT4D 4FG0A 1UATA 2J43A 4MCNA 4RFOL 3V4UH 2CR6A 3U82B 1G7HA 5E5MA 4JCMA 4ICWA 4M4PA 3CFCL 4PIRF 3X12A 2ZX5A 4DFIA 3ZR5A 3I6KA 2CCVA 3BKCH 3FSZA 5FV1L 5C3LD 1WSST 1SLWA 3QEGH 3VFRB 3EOBA 3PY9A 1C12A 1TJHH 2G2PA 3C8KB 4XMZA 2AKRB 3DJ9A 3OKKA 4U1SA 5GGQL 1U8KA 4X8XA 1AC6A 5FKPA 3VXSB 3LQMA 6TLIA 1PAMA 4PVNA 5EUKA 2DQJL 3BPCA 4TL5A 5EU3B 2BZDA 3LIZL 2BSRB 3TTSA 1SVBA 1IGML 3E6FB 1AGEB 4G8FB 3TESA 2YRPA 3UZQA 3ORJA 4UAHA 4QKXB 3GRBA 4RMWA 5KAQF 4L4TE 1AXTL 3S96B 5EOTA 4MDJA 1HT6A 4UNIA 3IMRA 4QYAA 1XZWA 4HPYL 5HHOB 4AR8A 4QAMB 5DYOB 4APXB 5KSBA 2EYRB 1VZIA 4PBVC 2UZPA 4LOVA 1N7ML 1YPZF 2HFFA 2ZQKA 1FIGL 3RX7A 2G4ZA 4I2XA 1XTMA 4ZFOA 2NY3D 3NDYE 3S4SA 2WN3A 5C0EB 4KK6D 1TZ8A 1A7RH 2RALA 2ZKHH 3A22A 2EVHA 3G5ZB 4I0PD 4CW1B 1M56B 3P30L 3UTTD 4JFTA 3L3HA 5IQNA 4LLVA 4ATTA 2X6CA 1V3MA 2IMNA 4AMXA 3OR6A 5HYSA 5D55A 2TLIA 3VE0B 4PJEA 1F90H 2CH8A 2P5WE 1L6XA 3VXTA 2DYPD 1QUNB 4HJGB 5I2IB 4ZX4A 1KJMB 4OCWL 4Z3TA 1U8QB 1H3WM 4L4JA 4M56A 1NL0L 3WLWD 4D0DA 4EO5A 5KBKA 2XTJC 3A0OA 1T0MB 4KKZA 1KXVC 1KEML 2DW5A 3WYRA 1P1ZA 3MSPA 4F8PA 5MENE 4DEUA 4QTFA 1LEIA 3NAAL 1B0GB 1IM9D 4GKSA 4DN3L 1E5ZA 1JDDA 4LVOB 2CR3A 3AS3A 2E4FA 3QZWA 4OUUB 1BF8A 5CS7A 3KNBA 5L9DL 5T33L 1RIVH 1U36A 3O4LE 3T4AA 4APQB 3BH9A 3D05A 5TE4H 2CALA 1OAQL 1KROA 2FLBT 4ZFZA 4WTZA 4ZW8A 5A6MA 5EO0B 5JXAH 3NZHH 3EJYC 2VLME 4UBDD 1A7OL 2DD8H 4M7LH 2EIBA 2KZ1B 3V7AE 3ZTDC 4C83B 3O81A 3T9WA 1NJ9A 3B3BA 4L8SB 4YFDB 3FL7A 4U1IB 4B9GA 4OSUH 4JFYB 4NWTH 3O11B 4EDWL 4O02B 3II1A 4KJYB 5B1BB 3CDGA 4OZIE 2LFGA 3O2VL 2ZXBA 3B1TA 5I1DB 3HBGA 1BF2A 4MZNE 3ES6B 3FYEB 3HNTH 4E9LA 1C08A 3NCMA 4KTDH 4JANB 2QFPA 1FPTH 5FAAA 1PZAA 4XC3L 5IEKB 1Z5LB 4M93C 1X9UA 2OMVB 3FO9B 3FTGA 1DVFA 3PWNB 4LMQE 1TYJA 3ECBA 1IC0A 1NFAA 3ARED 3RKDC 3FV4A 3W11C 1CI3M 2WXGA 1AHMA 1CCZA 2RR3A 4OF0A 4V33A 4XMKH 1U3HD 2E8ZA 5CCHE 2YQ2A 3DO0A 2J6WA 2MPAH 3K8KA 4OY9A 3N0AA 5ABZA 2D31B 3FB6A 1QI5A 1E9PB 1F45A 2DLHA 4JHWL 3IU4L 2FSDA 4UTBH 5JHMA 2X1PA 4Z7UB 1ZT4A 5B7EA 2I5YH 2VABA 3TVMC 5M7QA 4YHZH 3AG4B 2ZCZA 3SHSA 4I1RA 4WV1A 5DJYB 1KGCD 1S7UA 5LVEA 5EF0A 4B5ZA 3BVTA 1FVCA 3MRKB 3OV6A 4LEEA 4N5UA 3SKMA 3VUAA 1Q0XH 2IDUA 3G5YA 3MLYH 1SDDA 2CJUL 3D0AA 1G0XA 1WPCA 2P5ED 4X6CA 2Y3AA 3VU2A 3F5WA 4A6YB 3HMWH 1LK3H 2OV0A 3H8NA 5GGRB 4GP8B 2VDRH 1DO6A 4NBZB 4ABVA 2VDKB 4GAFB 4AQEB 4FFVD 4KVCL 4YZFE 1CDBA 3TH4T 4LSVL 4MCZB 2GKIA 2NMSA 3GMQB 3MRHA 2X1XR 1S9YA 4ONGH 1U8IB 4GO6B 4NC1C 1A4BA 5DHVB 3QQXA 4PW4A 3SEPA 4LIQL 3S3JA 3K0WA 5SX4H 2YXFA 1OANA 3JV4A 5J56B 2XPGB 3KHOA 2D03H 3V4PB 2ITDA 5DJZA 5DK2B 5AW3B 2KKQA 3ZTNH 4PGCB 4ZFFA 1W0VA 2X2HA 4W9KC 5IFAH 3GEFA 2QHRL 4JE4B 1DVZA 5F7EH 3CMOL 3NSFA 1FSKB 1QBLL 4Z95H 1HHKA 3CSPA 4QD2E 4A6YH 5FB8B 1I7TB 2Y2YA 2D03L 1I1CA 1PE5A 3DV4A 1TQBB 3MRNB 3MLZH 3TGXA 4J4PA 3FT2A 3GYRA 3QFJE 4G11A 1C5DA 1FN4A 2FH6A 3HMXH 3M17B 4KFZC 5FECA 5L8LB 4L3CA 1XCXA 3I2CH 2IQAA 3NZ8A 3Q13A 4L8DA 2FX7L 4L3EB 4PPTA 4ATWA 2WGNB 1D5IH 3P7RE 1WAEA 2GBVA 2PNDA 3NABL 4UIMA 1F56A 2EE2A 3L13A 4BH7A 2V4LA 5IJDC 2EDLA 5CP7A 2EEAA 3Q43A 1MWAB 2E76C 3ZDZB 1E9QB 2ISDA 5K59E 4HGWA 3LRSB 3SE4A 2HMIC 4MS6A 1JK9A 3V9EA 3D0VB 4RVBA 2YGVA 3MA7B 4I85A 4GKOA 4Z7UE 1MQ8A 4IU3B 2AJYH 4ONHA 1B4JL 2E3VA 3AS2A 1UD8A 2GJ6E 3DYOA 3I75B 2Y9RT 2Y4SA 3CVCA 4V11A 1A6ZB 3LQAH 4RMUA 4QHUB 3CFIC 3BEVA 4U0RB 4U2YA 1IGCL 4F15B 1A7BA 4RRPM 4XCFL 2P80A 4X4YA 4TULH 1GTNA 3N1QC 5DEFB 1XL4A 1ZTXE 5KN5B 3GK8L 4Y5XA 2QV2A 3AC0A 3MRFB 4LU5L 5E7BA 2NR6A 3ARGD 1M1SA 43CAA 2P1YA 2P8PA 2EADA 5CNHA 1FNSH 3VAEA 3M7FB 4LMQI 2YOAA 3JVFC 4L8DB 4CL7A 3IFLH 2NY7H 3IDJA 5C2BH 3Q05A 5IUSA 3MO1A 4Y5YB 3O0RH 3HPJA 2OCCB 3RPIB 3HFML 3HUJB 4UINH 5HYQA 4Z9KB 2DLGA 4P46B 2IPUK 1K72A 3MRMB 3QDAA 4XNQA 4NAJA 2RQ8A 3JWDH 3MA9L 1W0WB 3R4RA 5ECGA 4KJPD 5CIPH 5BZWA 1FLRH 2WJ5A 4H5SB 2C9QA 3N40F 4TS6A 4DPRA 3R7QA 2BVQA 2PO6A 3OPZL 1J5DA 1IQDB 5CZVL 3LPOA 4QNPE 5HY9B 1TXKA 2EEDA 3QCVL 3ZXAC 4N28A 5C0BB 5IB4A 4CU6A 1KDJA 4IRJD 4PJ8C 3IRZA 2H26A 4FQLH 4HT1L 1J5OH 1MRDL 4BFIB 1DVXA 4G59C 2X70A 4DNLA 5I0DA 3OPZH 3HNVH 1EANA 4RGOL 1FLRL 3QISA 2IANB 4KDTA 1A9BB 1JCVA 2AK4B 2X9ZA 3Q1SH 4YHIA 3MA9H 3W1ZA 3GUTA 3QCUH 5IWLC 1I9EA 1FQ9C 1ZA6B 2CKBH 5T1LA 4HKJA 5DHEA 2R27A 3OD3A 2AK4D 2DLTA 2ZOWA 4RRPG 3WN5C 4PJBA 2EXYC 4FE9A 5FYLL 3V55A 2ZKYA 1XGQB 4FHJA 4LGPB 3A6BL 4HLZH 4PJIE 1SQMA 3VGGA 1KACB 2GJZB 2V2WA 1OSPH 5D93C 4NJ9L 1NTDA 3FFCE 4Q6KA 4Q9RH 4BELD 4L8BB 3X1FA 3QH1A 4KRLB 4TVPD 5B4MC 3WENA 1NFDA 5IB1A 4CC0A 2FR4B 1DO5A 4LSPH 1FHGA 5SWZE 2WINA 3BZFA 2NT1A 2QV4A 1Z3RA 1PZ5A 1TEFA 4ZMVA 4MKTA 6CGTA 1YEEH 1AQKH 1QASA 1BVLB 1RXLA 4XPFH 1PSKH 4PCYA 5E70A 3KH4A 3SJVB 1E5CA 2TSBA 4O51B 4AX3A 3O3EA 1UB6A 4HJIA 4HIEB 2HX7A 3TIDB 4Q9QL 5GRVK 4TVUA 5FM4A 1OM3H 3SJVD 1A4AA 2WXPA 4LEOB 3OMAB 3VW3H 3HE6A 4PRNB 3L3HB 4Z3GA 2QELA 1G5GA 5E0QA 5JDSB 1M2OA 1XH3B 1GGBL 3EUDA 4MQSB 5C0EA 4LT7A 3SKNB 2P5EA 3CZNA 5F8QC 1MELA 5ETUA 3O11A 5ITBH 1QFOA 5ALBL 4XMUA 3F01A 1TETH 3CFBA 4U1MB 3BQUB 4GAGH 1CDHA 3D69B 5SWZA 2HT3D 5HI5D 3MLUL 4L2YA 4B9KC 5BVPH 5JPNC 3UPAA 1WAAE 3H56A 4GRLD 4Y2DC 5DFTA 2IH8A 3EO1A 5HDBF 2P46B 1FP5A 2IBZY 3IU3B 2BK8A 4TQHA 2WNGA 1CBJA 2GJZA 2PTTA 3IVKA 3CVIL 2KH2B 2NY6C 4PJ5A 4YL4A 1MFBH 1V55B 2VITB 2WK2A 2J1KA 1CVRA 2J5LB 3JTSB 3SY0B 3C2AH 1BMZA 3MCLH 3ZTNL 3KVPA 4IBYA 3VSQA 5JSSE 1X5LA 3QXVA 4UT9H 3QG7H 2X4UA 1OSYA 2VLJE 3I50H 2BXYA 3WAKA 5E6IB 2YKLH 5C0RH 3GSOA 3QIUA 4LBEB 4JGUA 2M2DA 1TEYA 4LRNH 4ZFFB 5JO5A 5DGQA 4Z7QE 4HDIA 1Z9PA 4LPUA 3BPLC 3FH5A 1G9EA 2VWEE 1WA0X 3IXAA 4WFHE 3BVNB 2CSPA 3L4WA 4TTGA 1G7HB 3B7UX 5FUOL 2BXZA 3S35L 5JPMB 2F2HA 1L0PA 4NZTL 3BGAA 3BFWA 3FQWA 4CMMA 3C09B 4QHNB 4I1PA 1CR9H 4UB0L 2NNAA 3WN5B 4WZ9A 5EF2A 1MFUA 2NX5D 3TBTA 3FOMA 2X7LA 1QRKA 4HSAC 3GJFK 1DBBH 4JPVL 1HSBB 5E6YA 4WWOA 1G0DA 4HOMA 4ZO6A 5KVGE 3TN0A 1H0DB 4PTTA 5INCB 3UTZA 1EERB 4PRPD 4UBDC 1I9IH 4KI5C 2VDOB 3KEHA 4XXCC 1KB5L 1MCKA 1YNKL 4MLSA 2FBJL 2C26A 3Q9QA 3AXLA 3E3QC 4HF5L 3PYCA 4NKOA 1FJ1B 2AI0L 1N59A 2ARWA 4K94H 1J9TA 4ZS6C 1QWNA 2BH0A 5EEXA 3QPXH 2DMGA 3IE4A 3DK2A 5B3SB 1IQWL 2Z92B 1JYNA 2ZJSH 1NGPH 3MRLB 4QRPA 2XFXA 1PL3A 4E9XA 2AXWA 3D4CA 1Q9KA 1PKQB 1CFSB 1GIGL 5JYMA 1T80A 3AFLA 1CC3A 3UX9B 4DEWA 1I1AD 3L4UA 1ACYL 2LLLA 3VFPA 4LIQH 2B8OT 3UO1H 5ESVA 1NKOA 4HALA 2HKFL 3GJEA 1JCKA 1CVSC 5JOFA 3ZLQC 3WSQL 1E4KA 3JXAA 4NRYA 5IB5B 3MV01 1XH3A 3HG0A 4NHCH 1JHKH 1C16B 4GBXC 1EGJH 1JPFA 5D1XE 3R8BB 2DWEA 2OPCA 4D9LL 3T8DA 4PH8A 2H41A 5EORL 3V6OC 4OZHE 2WQAA 2PW2B 4GKNA 2H32B 3LQAL 4NDMA 4AQEA 3D85B 4YOKA 1W15A 3VI3B 4PRIE 3FMGH 1W72B 2Z64C 3WXVL 2ESVB 2R4RH 5EUOE 3VMNA 5IFHL 2WXIA 2XWTB 3I9GL 4AEFA 4BZ2A 3ARFA 4XOEA 4L1LA 3ZKMC 1DQVA 15C8L 2AVFA 2E7CA 3QNXB 3WGVB 4ESKA 5E5RB 4AQ1C 2F19L 4PB9L 1AMYA 1KLUA 5K93A 3VGAC 2FRGP 1F4HA 2C4FU 2P48B 3DUHA 4DQOL 4AKQA 2CKBA 3KLDA 2ZSVB 3BWAB 4WY7H 4EKXA 1F4YL 9PCYA 3MV9D 5KS9A 3HC0A 3FBOA 1MI5B 3BPLB 1X5XA 1TTBA 5FYJH 3L9YA 4ZFGH 5HVWA 1OPOA 5IJKC 5MI0C 1Z66A 4MX7A 3THMH 3U9WA 4D3CL 1S4IA 2CZNA 1OTUD 3OKEB 4JY5L 3FO0H 4PWIA 4NT6B 3VXRB 2H9GA 3WE1A 4FXKB 4PGDA 5KANI 3IMSA 3CVBA 3NIFF 1QBLH 3E3QE 4Z95L 2Z0UA 3ROOA 1RUMH 1Y6KR 5T1KA 5E5MB 4AITA 3KPLA 1AGFB 4EVNB 3MFFB 4HLJA 3ZI6A 1G7JA 1OM9A 4ERSL 4N3UA 4KKRA 4N0UB 3SSBA 3OAUH 1EJ6A 4HWNA 5F3HA 1S8DA 3UTSA 4I3SH 3UPRA 2D7NA 3CSBA 2ODIA 1B90A 1M71B 3GMQA 3LKRA 3MRHB 5GS1B 2ATAA 2XKUA 3MBXL 2E8YA 4PY7B 2ZWZA 3OVUB 4K71B 1VFBA 2E7LC 2JJSC 4ZUWA 4UM8B 2FEDD 2OM5A 3GS7A 3X14B 2EYRA 3OMIB 1EVUA 3FRPG 4UNUA 2DS4A 5TE4L 4YSOA 4JFVA 4OD3H 4ZNEA 1B2YA 2CUAA 2OZ4A 5J6HB 1Q9OA 3G5YB 3AJ7A 4POZD 4BV1A 1O6SA 5FO8B 2EVFA 4TRPH 3HVDA 4OJYA 3LHAA 4PCTA 3SDYL 3ZE2B 2FHFA 1J8SA 2E7HA 2XXGA 4WV1B 1HX0A 4ZRGA 2IOIA 4OGAD 5DJXA 4XPHH 5DJ2B 1WFOA 4BKLA 5L4JA 2I7OA 5IJCC 1NEZA 2WUCL 3LIUA 4G9DA 4L1HA 2WZPD 2H5UA 3RIAK 3UZVB 1TVBB 4XBMA 3BVXA 4W4NA 3W57A 3B2DC 3VFRA 4AE1A 3KPMA 3SKJH 2WCGA 2CJ3A 3GBNL 4OJAA 1SGKA 4HLEA 3CQPA 1P7QD 4ZUUA 4DKDC 3P3TA 5HJ3A 3EOAB 3X1BA 4AQAA 1DEDA 3T8FA 1IM3D 1QLFA 4M7ZC 4XCEA 4X6CE 4I0CC 4KKCD 1JGEA 3GGWA 1FL5A 2NRDA 3ATAA 4P5KA 4KQ4L 1RP8A 1ZS8B 3LQZA 3MA7A 2XOTA 2CO2A 5CR1A 5KAQG 3T0BA 2GQHA 2ZUUA 2YPVL 2B9BA 2XN2A 5FOBA 2IANE 1NLDL 1NDMA 3F58H 5EIQA 5AVZB 4AL8H 1XVSA 5HHME 1IGYB 4IIQA 5JIKA 4TSBL 4OIBA 3EYSL 4AR1A 2I25N 4POYA 3INOA 4K8RD 3BKMH 4N8CH 4AWJC 2XKSA 1FNEB 1MW1A 2KYIA 4K9EL 1NUFA 3FTYA 2H8PA 1COBA 4BM7A 5B39A 2XTSA 1MVUB 3FFDB 2FHCA 1YCSA 2K8QA 2W60B 3CFJA 4X2UA 3DI2B 4XVTL 5DR5H 1AO7A 1E5BA 4AH2A 3W39A 5TLNA 4AKPA 4P5SA 1XEDA 1LNBE 4EKJA 2NXZD 3NCCB 2I07B 3OKYA 4YDLB 1E8YA 3ROLB 3U25A 3TA3A 5L0QC 4YSPA 2H1PL 3FQNB 5DZOA 4OCYH 2VLKB 4Z3IA 2JXMA 4NZFA 3RVWD 4J8RA 1FIEA 4MRCA 2VYRE 5T5NG 5I8OH 2XV2A 1ET7A 1XXDC 4HJJL 4YR6B 4FHKA 2Y7NA 2WY3B 4IKIA 5DD0L 2AJUH 2WVTA 2W0KA 1SXCA 4TMPA 3HI6H 4P5TD 1IX2A 2HT2D 4H1LB 3ZTEA 2MNJB 1HKLL 2HFGH 1W8NA 1JTTA 2FNWA 1HNYA 3BH4A 1YPZA 3WDJA 3ULVC 1TO4A 2ZOKB 3UGEA 2YEQA 3GDBA 2FK9A 5GZOD 5J7CC 1WFNA 5FW8A 2FO8A 5CSGA 3RILA 1Z32X 3VXUB 1A02N 4HETA 4XTRC 2GJ6A 2EINB 4MS8C 1IGCH 3QH3B 7TLNA 3LXUX 4DVRL 4RFNC 1NBVL 1YUHB 3J07A 4X6BB 2HXAA 3O3UN 1DCEA 2Y5TB 1F5WA 4NQCD 1ZGLM 4L3CB 4WWKB 2V37A 1RZIA 2YAFA 4X6BA 4JFED 1N5YH 4NKDB 1KMGA 2DBLL 4OZIF 3UP6A 2MIZA 3MBWA 4D9RE 1MREL 3O6LH 4MA8L 4MMXB 2J8UB 2FEEL 3M88A 3FOLA 3OKKB 3QDJD 3RVXC 1GGCL 1BGXH 2ZXGA 4WUKH 4XNDA 3BJ91 3EDJA 4KZEH 4DTGH 3V4VH 4E9RA 4GUPB 4PJDA 2B77A 1G9NH 1TJHL 1H5BA 1HK6A 3SPCA 1HS6A 3WL9A 4IGBA 5FV2A 4FC3E 1A47A 3RL2B 3LZFL 2IH1A 2EVIA 2EXWC 3TMNE 3SO3B 3WEAA 4M7JH 2GG1A 1IGTB 1VKXA 1UCTA 3MZTA 5FF6A 4P3DB 4LAQL 2F5AL 1LO2L 2F8IA 5TDOA 3LAFA 3GLAA 2WIMA 3H3KA 4D7PA 3CX2A 3V5HB 3OX8A 5AVSB 4BUGA 4UDTB 5C86A 5L8KB 3RWHB 1R33A 4Z78B 3AVEA 2YLHA 3RDTA 3T0EC 4R96A 3VGAB 4FLSA 4WCYH 4GAYA 1X5GA 3FGDA 1QA9B 2LGNA 4FLRA 4EOWL 4HIIB 3CHPA 1GC1L 3MX0B 4JQVA 2AS5M 5BO1H 1L9RA 3BHBB 1LYQA 4BUHA 3RVVC 4QF1A 3RFZB 3U4EA 1OGAB 1WDAA 3BSZH 1WVZA 4LVEA 1Q8MA 2GVYA 4ACPA 2Y25A 2VMDA 1NM4A 4XVOA 3A4FA 1KC5H 3P0VL 5F3FA 2N7SA 4KFMA 5C0ND 2RMNA 3ZDXF 4YQXL 1DBKH 2E6QA 3PABA 4PLJD 4CN4A 1U4EA 5CCJA 3BKJH 3EH3B 1ZT1A 4MD0A 1UUSA 1I9RH 2WCPA 3BIKA 5A7EA 4X4ZA 1SN5A 5IIEB 1BQRA 4UCFA 1P4IL 3RGVA 4HUWB 2K4AA 3C5ZA 3EO9L 4NXKA 2Y07H 1FNLA 3N9GH 3FB7B 2Q3AA 1YMHB 2GC4C 2EIZA 2ZPKH 3EO0B 3U2IA 5MEPA 2YRLA 2NUTA 3FFCD 5TQ2L 1JPEA 1PDKA 4NN5C 1FRGL 5D2NE 3EXJA 5CLYA 4OT1H 2HJKA 4JL2A 3W9EA 4JANA 4ZPTA 4G6FD 1TJGL 5BPPA 1NC2B 3SDXA 1QZNA 1LP9F 5F0MB 5D1QC 4WI0A 3VG0L 2VMJA 4ETQA 2VM9A 1C1EH 5I1DA 3TA3B 4FYQA 3W9DB 5B8CA 5KBMA 5LGJA 3BDBA 1ZHKA 4YVNA 4DP6X 3C5JA 1QYGL 2BVTA 1OQOA 2BCMA 1T7WA 4IKJA 4GP4B 3TWCH 2C7UA 2AANA 5A2LH 3DXAD 1I4FA 5E00B 4NZUH 1P4BL 4I9XA 3FT1A 1GC1H 4KX9A 3GXUB 4QYOB 4KTDL 3JSSA 4L8CA 5I0VA 4B5EA 3CPUA 5MEOB 1CDCA 3DPBA 3AY2A 4JO3H 4WHDA 4TSCH 3OAUL 4KKAC 4WO4D 3V4PL 5EEWA 1IJNA 1F4WL 3BFQG 5LWDE 1E9OA 3VQ2C 4LLAA 3KNBB 4XHQA 3ZKXC 4ERSH 4YNYB 4BH8A 3BZEB 2YWYA 4CGUB 1L7IH 1AKJA 2XWBA 4E41D 4M00A 2R69A 3KH3A 3KYNA 2LT9A 3GMNB 3MREB 1OALA 1KJ2B 2H47C 3F7LA 4ORGB 4TNGA 1UM6H 3NCJH 2EEFA 1A6VH 2VDLL 3MFGB 4L5FE 4J3TA 1DQJB 4PCSA 4PREB 4AYBA 4XMVA 5BW7A 2WKOA 1HNFA 1MHPH 3WIAA 3NCFB 5FF6B 2HVKB 1DHKA 5T1JA 3TNMA 4B9ZA 1IBZA 3B9AA 1JGDA 3UJJH 5FUZH 5DK0B 1KIRB 2XN9D 3OWRA 1PDKB 2MKWA 1WICA 1VHPA 1JNLL 1RZKC 4JFDB 3D08A 1UWXH 4Y9FA 3MFFA 2RH0A 1U6AL 4P9HH 1IFGA 3LPWA 1R0AL 4MGXA 5C0GA 4H1LG 1S7VA 2ADYA 1OB1B 4OT1L 1GAFH 1G9ML 1WTLA 3M07A 1J1PL 4N2IA 5GGVH 4JGNA 2AAAA 2EC8A 4KVPA 4ODXA 4PJFF 3REWA 3TC9A 5FSSA 4WWNA 1YDPB 1BVZA 3FT0A 1UOVA 4LRIC 3WS3A 4X9GA 2JKRM 4IBLT 5AKVA 5JW5B 4CVXA 4M62L 1H3GA 5DEGB 4K5LA 4HJ1A 3S96A 1DQDH 3RURA 3VD7A 5FYJD 1IE5A 1SDAB 3HN8A 2QGEA 1BJ8A 2EH7L 3LJ3A 1A1OA 4YQXH 4X9FA 4ZS7H 1BOGA 3IDMA 3TM6A 2H0PA 3MCKB 5E8DH 2C9PA 3UZQB 3VSTA 1Q9OB 4ECNA 3QNXA 3VXRE 2OQJA 5EA0H 1PJWA 4JM4L 3S3CB 2DWDA 1OF2B 3EFFB 4TNFA 1QLEB 5LBGA 1VF5C 5H8DA 4YMPA 4HV8A 5GSRA 4CVZA 1A7QH 1NAML 1FGVH 2VRAA 4HC1H 4ZMAT 1CDYA 4L4TB 1GZPB 1Y6NR 8FABA 3RLSA 1ASOA 2QPEB 4KKPA 3G5WA 1Q72L 4K2UL 2GT9A 3II2A 5IEHA 3PWJB 1XH0A 1KTJA 3FO1A 3WO4B 4FQPA 1ILSA 2WWKO 3B37A 4P48A 4QRTA 4JKKA 3OKDA 3TEXA 4KKNA 1V54B 2BINA 2WWKT 3EFDL 3L54A 4DH2A 1N0XL 1BM7A 3IDIA 5KVGL 1IAOB 5FIEA 3N44B 3DUSA 4ZUUB 2OTWA 3D25A 1DDTA 4N8VB 1OGTB 5DVLA 4Y4FC 1B0IA 4PS4L 5KSVB 1KB5H 4YDVB 5KYYA 5HI3C 3GZKA 2YMOA 1UZ6E 4KK5D 1D5ZB 3VXRD 3CQQA 5A6LA 1CS6A 4LCUB 5D2LA 5D6CA 1PG7H 4PV9B 5IQMA 1XF5A 5D1XB 1AKJB 5EZOL 1B0RB 5CGMA 4UM9B 1U8HB 1INQA 3BT2H 3SBQA 5J0BA 4FZ8L 1AKJD 4XMWA 5F7DB 1EH9A 2IBZX 3HB3C 5C09D 6PAZA 5K9QI 1MKFA 3N3EA 3P7WE 4WI3A 3X17A 1IC7L 3VA6A 5I1AB 3PAVA 4JO4H 5AL8A 1CR9L 4AEHH 4WO4A 5GZNC 4FFZL 4JRXE 4M4RB 2XUWA 1NANI 1K8IA 2RQEA 2XWZA 1OWWA 1KDIA 3QJHA 2DBLH 2FH8A 2F8XC 4AEEA 1OARH 1KTCA 2IPTH 2Z9TA 5CGBA 4H40A 1ZGLB 2C4FT 1TG8A 2X89A 4DO5A 1BSIA 5J11C 5ISZB 3WXWL 3AQYA 5CGYC 4R8WH 3TT1L 3RWHA 4LRNL 1BQHG 2H32A 4WI0B 1Y18B 3C2SA 4JO4L 4ENZA 1IC7H 3QJRB 2FWOA 5I0ZA 4FHBD 4XC1L 1T5KA 3L7EB 4TVPL 2ZYHA 4TQPA 1YN6B 2VL5A 3BEWA 4XZUA 1E27B 2FJHB 2IIJA 2R0WH 1KZQA 3HUJE 4MB5A 4KK8D 4PV1C 2C1PA 4TUKH 5D6DA 3DO7A 4JHUA 3WNPA 3LEYL 1UZ8A 1O9VA 4KTEL 4OKVB 4QRPE 3QIUB 4M8VA 4PGBA 4CAGA 4YHYC 3MACH 2VXQA 3NIGF 3SD2A 2TRYA 5HHMD 1UJ3B 2F6AA 3K4DA 5TD4A 3GS0A 3B9VA 3PABB 1FI8C 1FO0H 3VFVA 1EAPA 1MHEB 4LSRL 1B2WH 5H37A 4G2AA 1L5GA 2W38A 4X7DC 4JFPA 4UV4H 3RVTD 3WTXA 4GRMA 4GW4A 2PN5A 2GUOA 4R4NC 43C9A 1OF2A 4FNQA 4WUKL 1GYCA 2J73A 2EIJB 3MV8E 4K5PA 1IBYA 2F1EA 4X7FC 1ZCRA 2AQ1A 1IKFL 5C07A 4BKSC 2Y5TA 5BRZB 3SBRA 1BFOB 3PJNA 5DUBB 2K6WA 3U79A 1PKOA 2QADB 35C8L 1B6DA 4Q56A 1SOSA 1QTYT 1U4FA 1SMDA 4M93B 1A4JA 1JVLA 1L0XA 1AZUA 3GHPA 5BZDB 5BMFH 4D0BA 3VNZA 3CN3A 1LNUB 3MUHL 4AJYV 3DARA 1URLA 4IOSA 4LLDA 1A6TA 3GJFB 2Q86B 2NT0A 1HHHA 4S1RH 3CHXA 2H45A 1J1OH 2OTPA 1HQ4A 2GEQA 4PJXF 5DVKA 2VLJA 4JG9A 5GGRY 3FO0L 1TLMA 3KLHD 3CLEL 5D2NC 4U3XA 2NY1C 2QL1A 2A3TA 3W56A 2W0PA 1NPCA 1LK2B 3ARXA 3LRMA 5KYUB 3SYCA 1RIHL 2G3XA 3ZUNC 4QOKA 1H5BB 1XDTT 5I8KL 4XO3A 3HJEA 3JV5A 3E80A 5CINH 1DBML 1TLKA 2BVUA 1FYHB 1NCBL 1IBGL 1EAJA 3U6RA 4QDGA 5F7FA 2W07A 1LWJA 5CN1A 3BD3A 1IUZA 4XX1E 3DETC 3F84A 4P5RA 3V9FA 1JMZA 5DJXB 2VMCA 3AZUA 1IAIM 2KPWA 3GIVB 4LDEB 1QBML 4ZUVA 5TLIA 1UD3A 3WXVH 1J8HE 3TJEH 5JTWA 1UT2A 3MLSL 3BLKA 3I02A 4OD2A 4UUJA 5EEZA 2PABA 2GI0A 4G42B 4FQLL 2JQAA 5SWZB 1FC1A 3QYCA 5KVFH 1KN2H 5AVVB 1JS4A 5GS2D 1SM3L 3KZ8A 2EXWD 3GDCA 4Y7MA 5H94B 3BQUD 2NY6D 1TTAA 3FQ1A 1FVDB 5CZXC 2AXHA 3LVTA 1KJ3H 1YQ2A 3F7RA 2OMZB 4J3OF 2C34A 2X70B 1C9SA 2X0UA 4WI5A 4H2CA 4H1LH 2D2OA 4PJAA 4MCMA 2XQBH 4AYID 1P4BH 4HK3N 3T0ED 3AS1A 4X8CA 4XPBH 1NBYA 4LLQB 4KHTL 4YHKH 5LAPA 4G8IA 4P5TA 4M6NL 1THAA 2CBQA 4HDIB 4K23L 5IBLD 1AE6L 5K9QG 2IG2L 1F0LA 4HZ1A 4L18A 1XR8A 5GRWA 5BXFA 3BJLA 1ODUA 3GSUA 1BBDL 1XF3B 3LKOB 4P46A 1QOKA 3EJUA 2Q7YB 3ZYZA 5E03A 1AY1H 1ZANH 1AI1H 5C2UB 4AH2B 3MGOA 1D2PA 1HHJB 3QULB 4H0GA 5I73B 3DGDA 5GGSA 5EC2B 4IGBD 4WGVB 2F8OA 4B9CA 4G6AD 2OL3L 1EVTC 3AXLB 2JIXB 3WTTA 3C8DA 5F9WC 2W9EL 2BJMH 2CUIA 3UZEA 3BLPX 3CH1A 3ARFB 5FM8A 5FYKL 3O8XB 2APSA 3E1ZA 1F4AA 5LIFE 2EILB 4TRPL 3NZUA 4MZ2A 4WHTA 2QTEA 3EJZD 3IDYB 3UTOA 3VRLF 2ADFH 1Q38A 5I0XA 3IF1A 3SDCA 4AUYA 1RZJC 1A6ZA 5D1QD 3ZDYE 4HCFA 4JFQA 1K5NB 4JFEA 2F74B 2BIIA 3N6YA 3TZVD 3X2QB 1OW0A 3H3PH 4N85A 1PZUB 5F93C 5EZJA 1TF4A 3BPNC 3F2PA 1XF2A 3ETTA 4F9PC 3KYMA 4XP1H 3UABA 3BMWA 2Z91B 3PGFH 4MJ2A 1KGWA 4JKLA 3HZVA 1HZHL 5FCSH 5FA3A 5CJOH 3K0YA 1JPST 2BVEA 1QMUA 2XZCL 4ODHL 1IAIH 4M6AA 3RTQD 5L8JB 3V0GA 3B8SA 4PAZA 4IMKC 1WCBB 3V10A 3HG1B 2CDEA 4QLRA 2WLIB 1WWBX 3O2DA 4LAQH 1UXMA 4QHMB 3KYOB 4F2FA 2WHVA 4K55A 4OM0H 4XVJL 1QBAA 5JOEA 2BY2A 4RLDA 5ACZA 4UU9A 1TQCC 3FB8B 4QRAA 4G6JL 2VITA 5KW9L 3S3SA 1AAJA 2BOCB 5DJ8A 3PGFL 4F7KA 1V5JA 4L29A 4NGHH 4UU9B 2WZPA 5F9JB 1JXGA 5MEQA 4XMTA 4AE0A 4XXWA 2OXGA 2M8XA 3VXQA 1EFXD 1S9WB 5DEZA 5TK4A 4FXGB 5JHDD 5K1VA 3WS6C 2WD0A 4NJAH 2X4NB 5C6PB 2HTKD 1IBFA 2KQNA 1GGCH 4QRSA 2AI0H 4K94L 4IIQB 4JRLA 3OLDA 4ZO7A 3MV7E 5JOPE 4FJYA 2F7RA 5HGAA 15C8H 1ZE3H 2F61A 4S0SD 3VXUA 1QRNE 3BDYL 1X5AA 2WOYA 3QEQA 4YDLC 3P9WB 3SGEI 3FUEA 1P53A 3REVB 4HW6A 2VXVH 1RZ8A 2YAHA 4MD5A 2WLZA 4XAWL 3B7TA 1KKKA 3HHRB 1KYDA 5L88H 1Z9MA 4OFDA 2KDGA 5TF0A 5CJXA 3LKQB 3QORB 3MLYL 1DBBL 4JPVH 4XB3A 1BBJB 4FEMA 2PWHA 4NO5A 3NJNA 4W9LC 1C16A 1YEEL 4UTAA 2O5YH 3BAJA 1KG0A 5KYXB 4QIRA 3B7RL 3LB6D 4JLRA 3F2LA 3Q8CA 4JJHA 5C9KA 4UB0H 3C60B 3BWUC 4KV5F 3B2XA 2R56L 4NFBA 1N2RA 1NGYB 3QUXA 2PYFA 3CCHB 5GRJL 1E4XH 2BSBA 1X3DA 1N18A 4LARL 1RZFL 3MJ9A 2QQLH 4LSSH 1K4DA 3OG4B 2EXTA 4TUOA 1KTDA 3RL1B 4U1JB 3D3VE 1S7TA 1X5HA 4GKZB 3UTTB 5L3UE 3MKKA 4NRZA 4BGLA 2B14A 3QQ3B 3SE3A 5HYEA 3UO8B 1L3NA 3EXLA 4XB8A 4QXUL 1QSEB 3HI1A 4PJ5B 5CGTA 2FEDC 2V7HB 2HN7A 1M9WA 3GI8H 1PVHA 4M9PA 4B52A 3IAPA 4K7PL 3ZDXB 4OF6A 4X80L 2WGXA 5L2JA 3B3IB 2AXGB 3QPXL 1J12A 2BVPA 3BWZA 1F1GA 5HGGS 1MJJA 3H9SA 2CPCA 1PZCA 4PUBH 5HHNB 5DEFA 5F88B 3C6LA 4AGQA 3CVHB 1U93B 1E67A 1HHIB 3ILPB 1Z9SA 1T1XB 1A9BA 4KRPB 4YHIB 5FUCC 4D8OA 3FOMB 2FZ3A 2NSQA 1MCLA 4L37B 2OTUB 2E5EA 3MOBH 4Q2ZA 3VFTB 3LNEA 2ZKMX 5ADOH 2EUVA 3EJSA 5HBBA 3PJLA 1CXEA 3MLSH 4QHNA 4QXGH 4QHPA 3EH1A 4G9FA 3MLTA 5CZRA 1K4CB 3T4YA 5CFAA 4X6CF 5A3ID 1RCYA 4UTCA 3ATBA 1RP9A 2EO9A 1CF1A 3ZYOA 2L4OA 2A9BA 2DLEA 3E8VA 5MHSE 1F8TL 1OP5H 2N4IA 2Y72A 3KWWA 4OM1H 5I8CA 1A3RL 4JBSA 1ET8A 3AY4A 4TNVF 3WEXB 5C6WH 2E47A 3ZGIA 2R1XA 3PL6A 4KKCC 2W94A 2F53E 1VEOA 2XV6B 3AT8A 5CINL 4GUQA 3MROA 1ZE3C 4GW5A 4EJ1C 2D4DA 4F37K 5EEVA 4KROB 5DQDH 3RVUD 1LWHA 3SY0A 3K5SA 4U6XA 4CA4A 4WF7A 2XU9A 5F96L 2CHDA 2R0WL 3GFUA 1G7IA 4HWZA 5SWSD 1T83C 4L3FA 4YGVA 3RZWA 2KL6A 2W07B 1T21B 3QEHB 4JS7A 4FKHA 4PRPE 1U58A 4S1RL 4WWKC 1CURA 5D1ZC 5CIPA 3UDWA 1H8LA 5BXFB 5JIMA 2X4TB 4CJ0A 4HEPG 1XGZA 3R18A 1TMQA 2XSKA 3BQUA 1M3JA 1ZSDA 4V1DD 3WFDL 4WKZA 2Y24A 3ZRSA 1DBAL 3QUXB 5AWNH 5KSAC 1U8QA 3HTLX 3HZVB 2BRRL 2IO5A 1HINL 2NX5E 3OHXA 4DJMA 4XPHL 1HCVA 4PTUA 5E4EC 4WI9A 1F3DJ 4W4OC 5B22A 4OZIA 2ESVE 1EUTA 1PBYA 3BVWA 4WTZG 2A6KA 2DY2A 4G9FB 3D06A 1AR1B 1KCWA 3Q1SL 2F53A 4V2CB 1NC4B 4RQQB 4LCYB 4MCZA 5KSAB 3KWUA 1IBHA 4BFGA 4K5OA 3NJFA 4ZZKA 3FCGA 3CFEB 5AKTA 2D4FA 4ODSL 4JMNA 2FEEI 4F1SA 2WO2B 2OXHB 4MXVF 3MC0A 4LBEA 1GCFA 3D2UA 2H0JA 2WANA 3BZFB 3MBXH 2V2XA 2ZXEB 4UV7H 3CG8A 3V79C 1IC5L 4IKNA 4XNZB 3OG6B 3Q6GH 4IRZA 1L6PA 2Y5EA 1WZMA 2BMKA 4LSTH 5FXCH 2DM3A 1QEXA 1A4KB 1IV8A 4J6RL 3VD2A 3T77A 2XG4A 3Q2NA 1RUML 4GG6B 4NEHB 4N5PE 1C5BH 4ODHH 3U6RB 1SQ2N 1BXUA 1AMXA 1ANUA 1GY2A 2E75C 1XR8B 2O5ZH 4PRAA 4Y5VB 5DURD 3P11L 3LZRA 4M48L 1Z1WA 1CXFA 2YEZB 4NKIH 2K4WA 3UGXA 5KVEH 4JN2A 2EO1A 5DC4B 2VIRB 3WXWH 2XA8H 2J44A 4N0CD 4NOFA 1A7NL 1BD2D 4UQEA 4DHLA 5INDB 2UX7A 5IW6B 3FNKA 1RZFH 4QOKD 3NA9L 2IGFL 3HC4H 3FU0A 5IQ7H 1PD6A 5TMNE 1U0QA 1GMEA 1NMAL 4N8PA 4U6VL 5DMKA 3D07A 3RVXD 4KKBD 4WW2A 3UAAA 1WJ3A 4QRQB 1JK9B 1XGTA 2YA2A 3Q3GB 4ANVA 1TITA 2XI9A 1O7DC 5MENB 1M2VA 5HHOD 1CLZH 1R5WB 5LGHH 4AV0A 3LS7A 1I85C 2OCJA 5KOVC 3FTVA 4ZNCD 4QRUA 5JXEA 3T65B 2E59A 1G6RA 5EORH 1OPGL 4JFFA 2Y69B 5FSJA 1CPUA 5L2JB 4R2GC 3NFPA 5DA0B 3MBEA 5CEZH 5DPFE 3S0PA 5I1AA 3ULUE 4MNHB 2VR7A 2CLZB 3MRKA 3GIVA 5D96B 5EU6D 3IJEA 4J6IA 4I13B 2ODHA 4NYLA 1JN6B 2ID5A 3RAJL 3MCYA 3IDJB 3K1KC 5EU6B 3ABZA 3NJLA 5H2BB 4MWFB 4ODWA 2CIKB 3T2LA 1B0GA 1GGUA 4GKSB 1WCBA 4Z7NB 3FXSA 4P2AA 4MQ7B 3ARDC 2J4WL 1OLLA 1K3IA 5IQLA 1KCBA 1KY6A 4NI6A 4ZAKC 3ZKXB 3T8XB 3RAJH 1XZ0A 1IAOA 2XPGA 2X89D 1I82A 1A7QL 2BC4B 4UZSA 8TLNE 1SEBB 4AL8C 4F92B 1GZQA 1TTGA 3H9ZA 4XZUB 4FFWC 3U0WL 3SDAC 4HKBA 4WDIB 4A7GF 4JM4H 4J3VA 2NY2C 3K6IA 3ZL4L 5CWSA 4XNAA 2J20A 4GPVA 3RUGE 2NQCA 2OMZA 2OMYB 1FZKB 2BLFA 1YYMH 1RZ8B 2F54E 3SDCB 5JPMA 5SWZD 4U4IA 2E9WA 3TV3H 3LX9A 1KB5A 4L1TA 4P2OD 5EHFA 1HHIA 1NGWA 3ILPA 5I28A 1A7OH 3OJDB 3OF6A 2I27N 3L3GB 1J11A 2CO7A 2FE0A 4Y5VA 5IROA 1CTNA 1OKEA 3FO2A 3TZVB 3WHE0 1YEWA 4NZTH 1NCWL 4Q8BA 5GGSB 5CUSL 3HPJB 4XP9L 4DN3H 1FG9C 4P8QA 3QNFA 3MLWH 2FX7H 3AREB 4NNXA 4GQ9L 4M03A 4JZJA 5AVUB 5BS0B 5GXBB 4HOZA 2NSMA 5LB1A 1OP3H 3HMXL 4Z7WA 1I8KB 4HIXH 4FL4C 2X6UA 3TZVC 2ICEC 4PI2A 3OAWA 1UM4H 2QPUA 2CLVB 3HRZA 4OZ4A 4AQ1B 1E5AA 3GKWL 1YDPA 2GSGB 1S6NA 4G6MH 4TUOB 5ECJE 3RL1A 3ZUCA 2X3CA 1RUQL 3GSNA 2Y1VA 2BOBA 3LS4L 3OGCB 4XBGB 3ARGA 4MQXC 4BD4A 1XB8A 2CNZA 4KMTH 2J88L 1T0PB 2UY7B 4FQQB 2LTQC 1A7RL 2ZKHL 3WKQA 5AD0B 1CF8L 3CZFA 2X05A 3IJHB 1H9VA 2WKLA 2JELL 4U1HB 4DK3A 1I8UA 3GM8A 5B7MA 3BPOC 2NLJA 3QC5X 3UBXG 4URKA 4JRWA 4M5ZL 3UTSE 1K5NA 2GJJA 1AP2B 4BQCA 4OCXH 5BVPL 1M6UA 3CFNA 1EHLL 3ELAT 5K9KB 3REVA 3FH7A 3PNRB 2MEJB 5ID1B 3OHXB 2Z93B 4F9LC 3CVHA 5CP3H 1GYWA 2ZNWA 2WB7A 3NCYS 1IZJA 3DOSB 3PHOA 2XNAA 1EJOL 4ZK8A 1KV3A 4G42A 2O30A 3EGDB 3IFPA 1KT2A 2BCKB 4PSRA 4UV4L 4K07A 2KDYA 5KTEH 1AR2A 4QT5A 1C5CL 4BE6A 2ERJB 2G0LA 4GIPD 1B2WL 1ZXKA 3BC9A 3L2LA 4PJHB 1HAWA 25C8L 4LGSB 2E27L 1HHJA 4IRJA 1ND0A 2TMNE 4M7JL 5EU3A 5IVXF 4DKAA 1OWRM 3QZOA 3X1GA 5LNGA 2YFNA 1I7RB 3FB8A 1IEBB 2YD7A 1AQ8A 1XSJA 4EBQH 3WKMH 4JM2F 4J4PD 4H8UA 3IPEA 2KLTA 1UT9A 1CK0H 2Y07L 4XBEL 5CEZD 3TJPA 4C59B 5KYWA 2CG9X 3VACA 3MS3A 3R19A 1N67A 3BKJL 3QORC 4WO0A 4LSUL 3P2DA 4Q9RL 3OXSB 4HWBH 1DZBA 2YAQA 3QDGA 1ESPA 3BMVA 1AGBB 1FF5A 3HZMB 1T1ZA 2HRGA 1CLCA 1JGDB 1M4KA 1AQDA 3NA4A 5DQDL 3FPXA 3UC0H 1ITBB 2JI2A 4UQ3A 4NUGL 1M6OB 1W72L 3D39D 2IXQA 1QFPA 3CLEH 5IROD 1CIUA 3G5ZA 1ZTMA 1OGAE 4CW1A 1NIDA 3CXDL 3FAXA 2O5XL 3KVDD 5BVJB 4E42B 1JVKA 1YZZA 1KCSL 5AZEH 3NOIA 3QC6X 4J3OG 2EDXA 5I16A 1E65A 3QCUL 5ISZA 4GLRI 4HH9B 4QXTA 1A14L 3FFOA 2HKHL 2QSTA 3QZBA 2J8OA 4JEGB 4Y19D 3NT0A 4XZ4A 2DPKA 1ES0A 3HE7C 4PVMA 2Z31A 2Y1YA 1FIGH 1UJ3C 5DRXB 2Y5QA 3RU8L 4AV5A 4XNYL 1VESA 3NJHA 3QSKB 1CUOA 4JPKH 1LQBC 1XGYH 4RSYA 3IJSA 4H8VA 5IMKA 4PHXA 1CMOA 1R24B 4FNRA 4F7PA 4L29B 4PYGA 1XSIA 2JK5B 1UFGA 1OAYH 3HS0B 2PWFA 2XRAH 2IDTA 3FJTA 1L6ZA 4LHUD 2AV7A 1YVLA 4H0LC 5IZ7A 5DO8A 3TBVB 4X6DF 3GXDA 3CX5J 3SB3A 2EUXA 4DPAX 2XZQL 43CAB 4E9QA 5JW3L 4AMKL 5IKCB 2EVGA 4XI5C 5HDWA 1PF3A 4LNRA 4LKCB 1VADA 2FIKA 5FA3B 4G8IB 3QRGL 4LGRB 4IOIA 1HN1A 1JWMB 2H6OA 5IHLB 3FU8A 4RGNB 1MCPH 2NUTB 2XRAL 1HH6B 5CILH 3VU1A 2YD5A 2B1HL 4F7EB 1YY8B 3QWOA 1QSVA 12E8H 4K7FA 3TNMB 5DJDA 1JGUH 3OR6B 3FFCA 5LCVH 1RURH 3APCA 2P8MA 3R4DA 3HUJF 4ZMYA 3ZE2E 2ZWYA 4AYFB 4B9YA 3FTUA 2LVEA 3IFOA 2VERA 2HRHA 2Z0BA 2VJ0A 1MFCL 2OJEA 1ZLUK 1LDPH 4IW4C 4AGOA 2HPTA 3NIGE 3NIDF 3LH2H 5BQDA 1JGLH 3K2KA 1KPRB 2F54A 4PP1D 3MXWH 3VWKA 4KGLA 1DQDL 1X7TA 3FQRA 1IEAB 2Q5BA 2P7TB 4NSKB 2C3VB 3SE6A 3L4CA 3S8WA 3JTTB 2OX5B 1ZEAL 3NCBB 3RY6A 3PWPD 3E6FA 3VGBA 2DKUA 1MLCA 2P7TA 4NSKA 5CAYB 5KUMA 1CZ8H 4RIRB 2GBTA 2XZAH 3HKFA 3VD5A 5DJAB 4F33A 1IAKA 2XETA 3EF4A 3KLLA 3G6AA 1GAFL 3EW3B 4M7LT 3T2NL 3E9UA 4LHUB 4NIYE 1R0AH 3SZKC 3O9WD 2XWXA 3SKJL 3QHFL 3I2CL 5D7IF 1UQSA 3QDJA 2VXSH 3DV6B 3K2MC 2V7NB 4NGHL 4PJIB 5L4MA 4F7EA 3TEZA 2LLNA 1Y1UA 3P0GB 5KSUA 4JFDA 1BFVH 3ECBB 5KW9H 2UX6A 4QRRE 2E6PA 2R1WB 5DS2A 1ID2A 4BHUA 2DMKA 3PXHA 1JNNL 2C1OB 1JK8A 2KLRA 1OAUH 4OD3L 4J3XA 3M6DA 1RZJH 5JOPD 3FOLB 2GJ6D 2C4XA 5H94A 4DP8X 1AZNA 1WT5A 3K72B 4LCCC 1GJWA 5AQ0A 4YXLL 4RH4A 2VUYA 3GIZL 5KSBB 1H6EA 4KHXL 2AABL 2D0HA 3FRPA 2DWDB 2MPVA 1RHFA 2W65B 5EBWA 3UCRA 1NCTA 1VFOA 5B1JC 1IRAY 2JKJA 1KFAL 3WKYA 2VLKE 1DUZA 2F58L 3SQBB 3T3PF 1S9VA 4ADGA 3W81A 4LEXH 3CPLB 1PEWA 5HVGB 4DP7X 3QDJE 5C0AD 1TPXC 5AUMA 5BV7B 4C47A 1J0JA 3LDBB 1WYJA 4IBUA 3AT0A 3PDGA 5MEND 3MNVB 1CD1A 5I6OA 1JUFA 4HOXA 2A6JB 3QXUA 5I5MA 2YAPA 4G8GB 3SCMD 4TUUA 5L2KE 1G43A 4KKBC 3OX8B 1KBGL 3SGJA 1F4XL 4DESA 3HR6A 1RZGA 4ES8A 5KWYC 1V3JA 1NC2A 2YXMA 1PZ2A 3SYPA 2QSVA 5GIRA 2X9XA 5C0GB 2VW6A 4FQXC 4WEEA 4XCEB 4WY7L 3QK0A 3O6FA 4OB5L 4G6FB 3BO8B 3MRCB 3V6FA 3N04A 4YLQT 1QPXA 4ZYKB 3AT9A 3MQIA 5J1TC 2JKSA 3G5VB 1W80A 4IRZH 3SDYH 2R2CA 3NRFA 3CXHJ 2LLGA 1P9MA 2J2ZB 4EUPA 2MPAL 3BIKB 3SDXE 3G6DL 3AW5A 2BP0A 4XMKL 3S4SG 2BY3A 3KYNB 2A7GE 2UYLA 2W9DH 3NJIA 1PTZA 4Y16A 3NQXA 3FMGL 5KSBF 4YPGB 1WBYA 3U7WL 1FC2D 1G7PA 1S5HB 4LP5A 3FCSB 4MAYA 3TNNB 4LZKA 5I6MA 4TLUA 5TK2A 3ZKND 3KPQA 2CIIB 4WFFE 3QGOA 4MAYB 3TNNA 2ENQA 1KWGA 2P5EE 5DHXB 5E9DD 5JMOC 4MA1B 1A5FH 1BQSA 5MERB 2ICWA 4MKMA 1S78C 4PGEB 4NKMB 2EH8H 2FGZA 4WI8A 5LDSA 2AKRA 2NTSP 4U1SB 5IHWA 2WNKA 2JB5H 3DYMA 3R06B 5E56A 1V10A 5IT2L 4Z0BH 4DOHE 4RWHA 3VRLE 2P5WB 3REWB 2QMJA 1K8DB 5J5EA 4KV5E 1RUAL 1TJIL 4Z3JA 4JMXA 4JKPH 3BO8A 3MRCA 4KRPC 3V6FB 1QLFB 5AB2A 2UXFA 4B3EA 1E27A 5JIQA 1M7IA 2NYKA 1SJEA 1IQWH 4NLHA 2YMTA 5E2UL 1JRHH 1NH6A 4FI7A 1HQ4B 4JO1L 4B0MB 5FO7A 1MY5A 3FUIA 2PPCA 1ODAA 5F1NB 3TA3D 4AJ0A 1KJPA 3D9AH 4OB5H 3OJMB 3C87A 1A1NA 2FDBP 5KJ4A 1VCBC 4G3YL 5T1MA 2ZPKL 1M7XA 4MD0B 3VGEA 1X9QA 2AXFB 1EWHA 1ESOA 2GTZA 3QXTA 4IU2B 2PR4H 5FYLD 1E8WA 2R4RL 3PHAA 3A6CH 5TFSL 1T7ZA 4YGAB 1QRNA 4R5TA 4NC0B 4LLWA 1KSRA 3AXIA 2I9TB 2KI6A 2ZSVA 3BWAA 4ZTPH 3WIFB 1MG2C 1IIIA 5AUMB 1MRCL 3QUGA 4GSDH 3UCQA 4GINA 2XBZA 2CIIA 2H32H 5D7HA 3P7PE 2N0KA 3DX6B 3NJJA 5C07B 5BCAA 5IY5B 3MLVL 1WE5A 2BFGA 4PJ5E 3BHBA 1TMCB 2GK0A 4B6ZA 1YUHA 1MCEA 4WUUA 3TL5A 4KMLB 3BSZL 1I4FB 1MLBB 1PE8A 1SLVA 1YYLH 3IB4A 4Z7OF 4TQIA 3QUZA 1VEMA 4J8QA 4PJXA 3V6ZB 5IHBA 5BOJA 4HH9A 2XA8L 3BCDA 2X4PB 1A7PL 5T5FH 1QQDA 4PLKD 4IM8A 4ZX5A 3T8HA 5GRZA 3CFQA 4ACTA 4I18C 3D3VA 3TP4A 5C0RL 4Z7VF 2YD4A 4OCMC 1M71A 5IG7B 2ITCA 3LEVH 1IKFH 4OF8A 1HL4A 4OZFA 4UT9L 1HYRC 1CFTB 2VDNL 4DF9A 3SODB 3ASOB 5DEJA 1OE3A 4KY2A 1S46A 2HUEA 4MNQB 5I75B 3MLRH 4J6RH 4W1TA 5JW3H 2H1PH 5GRYA 5ENWB 3H1ZA 1INDH 4A7SA 1A6WL 2XCMC 5A2CA 4I7ZC 3KDMB 3BCFA 2QQQA 3AU1A 4IOFD 3V5KB 4RWYL 4XPAH 3ZU8A 2GT9B 3WO3B 2QPDB 1KJ2A 1UVQA 3LN4B 3QUYA 4PM1A 2GFBA 3KJ6L 4FD0A 4XNUL 3ZPDA 5A6IA 2D9QB 1P7HL 2R7EA 4WFEE 2VXSL 3K7UA 4W9JC 4ABWA 4MAYC 3QHFH 4XNXL 3OAZK 2O1AA 4OLYL 3LEXB 5C6TL 4BWWA 5C0CD 1A8JH 2NXZC 4N0UE 4F8QA 1I8LA 3UAJA 2X4RB 3CU1A 2WV3A 3OKMB 4K94C 4NCC1 4AEIL 3WUZA 1UA3A 3VVWA 3DA0A 3MRRB 4IQHA 4FI8A 1SY6H 4U1GC 2F7OA 2XBTA 2BCKA 4M1GH 3HS8A 1P9MC 1BLNB 5I1GH 4L4TD 3UTZB 3AWFA 2C7UB 2G3ZA 3CZSA 3S35H 1UOLA 4R0LC 1ETB1 2ATPB 1YY9D 4XAKD 1B0RA 2Y1AA 3LSOB 1ZIAA 4D9WA 4DVRH 2VW4A 1LO5A 4YDNA 2QVMA 2J2ZA 3LQZB 3VMPA 5KOMC 4PJGB 1YEJL 3UBXB 4KROD 1BMGA 4ALAH 1CU4H 3PUUA 1SJHB 2O4EA 1AQDB 5FWRA 4DZ8A 5ANMB 3WUWA 1L9PA 4FQCH 4MXVE 2APWA 1UEYA 4D7BA 1AIZA 4JFOA 5KVMC 5EZOH 5DK0A 1MDTA 1LEGA 3FRUA 2EIZB 2A9DA 3T0EB 4P2QE 1HI6A 1MI5D 3KJ6H 4DCQB 2HB0A 3FU7A 3SGDH 5D1XD 1NQBA 5FYLH 2CIKA 2AXJA 3KGSA 3FBKA 4FQ1H 3PE9A 1TVBA 1P7QB 1JNHB 5A3IC 3K3QA 3KL3A 2NCMA 2X6BA 4H0IA 1BCIA 3RKDD 1KOAA 1FBIH 4PYHA 1RK1B 2DQCH 2VE6B 5F44A 4LCCA 3DRQB 5IMKB 1EK3A 4J3OC 1U3HC 3RFZA 5I0YA 1ZHBB 4CC4C 1ZHLA 3W5NA 4G82A 4JFSA 4GY4A 1P7KB 5HYJA 2A74A 3KS0J 4IBVA 3BUDA 4XVUC 1F11A 4X5WB 2V2XB 5FKAA 1LD9B 3LKPA 4FFYH 4LCIH 3HLKA 1GC1C 3RYMA 3NSYA 3QIWC 4QRUB 3F3HA 4K90A 3SZ6A 4YPGA 1VZGA 1Y1DA 3K72A 4Y1AA 4OCSH 1LDSA 1YEGH 2FVNA 5C08D 4NXSA 1WAPA 4LESA 1CF8H 5IB3A 4OV6F 5JDSA 2O61B 5J89A 1OXYA 1T04B 2WVSA 2Q9OA 3GTNA 2C3WA 4X80H 3RI5F 1QW8A 4OGYH 5DZJA 4AJWA 3GQFA 3HFMH 4HG4J 1AGFA 4ZW6A 5EN2A 3GKWH 3LRKA 4M62H 1KZYA 4WVRA 2K7PA 2ENSA 4H88L 1I1AA 2PW1A 4G8EA 5K9JL 1XIWC 4QPEA 3NJXA 4EI6B 3ULUF 1PIFA 2AHIA 2VDMB 1YNTB 5KVFE 3VGFA 2ENJA 4GRLA 5BQ7B 3CSYB 2FT6A 3V4LA 4YFLI 5DFVC 4GRWE 5ICXA 3GRWL 5IMOA 3MUUA 3UC2A 3AACA 3EOYG 4PB9H 5LNDA 3QQ4A 1NIFA 2PTTB 1KIUB 5JW4Q 1ZRUA 4JCWA 5DRNB 1L0YA 4L0PB 2WBWB 5JHLA 5EEUA 1PNCA 2GY5A 1N59B 3AMKA 5FX3A 4Y9BA 5EULV 1FAKT 3MROB 1J8HA 4KY1L 3AQDA 4ISVB 4J39A 3DMMC 3KWTA 4DIXA 1WGVA 2CO3A 5IQ9A 4BFFA 4WJ5A 4ODBD 3AREC 4WI7A 1ZA6A 4KPHL 1IL1A 5T1LB 4JUSA 1NDMB 3FHAA 3TYGL 3PPEA 3VWJB 1KN4H 5FS5A 1KB5B 1SEQH 3RUGF 2HZHA 1FVEA 5FHBH 4AJVA 2IJ0C 4JO3L 5E5LA 4E42A 3RDJA 3NABH 5IK3A 4X7SL 5TDOB 7CGTA 3N91A 2P8MB 5HYJD 2W91A 4XN1A 1M6OA 2ZX9A 4CMMB 1NMBH 4PJ7B 3RB5A 4Z7OB 2WCSA 5JIPA 4YEEA 5FWQA 3HA0A 1IJ9A 1XD0A 3KG5A 1W8OA 4DPBX 2WI0A 4G7SB 1CD9B 3MLZL 4FTVE 3DX0A 4TNWK 4MJIA