5C97A

Insulin regulated aminopeptidase
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
866
structure length
860
Chain Sequence
LFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-cystinyl aminopeptidase
publication title Crystal Structure of Insulin-Regulated Aminopeptidase with Bound Substrate Analogue Provides Insight on Antigenic Epitope Precursor Recognition and Processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 263
structure length 860
sequence length 866
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2015-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 5c97A02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 5c97A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 5c97A01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5c97A03
4PW4A 2DQMA 2GTQA 4XO4A 3RJOA 3FUJA 5J5EA 3FUKA 3FTXA 4FKKA 5AB0A 3FUHA 3FTYA 4XNDA 4FKHA 4XMUA 5CU5A 4MKTA 3CHRA 4KX7A 3MDJA 4XMXA 3FU0A 1GW6A 3FH8A 4ZX5A 3Q7JA 4DPRA 4R5TA 3FTWA 4XN7A 3FTUA 4Q4EA 4RVBA 2HPTA 3B34A 4PVBA 4XMWA 3FU6A 3FH7A 4X2UA 3EBGA 5C97A 2VJ8A 5LHDA 5AB2A 4NAQA 5LDSA 4KXCA 3QNFA 4ZW6A 4KXBA 5J6SA 5K1VA 1SQMA 3Q43A 4XO5A 4ZW8A 4Z7IA 2ZXGA 3B7UX 3B2XA 3EBIA 4ZW7A 1HS6A 3B37A 4KXDA 4K5LA 3CIAA 3FUDA 4Q4IA 2XPYA 1Z5HA 4XN5A 3FTVA 4QMEA 4ZX3A 3CHPA 4ZW5A 2YD0A 2HPOA 4GAAA 4XN1A 1Z1WA 4XNBA 4ZW3A 3FUIA 4L2LA 3B7RL 4FYQA 3B7SA 4RSYA 3FUMA 3CHQA 3KEDA 4XO3A 5FWQA 4E36A 4KXAA 3FUFA 4K5PA 4XMVA 3FUNA 4WZ9A 3T8VA 4R5VA 3FULA 4ZX6A 4QHPA 4F5CA 3SE6A 3B3BA 4PU2A 4QIRA 5LG6A 3FTZA 4R7LA 3FUEA 4R5XA 4XNAA 5DYFA 3FTSA 4XN9A 3U9WA 4NZ8A 4XN4A 4FYSA 3QJXA 3FH5A 3B2PA 3EBHA 4FGMA 4XN2A 4FYTA 3Q44A 5AENA 4XN8A 4JBSA 4ZX4A 4XMZA 3CHSA 5BPPA 4P8QA 4PJ6A 5DLLA 4QPEA 4OU3A 4FYRA 3B7TA 1H19A 2DQ6A 4J3BA 2XQ0A 4K5OA 2XPZA 4KX8A 2R59A 4KX9A 3FHEA 4QUOA 4HOMA 4MS6A 4XMTA 3FU3A 4K5NA 3FU5A 4FKEA 4ZQTA 4K5MA 3CHOA 3PUUA
chains in the Genus database with same CATH superfamily
5E9DD 5TDNA 3HTLX 5INCA 4WJ5A 5AALA 4NUQA 1V27A 5F1IA 4V2BA 1Q1JL 2ENPA 1XH0A 3QEQE 1CK0L 1N0XL 1REIA 1OM3H 2CKBB 3LIZH 4XVJH 3F7VB 3V7AG 3WMQA 3DROA 3VTTA 4JFDA 2JK5A 2YAPA 3FO9A 4MCMA 3GMRA 3AM8A 2BNQD 3W81A 4BXVA 4JFPA 2VLKE 5ICXB 4ZTPL 5L8PE 1U2YA 1HOEA 3PAZA 4N0CD 4XCEB 1IU1A 3CQFA 5EU7C 4JFZL 2AXGA 2OMNA 3IWUA 4ZOBA 5M95B 3CCHB 5E8NA 3S88H 1WYJA 1R0AH 3S7GA 4FLOA 3EO1A 3HZKA 4N8VA 4NZRH 2W59A 4X83A 1IMHC 1JPFB 3GSUB 1KCWA 3LNDA 3IDGA 5JTWA 5I6XC 1GMEA 1I8KA 1BPLB 4AQ1C 2IEPA 2H1XA 5DJDB 1SY6A 2HRPH 3HHRB 4C83B 1Z0MA 3HZYA 1WICA 3AABA 4HALA 4JB9H 2VDOH 4KKBC 3ECBB 4HW6A 3M46A 1TU2A 5EF2A 1LNAE 2E9WA 2Y3NA 4YHIB 4FQHA 4R4ND 4PRAB 5AW4B 3H4FA 5F1SA 2PYFA 2QZQA 4HKZB 1R6VA 1KGIA 3CFUA 1GGIH 3DJ9A 1JXKA 3LXUX 2IQ9L 3DJZA 4JFYB 3RUGB 2JXMA 2V2WA 5CD5D 3B5GA 4R4FL 1PG7X 4MJHA 3LKOB 4YDZA 4X5XA 1VADB 4X7EC 4OIBA 1YEDA 4J8QA 2ZXQA 2CK0L 5EN3A 3BRFA 1SJVA 2VNCA 3LEXA 4JMNA 5DMIL 4K3JL 4OFVA 3EH1A 2FBJH 1F3RB 4HIHB 1FJTA 5KYYB 3UG3A 3BEWB 2VZVA 1U8OA 4HGWA 1X3DA 2OYKA 3KLHD 5GS2D 3LEVH 3GXTA 1OGAE 5BMFL 3EFFB 4DAGH 2WBKA 2FZ3A 1KN4L 4NWTL 2JIXB 3X13A 2WAQA 5EUOA 2JQAA 1LO5A 1V7NH 5E0QA 1ZLDA 5IMMA 4BUGA 2OZ4A 4Z1PA 3L54A 2YAEA 4Y4FA 1BAWA 1QWHA 4DEWA 1MF2H 1JWSA 3WU1A 1N5YL 3ZHNA 3TMNE 3CC1A 4G8FA 2CUMA 1A6UL 2A99A 3NJHA 4L0ZA 4I18A 3ARPA 4DZ8A 3MRNA 1JVOA 4X7TB 5DF0A 5IHBA 4M93B 1Y3GE 1J12A 2Q3AA 2NZIA 3UBFA 1LQBC 3MODL 3RZWA 1JPTH 2DI7A 1IAIH 4MB5A 3SKOA 1P1ZA 5K9OA 4R0LA 2COQA 1JHLH 1KXVC 2JIXD 3OC8A 1PF3A 2EYSA 5HJ3A 1CBJA 1JHTB 5E6IA 4BA0A 5ISZE 4DP5X 4LMQI 3WJLC 5DZNA 2CGZA 2KZBA 4Y5VB 4YHNB 3LQZA 3VFWB 1L9QA 4JM2C 3VGGA 4FFZH 2FEJA 1XR9B 1KBGL 4MQSB 1CBVH 1U8QB 1EAQA 1EFXA 2DLHA 3MJ9L 1DSFL 1ZEAL 1QI3A 2XY1A 3PWNB 3X1BA 4JM2B 3LY6A 2XUWA 2J56A 5J6GB 1CLZH 4Z76A 4YX2L 1ZDPE 1TJXA 1HL8A 1QLEB 1EXUB 1P6FA 2Z64C 3QI9A 4GFXA 4Q4IA 4YHPB 3FAWA 4JFEA 2NNXA 1YN6B 4KRLB 3L4XA 4RISL 2EVHA 2CBMA 3RWCB 3MBWA 3NZSA 3OMZA 2JJTA 5JT9E 1BIIB 5I1GL 4ADIA 2IBZY 5EPMA 2C4FT 1HKLL 2I27N 1FL6A 3F58H 4XC3L 1BZ9A 3MOAL 5EU3A 2PXYB 4N2EA 3HI6H 4GMTH 2MTAA 2FO4A 3WNJA 2ZUUA 3I9GH 5DQDL 3WKNA 1CGSL 4R90L 3O9WC 2WUCL 2DJMA 3MJGX 3ZIYA 5HYJA 1ULVA 4ENEC 5HGBA 4LGPB 2YFNA 4NZ8A 1XT5A 1ET5A 3OC5A 5LQBL 2AJYH 3FMGH 4XMPL 3C5XA 5H4ZA 3MLVH 4G9FB 4OLVL 1AR1C 4GS7B 4XMKH 3L4CA 4HJGB 5FO7B 3OTTA 4POZC 5CLZA 3BVUA 2MFNA 5L2KB 1FFNA 1WFNA 4NWUH 5DTFA 3FT2A 3GSNB 5DI8A 3VG9C 1O5PA 2PXYD 3GSRB 5BV7H 1JXDA 5DMKA 5HYJD 4F33B 1YMMB 5IG7A 4UT6A 1PY4A 4BE6A 4IBLT 3AREB 4PB0H 2X4NB 1CFSA 3L1FA 4TUJA 4KNQA 4U1IA 5D70H 5LDUA 4MD4A 1A4CA 2OCCB 1K4DB 3DIFB 4U7MA 3C60C 5BVJB 1PD6A 1MCNA 4X50A 5AVTB 4G9FD 2ZKHL 4YOKA 4LXFA 4PV8A 2Y1ZA 1QFUH 1ZKAA 5IFHL 4TVPD 1ZV2A 5DK3A 4HWEL 3Q1EA 1FRGL 5L2KD 1CLYL 4V1DA 1BMWA 3QC6X 4OFKA 1EANA 1NEZA 1TYRA 2KZKA 1H9VA 4OJCA 4PS8A 4U1JB 1NDMB 1LP9F 1YMMD 4EBQL 2UYLA 1NCDL 1E4HA 3ARED 4P2QB 1I7ZB 4JZOA 3VXNA 3BUYB 3E6HB 2R8SH 1HIMH 1Z5LB 4W9HC 1G9MC 4N2KA 1R3IH 4PI2A 3FB7B 1WIOA 2Y5TA 5FSSA 5FF6A 1U8IA 3DBKA 2HZHA 4N25A 1NLDH 3RWDB 1PE8A 3MACL 15C8L 1CGXA 5LUMA 2PO6A 3VM5A 4Z7QF 3GKZA 3KXFE 3QR2A 2Y7SA 3NJNA 4QD2E 1IRAY 4EI5A 4S2SB 2FQFA 4LDLB 3U2SA 4DQOL 2NNFA 3A4EA 1KGXA 4GT0A 1IJNA 3PP3H 2HH0L 3LN4A 3SY0B 4EDWH 3VRLE 1E5AA 4FDWA 4K5PA 5E9DE 2OXHA 5EV7A 4P2QD 1RIHH 4IU3B 1OP4A 2XQYG 3O41B 5D2LF 4FLQA 3PHAA 3QULA 1QTYT 3NFSL 1C9SA 2H5UA 2QQLH 3CXFA 2PCFB 5JQ6L 2WXOA 2R15A 3QHFL 4OCMC 3DIDA 2J1YA 3QO1A 2R0ZL 4J6RL 2BRRL 4GI8A 5F8RC 4M43H 2BNQE 1F00I 2KDYA 5H94B 1ZANL 3U6XA 4KKZA 3V52L 2YAOA 3HAEB 3DO3A 1RVFL 3VAEA 5DJ8A 3RPIB 4XN8A 2JJUA 3FSAA 2P5WA 5GS0L 5E8OA 3EOBB 1PG7L 4HK3J 3T0VA 2P7TB 1A6WH 3U46A 4U7KA 3BKMH 5TE6H 4ECNA 2YPVL 4OLXL 4JPWL 5CNHA 5B22A 2Z7ZA 3NZ8B 4XVSL 1INEL 4KVCL 2KZ1B 2OSLB 2VISA 3OAUH 4NCC2 4K5OA 1YC8A 2H3NB 2ICEA 2R23B 3A0OA 3KR3L 4X9BA 1EBPA 4ALAC 2P3YA 1MVUA 3DHPA 4XPTH 5FYLL 4LRIC 4BQBA 4JK0D 1KB9J 3MN8A 1TVHB 4GB9A 5T3ZH 4AGMA 2BZCA 1SOXA 2GPZA 5IB1A 1ED3B 2F7RA 4ANVA 2P5WD 2DQDL 3TBTB 2BVEA 4ODXA 3LIZL 1RZFH 5DHVA 1D5MA 4XVJL 3BZFA 5EU4A 3C6SB 5AFAA 1MHHB 5DUBB 4A66A 3F6JA 1G5AA 5KANG 3JZ7A 5TQ2H 1PG7W 4FOMA 4PJIB 2UY6B 2DWEA 1FPTL 1NGXA 1NDTA 3D4GA 4HBCH 1BOYA 4TUKH 3T6WA 5BZZA 5GRYA 3G6JB 3HE7B 1FVCA 3WTSA 2YSTA 5HGDA 2SODB 1H3XA 4H5SA 1SM3H 1EXGA 4PJDA 1FO0L 4NRYB 4X9GA 5I17A 5KWYC 1NUGA 2PYEA 2ZUVA 4K90A 1ACCA 3WJMA 1WAEA 4MFHA 3MLWL 3B9KC 1NWPA 3K6SA 4CVXB 4JUSA 1U8HA 1PZUB 3I02B 4WDIA 5FW6A 2H2PC 4XBMA 5J12B 5C9KA 4PJGE 3BGMA 3ET9F 4D9WA 2X2YA 2HG5B 3LSOA 4MJ4A 4R3SB 4ZG1A 3TBWA 4AITA 5LIFE 4LCYA 1SDAB 3NK4A 3QC5X 4NQDB 1U8LA 3O6MH 3DSNA 5B39A 3MA9H 2N01B 1IM9B 1UGNA 1ACYH 4W9FC 4LCCA 2ITDA 4JY6A 5EZLA 1Y1UA 2DQHH 4XNMA 3KPNA 3HE7D 4B50A 2DQCH 2PYED 3L2LA 5HHQA 4WHTA 1EEYA 4R8WH 2X3CA 4TNWF 4RAUB 1MCLA 3TEXA 4LEOB 1TLXA 4K94H 5EUOE 4FQLL 3HMXH 4NCC1 3VGAC 1RJYB 4R4BA 4XVUC 4DUWA 5JLZA 3TURA 3FTSA 3QCVH 4J3OC 1W72A 4DNLA 1MUJB 1WITA 4JDEB 5CWSA 1SEQH 3K4ZA 3UCQA 1YYCA 3KGRA 5C70A 3VGAB 5ITFA 2ZXEB 5GQBA 4JRXB 2HFEB 2VTFA 2ZXBA 3MRBB 4BK8A 1OO2A 3INUH 4NQDD 3H2QA 1E4XI 4Y16C 1GOFA 1ZY9A 3RE0A 2D4DA 4G11A 4W6XB 3WNOA 4M61B 2EEFA 3BXNA 1CICD 5DS8A 2WUBL 3RWHA 1D7DA 1URIA 5C2BL 5IQOA 3CZKA 4WGVB 3RTQC 3VI4F 3L45A 3GZQA 1K2DA 4YQXL 1VACA 3QWRA 3OX8B 3OB0K 3I3BA 3IFOA 2C1OA 2DKSA 1DBJH 3DX4A 4PJAF 1EJ8A 4NDMA 2BIMA 3DA0A 4R7NB 5HYSB 1JYXA 4L18A 5G4NA 2YAHA 4MS8D 1T4WA 3M7OA 4JRXD 1FVEA 3MGTA 3ESOA 4U1MB 1S8DA 4MCZA 2PP7A 4Z7VE 1JHLL 4JJ5A 1SQ2N 5E9NA 5DGRA 3AU1B 3HPLA 4XWOD 4JZNA 1CU4L 3QIWA 5IB5A 3WFCL 4NO5A 3UP6A 3NAAH 4QT5B 7FABL 1C16A 1F11A 1V55B 1BGXH 2BIIA 2F7QA 3IDYC 4GAJL 3RTLA 3ZT5A 1OWRM 1N59B 1RP9A 2JKTM 2VITA 5B4MC 2CO2A 3ROLA 3K2UL 1FAKT 2A73A 2G2RA 2N59A 4JDTL 3ZW3A 5DT1H 4WI7A 3IMWA 1OF2B 3N42B 4YE0A 4F7PA 5AB2A 1UT9A 4QO1A 5C6TL 4X6BB 1DSYA 3VXRD 1CLZL 3Q43A 3AITA 4D7PA 1QBLL 3QUKB 1R5IB 3P7WE 3DK2A 5L4FA 1L9PA 4F7MB 4OF5A 5LNGA 4Z77B 3ZR5A 4F1SA 4JFXB 4DFHA 1ECYA 3FT9A 4KITB 3OGOE 5MENB 2LHAA 1CFVH 4P46A 4BHUA 1KEGL 2DV6A 1GXEA 3IXAB 3FQ1A 1FBIH 3IXTB 4QHUA 2Z8SA 3RHWF 2OJZL 3SGEI 3Q2LA 5HYJE 3P0VH 3DMMC 3GXIA 3LN5B 2F9BT 4XCYA 1XGRB 1JNLH 4KRNA 1JGUL 2X1XR 3WHXB 3DX9A 2OULB 2XG4A 1IKOP 4ELKA 4WW1A 4WNQB 5LGJB 3W5NA 4FP8L 1LK3H 1W0WB 3T8XA 4GMTL 4XRCA 1KXTA 1X5XA 1Q0EA 3I9GL 3SGEH 3DMMB 4L9LA 1N6QL 5I26A 2UVEA 3SE6A 2OBGA 3GMOB 4G9FE 4K3EH 1RLWA 3SODB 3FQUB 3CBKB 4AE1A 4D0BA 2X0VA 3JUZA 5AVSB 4TVPE 2Z7YA 3ALXA 1MJUH 1Q9LA 1RJCA 3O45B 1A0QL 5F7HA 5L2KE 3SE3A 2WQWA 1F8TH 5MEND 2Q7YA 1F86A 2AJYL 3BSHA 3FMGL 3N1GC 4HS3A 2AW2A 2LAGB 4KKCC 4QRQB 1IQWH 4W4OA 1UENA 3MLVL 1O0VA 4NKOA 5C8JA 3UJJH 5C0DB 1WFTA 1HEZA 5GGVY 5JPMA 1AGCA 1XL4A 4N9GB 3DX8B 4L1DA 3T0EB 3ATEA 5HI5D 3ZTJH 1YMME 1B90A 2V3DA 4LPCA 1AXTL 4TSAL 4Z6AT 1NH6A 2YJQA 1U8CB 4QRPA 4NWUL 4LVNC 4O51B 1JPGB 1H3WM 3SDYL 5J13C 4XO9A 4KKQA 4UOJA 1KACB 4DKFH 4OCNC 5L9DH 4XXCC 4S1SH 3TT1L 3L1OH 2G5UA 4S0SD 1L6XA 2HFGH 3V5DB 1T5KA 3MRLA 4RAVB 4AIZA 1SEBA 1J5OH 5B3NA 1NPUA 5F1OB 2E75C 1PD0A 1KY7A 4HG4J 5A2JH 3CZNA 1NPJA 2BZDA 1F3JB 1QEWB 5IROC 4MZRA 1KCKA 1E9QA 3OWEA 3H3BC 3A4DA 1DJGA 3GF8A 1GZPA 3A47A 3APFA 3DTXA 3T0ED 3MRDB 4QRPD 1UG9A 2OSXA 2OMXA 4EIUA 4NC0B 1DVYA 4KFMA 4QEGA 4J6IA 5T1JA 4EQ3A 2W0FA 4P2QE 4PLKD 4PYHA 1HL9A 3Q7JA 3UG4A 4BFRA 5I24A 1UD8A 4OLYH 5D1ZA 3PUCA 4UT7H 1USQA 4RVBA 3K72B 3IFPA 5EBLB 2GIYA 4HIEA 2OJEB 2WQAA 2WW8A 5FK9A 1TZHA 2GJZB 2XBTA 3QO0B 3V6FA 5DMGC 4R7XA 4P3WA 2R8SL 2WTPA 1HIML 3EKCA 5INDA 1FG2B 1S9XA 2R0LL 3HHSB 2YD1A 4YSQA 1BXVA 4I1PA 1INQA 3P9MA 1YSOA 4HHAA 4BM7A 1ZSDA 1KV3A 5JW5A 3TC9A 5TDOB 3SPVB 4XVTH 3QH3A 4Y5YB 1NLDL 4EKJA 5F89B 1KB5A 2FNWA 2NQCA 1XBDA 4XWGL 3QUML 4NM4H 3ALWA 5GISL 2AJSH 4YXKH 1SN0A 2QKSA 4XNYH 4ABQA 5EU5A 1IM3A 3RVVD 1CXHA 1T3FA 4EMZA 3NEXA 1DBKH 4MMZC 4YVUA 5TGBA 2HPOA 3L4VA 3VD0A 4AGNA 1KN2H 2QPFA 3RIAF 3UTZB 4IRJA 4KUCD 4YSSA 1PJ9A 4MDIB 2HMIC 4BZ2L 2GJPA 1ZGLB 1TZAA 2R4RH 3MCLL 2HKFH 5JW4M 2P49B 1H5BC 4PGEB 5LN4A 4MMZB 3KWUA 4ATTA 2OR9L 2B2XH 5FYKL 3V6ZB 2DLEA 2P5WE 1WC7B 3HS9A 2LQRA 2X2UA 4HXAL 2XN2A 4PRBB 1J10A 4KK9C 5ICUA 1HC1A 1MLBB 4NZFA 4PI0A 3EG9B 3HG0A 4U1SB 1FH2A 1V54B 2ZOWA 2OP4H 3PXHA 4UYQA 1WHPA 5ILTL 1JWMB 4IRJD 1MQ8A 1P2CA 4OM0H 1RZKL 4I89A 3FRUB 3TGXA 1QPXA 2H9GB 4Z7NB 5I16A 5ID0B 3L1EA 1VGEH 3D25B 4IJ3C 1KCLA 3UCRA 1TO5A 3JTSB 5KSVA 1KYAA 3IMBA 3OAUL 3T1WA 5BS0B 3GJEB 4BWTA 2V9QA 3I85A 4LHUA 3QQXA 1TMNE 5DPFE 1R5VA 4P3CL 4XPTL 3L6FA 5C0FA 1SN2A 1W9XA 3VXMB 4LSSH 1DVFB 3HNTL 1X9QA 4JGJA 2CNZA 2MQ0A 2HCZX 4PJCF 3Q8BA 1A14L 1KJ2A 5SWSA 1Q0YH 4FKKA 1YUHB 3QJRB 4U33A 4QTFA 3AW5A 4GAYB 2B14A 4OLEA 4H8WC 5E5MA 4NJAH 2HTLC 4P5MB 3FQWB 1MH5A 4MX7B 4L3CB 1ZHLB 1MHEB 2F53A 1CZ8H 2PYEE 1JOIA 3FF7A 4MXWH 4ZAKC 3V10A 2XCMC 5TQ2L 1UWEH 4WY7L 1IAKA 1DCEA 3VFNA 1QG3A 4LHUD 5E00A 3VWKC 5BS0D 4E5XB 1A02N 3OGCB 2WD0A 5J1AB 4IGBC 1JZ5A 3SD2A 4ANXA 4AZ8A 4DPCX 5A16A 3B2UC 1MCFA 1YUKB 3VXMD 1DVFD 1ZT7B 4PJEF 3ILDA 3TOPA 3GBNH 4XO8A 2X10A 1QKZL 1J1OL 2DMHA 1FJVA 3BPCA 3IMRA 4LF3B 2F1EA 1OCWH 4PP2B 4NUJA 4YE4H 4FZEL 5GZOA 4NQDE 1J11A 3KM1A 3GRWH 2EUVA 3B9EA 3CZFB 4DP2X 2QV4A 4OV5B 1QTSA 3FTVA 4M6MH 1RERA 2XIIA 4WU5A 3OQRA 4KK8C 3ARDC 5HJBA 2EO1A 4PRHA 4S0HA 3VG0H 5FC9A 3T6XA 5I19L 1XF5B 4UAOC 3QNZA 1FZMB 4OJYA 2DQHL 4NLHA 1SXNA 2DQCL 1W8EA 1KFAL 5GS0D 3WKMH 3B3BA 3HEIB 4K94L 2A6KA 2COVD 4JRXE 3LYRA 3RWGB 1A5FH 5AD0B 4KNTA 4KRPD 4UAOB 4KZEL 4PGJA 3HC0B 4FNRA 1B4LA 1O6SA 3MQIA 1KIUB 3RA7H 1JGEB 4QJ5B 3VQ1C 1SEQL 5T1MA 2Z8RA 4DH2A 3VNZA 4UNUA 4G9DB 3MRJB 5FYLD 1E8XA 2X53A 2AKRA 3NGBB 4PRHD 1BECA 3PWLB 4I48A 1AIFB 3HAEG 5E5UB 4ZMWA 2H26B 3WY1A 5HHOA 1I75A 3OKMA 4LARH 1KULA 3ARUA 1CGVA 1FO0A 3ZO0A 1RJZA 1URLA 2WVVA 4JVPA 3VXRE 1U42A 4AV4A 1RUKL 3C6LB 3I9PA 2GTZB 2OMYB 4LB8A 2Q0ZX 1E4XL 4WEBH 3P2TA 2H47C 4G59C 3S5ZA 4APXA 2Z92A 2CZNA 4HKXB 2E8YA 4X6CF 4HT1H 3U4BH 1C08A 5J3HC 2GTQA 3VCLB 5D6CB 3CSBA 6TAAA 2A9DA 4LBAA 3WKPA 2J2ZB 1R3KB 3D18A 3C5ZA 3PY9A 3GHEH 2ATKB 4D0DB 1LNCE 1E90A 1KLFA 3DSFL 3WIFB 3EFOA 5EDSA 3NP4A 4EOWH 3WAJA 3PHSA 4CW1B 1QZNA 7CGTA 2OL3A 2DBLL 4L37A 5HYEA 3K6IA 1NFDF 3C6LD 4WEMB 2E7DA 3F65A 2EVGA 1FCCA 2JMRA 4Q9CA 3RFZA 1FGVH 2FGZA 5DC9B 1JZ7A 5DT1L 3BEVA 3RLSA 4J1UB 5MENE 5KBMA 4ODBD 4NN6B 2KERA 1BFSA 1SYVA 1XCQB 2DH2A 2FLMA 3MREB 1G6VK 1KYOJ 4YZFE 4I0PC 4P5TC 2OCJA 4OGYH 1YEKL 4OY9A 1K9TA 4HMCA 3F7YB 4PD4J 2R9HC 1RUPH 1AD0B 3UYOD 5IFJA 4EZMA 1MHCB 3OAYK 1PLAA 2WINB 3LNIA 3BWAA 2WLLB 1DTUA 4ATWA 3KEHA 3VYPA 2ZE0A 3L9EA 1LEGA 3US0A 2A6JB 3UO8B 1V3JA 4MDJA 2DMCA 5KOVC 1T4KB 1YN7B 1OAZL 2IWGA 2WZAA 5SX4H 5FEBA 4AUJA 1M53A 1QVOA 2LGNA 3BPOC 3EH2A 5K59E 3LNFA 1OSZA 1FGNH 3GBLA 4MSWA 2CH8A 3F05A 4Q89A 1XXDC 1OY3B 1N4XH 3WIHH 4ZX6A 3E6FA 3HMWH 3JYBA 4ONFH 1YQ2A 4PRDA 1JWUA 1H15B 3T0EE 3FN3A 3I6GA 3PJSB 3UOAB 4QRPE 2Y7MA 1LNUA 5IWLA 2XWTA 3ARQA 1F8TL 2EIDA 1L5GA 3U9UB 4DEUA 3U9PL 4KV5F 4MWFB 1E4WL 3ZTEA 1IQWL 4WU7B 2ZD0A 5FGSA 3UJJL 2XN0A 2ZCLL 4YBQC 2B5IC 3G5XB 4BFBD 1ZIAA 2OMBA 5FCUH 2X0UA 5JW3H 2DN7A 3W0WB 3RWEA 2BH0A 4UT9H 1CCZA 2VWEE 2FECI 1EVUA 2WSPA 1JV2B 2KPWA 2CHNA 3L3DB 2NUTA 2IFFL 4DKEL 3S96B 4Y9GA 4JQXA 5EIIA 4TRPH 3L1OL 3B7TA 2HFGL 2X4QB 4PJBF 4TOYH 1GHFH 4JDVA 4X0KB 1HJBC 1CD1A 2EVFA 3FT3A 1C5BH 1QUPA 3REWA 1F3DJ 3TH2T 1J5OL 3BO8B 3QR0A 2G9KA 3RP1A 4EUPA 5HYSG 2Y7QA 2BHYA 4G8EA 3GMMB 3GZOA 4G42B 5L2JA 1BBJA 4AENA 3W0WD 2BLFA 3NCCB 4X7DC 4IMKA 3S6CA 5CAYB 1BWWA 2JI1A 3FH8A 4XB3A 3BQUC 5DJZB 4MMYA 4QF1A 1L0YA 1DQDH 3DO1A 2E9BA 1LQSR 5JXED 3X3FH 1LWJA 2FJFB 3L95B 1J88A 5AVWB 3X1NA 4YXHL 5MEOB 5BV7C 2MNWA 3RURA 4K9EH 3C08L 2VJ8A 2QFRA 4TS6A 1ZE3H 2IOIA 1CURA 1RPQA 3FAXA 5AKTA 4P2CG 3O2VL 4L1HA 5SWZA 4LNRA 2VQ1B 3L3KA 3MBXL 3LVTA 2BMKA 2F08A 5D4QA 3X1EA 4UILH 4CC4C 3ZQWA 1U6AH 4WKZB 1DQQB 1NMBL 3CIAA 2AJSL 4L4VB 4XNYL 4YXKL 1P69B 3O3BA 5F6HI 4DP7X 3QJTB 3S2AA 3VSTA 3BVTA 3GSWB 5KW9L 1GR7A 5KYNA 1KN2L 5SX5K 2BSCA 3IBEA 4XN1A 3ZDWA 2NLJA 1T2JA 4N6QA 1TPXB 3DRQA 4L2LA 3U7YL 1EGJA 5DK0A 5TQ0H 3ZHDA 3UYPB 1ZA6B 4BCZA 4G7YH 4AQ8A 3BAEH 3LNEA 1ZCRA 5BO1H 2LU4A 2B2XL 3VI3F 4ENZA 1AVAA 4BGLA 3L5HA 4JQIL 1IGIH 3TU6A 3P4OA 3QHZH 2AK4B 4TSCH 5I74B 3DDFA 4Z7NE 3BPLB 2XRAL 1CIUA 4IDLA 3EAKA 1RHHA 2G5BB 3WN5B 1H3UA 4NOBA 4PY7A 5IVXF 4ZTOL 3N50A 3C75A 1B0RB 3PL6C 4GBXC 3C9NB 2CGRL 3S3SA 4C58B 1TENA 5CS7A 4YPJA 3KPMB 5BS0E 2VDLL 3QP3A 3LMJH 4F7CB 4J2XA 5IR1B 4E0RA 4URKA 1MVFA 2VKXA 3DUSA 3B7YA 3PGFH 4GW1B 3L9RB 2RGSA 1LP9B 4HPOH 4NB7A 3VXME 4Y7OC 4LKCA 4LLQB 5DVPA 4G8IA 4XP5H 2P80A 2DEXX 4KUZH 3QUMB 4PJHA 3QWNA 4H7VA 4U1LA 5C08B 1Y7VA 5F72S 1UCTA 2AK4D 3C12A 1X5HA 2PWFA 1OAYH 2XXCB 4M5SA 4EPSA 3T65B 3DUHA 3I75B 4FD0A 2I60L 3NSCA 4CVZB 1HXYA 3HS0A 2CHZA 3BP5A 3MRPB 3UFIA 4JPVH 3NJKA 3FF8A 3FV4A 4Y5XB 4TQEL 2X9XA 2K0RA 1II4E 1ZSHA 3FO0L 2CMRH 2GITB 4J23A 1QX1A 4NJAL 5DSCA 4Z7QB 2P8PB 3MROA 3CTTA 3NH7H 1UVQB 2VDML 2YJLA 4XAKE 1CZ8L 2EC9T 2P80D 2EINB 3HNVL 2F19L 3GHPA 3QXVA 3N6YA 3WEMA 1MLCB 2WHVA 3HVDA 4GEIA 5IBUB 2XQYA 2E0PA 5A6MA 1ITCA 1S9YB 4QY8A 5C08D 3ULUD 5D2LB 2HTKD 2IWFA 4N2OA 5DFVC 1Y0LB 4NNYA 1CI5A 2Z1KA 3BHBA 5EBWB 3SDXB 1DJHA 1SHSA 1QR1A 3H4HA 2APXA 5FDWA 3TFKD 4PY8I 3DGDA 4A38A 3DTDA 5FYLE 1N0LA 3QORA 2BOCB 1SRDA 3Q8CA 3VXTA 1M7UA 4PRHE 3MNWB 4NBZB 4OI7A 5K39B 4MD5A 5DZOA 2BSSA 3V9FA 3A6CH 5F7MC 1DN0A 5FYKD 1FYTA 3KJ6H 5GJTH 2HRGA 3HE6A 4NBXB 2XX0A 4A7SA 1DHKA 1IILE 3B37A 4G6AD 2KLSA 4MVBD 4U0RB 2ZOTA 1MREH 3U1SL 1EDYA 4CA4A 1BA9A 2AJ3B 3E8UL 5IHLB 3BFQG 1NGZA 1QASA 1RZGA 2QPSA 3HZMA 2CO7B 4JO4L 2ZTBA 5D93C 1DO6A 4HDIB 3O8XB 2W95A 4ZW3A 3VG0L 1NANI 1NMAH 4WV1A 4OQTL 4E41B 3DX7A 4HX1B 4U6VH 3E38A 1M3JA 1JZEA 5D93B 1NAML 4JJOA 1CXFA 1MJ8L 2H2SC 3WKML 3MJ7A 3GUTA 5DO2C 2VMFA 1NKOA 3G5ZB 2EEBA 4Z8FL 1J5DA 5IOPB 2OTUB 2QQKH 1PS3A 4W9IC 4N2LA 3RAJL 5BW7C 4RGMB 1XBRA 1I9JL 5I1KH 2NUPB 2YS4A 4PGCA 3VFOA 3MNZA 1A6TA 4HUMB 1ASOA 2G3MA 1CC3A 5D96B 2EYTA 3HVNA 4XN4A 3QJXA 2NY5L 5F6IC 4YDVB 3VTAA 4DGIH 1D7CA 5J6HA 2XWEA 3CHSA 1JS4A 4CN6A 2ADGA 4MZNE 3GSOB 2EIZB 5E4EC 5HD8C 2YAFA 3LOWA 1X5MA 2QLYA 3H42H 2YUVA 4PJ9C 1F0LA 4L8SA 3VGBA 3CDCA 1UM4L 2ZUSA 3HC3L 5DRXB 3FU7B 4IDJH 2OMVB 4XNZC 2RMNA 1PKQA 1PZDA 1MRCH 2FHBA 1TZOA 2QEJA 4F7EA 1PLGH 4HUUB 4UMSA 4EIZC 3LZFH 2ZYSA 1NFAA 4OZ4A 5AOMA 5GRWA 3E0GA 2F6AA 3AXLB 4YDJA 3EGSB 1B4RA 1RAMA 4ODWB 4D8PA 2MCAA 1IBZA 2WIIB 4XNZB 5I8CA 3ARYA 1S3KL 2HFFB 3MOQA 5D7HA 2DIAA 1G6RL 1F4YH 1NFIB 4G5ZL 5AAMC 2WQSA 3R0NA 3QPQD 1E28B 2NZ1A 43C9A 4Y4HA 3AS0A 3GIVA 3QXDB 4Z3FA 2BP8B 4TNWK 2CUAA 4E5XG 2WWKT 5DQJA 5FUCE 5DMYA 3ELAT 4YN3A 3FU6A 3EYUL 4U3SA 2Y07H 1A3LH 3R4RA 2PETA 2QHRH 3EYSH 3VFSB 3IDIB 1I7UB 1Z7JA 4P57B 1YEJL 4OGYL 4MQXD 3THMH 3PCYA 3NRQA 2WBJD 2GJ6A 2NXZB 2XSKA 1SUJA 4GRWF 1HS6A 2GVYA 4FNLH 2WPGA 4WSGA 3QISA 1OP3K 3CZSA 2VXVH 4OIAA 1T1ZA 3MV8A 2C3VA 4MHHI 4Y2DC 3DV4A 4MAZA 4Q6YA 5JIKA 3VI4B 4D0CA 1ZWIA 3HA0A 1N70A 4KMQA 3O6LH 1Z32X 3DOSA 4GRWH 3SDDB 5A2BA 3C2AH 4XZUA 2NY7L 4ONFL 3EH3B 3ZZQA 4LMQE 3QNXA 4PJAB 2EUXA 4AJVA 4G2AA 4JREC 3W0WE 3TS8A 4X8JB 2NXZD 4IBTA 5F96L 4QXVA 4DPBX 3BPNC 2XG5A 2D0FA 4O5LH 4JHWH 4CADA 1O6VA 4JREB 1E65A 4RMBA 2GEEA 2IDSA 4UTBH 4WJKB 5F3HB 5FCUL 5AAWC 1JP5A 4YBHA 5JW3L 5K9JL 1NTDA 3HRZA 1A7OH 1BYPA 2PWHA 3QUGA 4A6YA 4O4YH 3K80A 5B21A 4J8RA 4FFVD 2A6DB 1DJZA 4XPAL 1P7QA 2YQ2A 2YRPA 1JGLH 4KDTC 3SCMA 1GW0A 3MGAA 3SDDD 2R51A 5CGTA 1WH0A 2YUWA 4AXWA 1S7QA 1U41A 2BDNL 3G6DL 2AXFB 1YAZA 3GSVB 1HXMB 2FECL 2YA1A 1TJMA 2A6IA 2WXLA 3BFWA 3JV4A 1WS8A 2N4IA 4Z78A 1D5XB 5A2KH 3O2DL 4H26B 1K6QL 4GOSA 4K5MA 3CHXA 2VR6A 4J3XA 2B3IA 4QRUA 2Y5EA 5A2FA 3L3HB 1A6AB 1FNFA 2J43A 3OLDA 3KBFA 3N85L 3FSVA 4BBWA 2ORBH 1P7QD 1IC4L 4L3EA 3SCMD 1A3QA 5FKPA 1S7VB 2KS0A 5IHUH 5SWZE 1IX2A 2OX5A 3D50A 2E76C 2F54A 3HJEA 4AQ1A 5JOEA 1DZBA 2LOEA 1DQDL 3SYPA 4AR1A 1TYJA 2F8VA 5KVGL 5CP7B 4YNYA 5GRXG 2W38A 4GKZA 3P7VE 4YSDA 3AWGA 5JS3E 4GXFA 3FH7A 2A9ML 4DO4A 1I8LC 3LKOA 4DN4H 1HQ4A 5C97A 3QS3A 1SHWA 3BAJA 2MNUA 4XX1E 4ZMQA 2WN2A 4RMSA 3O81A 3WXWH 4MZ3A 4GIPD 5F88B 2DJ4A 3FQ4A 4UILL 2ZG3A 3LRMA 4XXWC 1AZBA 1U6AL 1R3LB 3EFFA 1PDKA 2HRLA 5AYTA 8TLIA 3ZRSA 4UZGA 4BQ9A 1L4IA 2O4EA 3LV3A 3JWOL 4TXVB 4Z7UF 5A2LH 4DKDC 3IVKB 3DHJA 4QHNB 1FFOA 4OZHF 4ZFZB 5HDQH 1CT8A 2AK4E 5TQ0L 5EIQA 3ZVVA 4N8PA 3IMTA 4G7YL 1KR6A 1WA1X 4J4PD 3LIUA 5BO1L 5J11C 4XXDB 4MD0A 4PTTB 5E1QA 3II3A 3FUNA 4WZ9A 4P3DA 4BQ8A 1M6OB 1TSHA 3BP7B 3VGEA 1FF5A 1QBMH 1W8OA 3T09A 1HOCA 3EH5B 2G4GA 3PNWA 1A6PA 5ESVB 4DP6X 3OZKA 4H1LH 4JO2L 1RLBA 4M48H 2AEQH 4KVPA 4X7SL 5TTRA 1FSKC 2ODHA 2AJUH 2HAZA 2DPKA 2BJMH 3LS4L 5DA0B 3ULUE 2X70B 5CUSL 4FERA 4EVNA 4I88A 4XP1L 4XX5A 5HI4C 3KBPA 3X1GA 3PGFL 3RI5F 3VMNA 3GMNA 2YIHA 2D73A 2X4PA 3JV5A 4FQ1H 4W70A 2Q7AA 3RRQA 4EDXB 1KXVA 5TD4A 3Q9QA 4XP5L 4BSWB 2D0HA 1XZ0A 2A4CA 3EGXB 4NT6A 1WZLA 3WJLA 3FCUB 1A1NB 3KVQA 4JM2A 3KPSA 2E27L 2VT0A 1OAYL 5FYKE 4WI9A 5DYOB 1AY1L 2DIBA 2QSCL 1B3JA 1ZT4B 1DQLH 1EXUA 4XP6H 2F58H 1DZ0A 1L0XA 1YNKL 4KAQH 2IPTH 4DO5A 1MWAL 3QRGL 4N4YB 1EHAA 4L1TA 5JORA 3HN3A 3D39A 4XNDA 3UAJC 3KYKL 5DD6B 3NH7L 3RWCA 4RWYL 3P0YL 3GMLA 4LRNL 4C4KT 3SDXE 4ABVA 1G7HB 3F12B 3FU0A 2C4FU 4AZUA 2J6EH 2Y9RT 4DPRA 5I23A 3WTXA 1YEEL 2WNXA 3U36A 3KPSD 4OUUA 4XPFL 3KCPA 3PP4H 3QWQB 3B6SA 3CJJA 1JV5B 5FYJL 4FNPA 1TVBA 4D9RD 3T0DA 4P4KA 3CXHJ 5KTEL 2YD5A 1ROWA 3TNMB 2C9XA 2VUYA 1M7IB 2G75B 2VDLB 3H3PH 5AUMB 3VFMB 3AJ7A 1H9DA 4AEFA 3U1PA 1L7IH 2HWZL 2BFVH 1CD9B 3MOBH 3W56A 2J1WA 1NGYA 1TMQA 1TJGL 4DOHB 4G1EB 4JY5L 3O9WA 1RUQH 4U2YA 1NC2A 4WTZA 5EWIH 5I76B 5FO7A 4ESKA 2EDLA 1WAAA 2TSBA 3QIBC 4P2OC 4WO0A 3T2OA 1MI5A 2A9NH 2K70A 3ISWA 1AR2A 5DRWA 5ANMB 3RDJA 3UPRB 1F97A 2C9AA 3AY2A 4G43A 4P4KD 1HH9B 3LAFA 4DCQA 2FATH 4OF6A 3RX9A 3SD5A 1DSWA 3QIBB 3MLRH 2B08A 1NIFA 3E2HC 3QWOA 4XPHL 3ESPA 2F68X 3UTTA 4PV1C 2IQAB 2VDMB 4H0IA 4J5VA 3L4UA 3O9WD 2Q3XA 3KNBA 4ZFGH 2JI2A 3H8NA 3QGVA 2CIIA 3H3KA 2AEWA 4PJCB 2SEBB 3QZOA 1J9RA 5ICZA 1G0DA 3S0PA 4RRPA 4IOSD 4RBPK 3K4DA 3B8SA 1AH1A 4BE5A 3C60A 5I66A 5DZPA 3ULVF 1KCVH 4UWQB 5EORH 3WXVL 3GTVA 3VFPA 4UNVA 4UU9B 1YJDL 4UV7H 4DGIL 3SQBA 1HZHH 2XYCA 4M3JA 3FB5A 3H9SA 4GW4A 5TPWL 3GMPA 4PTUB 2R1WB 4LEBA 2RFXB 2VDRH 2FJSA 2X4OB 4OCWL 5F71A 4FABH 7TAAA 3SYCA 3ULVH 4KKAC 1YECL 4PJEB 5IB4A 1N10A 5BRZB 2DMBA 2PW1B 3A6BH 2HT2D 2IPUG 5HPMB 3GYRA 1PZ2A 1EHKB 1FZKA 2W60A 4LLAA 3ENEA 4FCAA 1GZQB 1XX9C 4BYHA 4WI8A 5KBPA 4TLSA 3RGVC 2NY4C 4KFZC 4YH6A 2AQTA 1NAMB 4B9CA 1GY1A 2IAMC 3S5LA 1KBBA 3O6FB 3F7QA 5L3UE 3RGVB 3V5HA 2BWQA 3PGDB 3SY0A 1UUSA 1OTTD 4NP4H 5TE4H 1WCQA 1UTDA 1HHIB 3QJQB 1BLNB 3P30H 3K6NA 5HDBF 1CFNA 3GJFH 1CFQA 5AW8B 2QPEB 1TFHA 5IBUG 2NQDA 4QHLB 3LQAL 3RZCC 2D31B 5KSAC 1I8MA 3PDOB 1EX0A 1J5CA 1LDSA 3KE0A 1G7IB 2XV0A 4N68A 2YGQA 1L9MA 3RX8A 1UM5H 2Y07L 2YK1L 4AUYA 3WFEH 2R69H 3EOYG 1KPUA 2AERT 3W2DL 4TQ8A 2B1OA 2JB5L 3TIDB 5EUKA 2ENYA 5I1IH 5BOZG 1WO2A 2HXAA 3TYFB 5D8JL 1X7TA 5AG9A 2WY3B 2IC2A 3O6FD 2VAJA 4G70B 4YUEL 4FNLL 1C1EH 3DPBB 5J1TC 1YPZA 4ZFFB 5JHLL 2BNRB 2YGVA 1U8PA 3BVWA 3KLSA 1FA4A 3EOBA 3RWJA 2X4UA 4PJAE 4NPYB 1GGTA 4W1TA 5D7IF 2DQTH 1GSMA 1CDHA 4D9LH 3AROA 4ZYKB 3WFZA 5BJTA 3NBNA 1CYWA 2G30A 4JN1L 5DLMH 4F9PC 5EF3A 3O6LL 4IOIA 4N0RA 2JFCA 3C2AL 4L8DA 5L7XH 4MB3A 1I3GL 2C9SA 2EXYC 4X6CB 4DVBA 3HOGA 2X4TB 5EOTA 4Q52A 2CBPA 4OZFH 5F70A 5C0JA 3DV6A 4JRLA 3EYVA 3WO3B 4LRIA 4W9KC 4O5LL 3ML8A 2ZAIA 4JJHA 1FZOA 2DQIH 3WTTA 5A3IC 3ISRA 2GW5A 3QJHB 4JO8A 3IT8D 1KGCD 2C9QA 3WFBH 2UXVA 3KLAA 4Z0BH 3UO1L 5IBTH 2EIKB 4XBPB 1NFDB 1W2KT 5EO9A 2MHAB 1JGLL 1IEAA 3O0LA 2EDFA 2P8LB 4LFHG 4NCDA 1AKJB 4G6ML 4IU2A 3G6JA 2KYIA 1X9LA 4L3EE 4RNRA 5I71B 4PWFA 5AYUH 1VEOA 2VN3A 5FFLA 1KTLB 4NJ9H 2ZNWA 1S9WA 4K7PH 4F20A 2HVKA 5AZ2L 2FIKA 1AS8A 2NNCA 4PS4L 3WS3A 5I1JL 3U0WH 1G84A 3EXLA 4KZ0A 1A4KA 2FR4B 1PX4A 4JHBA 1U36A 3S3DB 5AOIA 4M65A 1G7QB 5ACLA 2BXZA 1ZHBB 2UXFA 5IP4A 2Z9TA 3MX0A 3B9KA 4QKXB 5IHUL 3UJTH 3QFJA 3HUJF 4TN9A 4TVSa 5F7KC 3CU7A 3CUPB 4ACPA 1X44A 1PZBA 1INDL 2ZWKA 3EFDH 1IM9A 3N40P 3FFDB 1EEZB 1IC7H 4ZDHB 4AGLA 1P4BH 2ESVA 2ZKYA 3LDBC 4Z7WF 4Q4EA 1NFKA 2G4EA 2FUTA 1E7UA 3UAAA 4PRIA 2QR0B 4L4TB 5I1LB 1RJYA 3MA7B 1E2ZA 4U3XA 4L0PB 4GP5B 2OM5A 3B9VA 4N0YH 1XQ4A 1MZYA 1MUJA 2R7EA 3QJOA 1KS7A 2F15A 3BZEA 1T1YB 3V4VA 2K4WA 2XZQL 5IJCC 4DZBA 2EVIA 5JNYB 3EHBC 4CSTA 2RACA 1KJMB 4KK6C 2AEPH 3UBXA 1X7QA 1BQHA 5HY9B 1F6AA 3T8HA 1DE4B 4M61A 5T33H 2BS9A 3CHPA 5HDQL 2GJJA 4ONHB 1RZ8B 2VDPL 4NPJA 2O5XH 4N5ED 3V0VA 5GS1B 2VGLM 3QJZA 5JIHA 3CGTA 3O3EA 1XCTB 4Y16A 4ELDA 2LVCA 3BVNA 4LAQH 4PJBB 3AGVA 4L4TD 5F7WC 1QBML 1XH1A 2G2NA 3RTQA 3BH8A 1C7TA 4K9EC 3QQ3B 2EDOA 2BS8A 4B9GA 2W1NA 3KYNA 1NCNA 4KI5F 4BFNA 2ZXCA 1VERA 2X89D 3SQRA 5TF0A 2AJUL 2GY5A 1DVTA 2R4SH 4P23A 3KPSE 5AB1A 4QDGA 3ESVF 2EXSA 1UADC 1BZDA 3ARRA 3IMVA 4OD3L 3TH3T 2L7JA 4D9RE 4KJQC 2VXQH 1SHXA 4WI0A 3V0AC 3QUHA 1I3UA 2RD0A 3O3AA 3MYJA 3BW9A 4AQEA 4LAJH 5AKSA 3DJTA 1R3JB 4CMMA 1VCBC 3RTQD 3SB3A 1NGWA 1PPIA 4H40A 3S3CB 3X2QB 1ET7A 3EJUA 4N2GA 4FADA 5DWUL 5HGHB 5JR1H 2AAAA 3V6BR 2QPDB 4BV1A 4HOZA 4TTDD 3WFDL 2XQ0A 1AHWC 2V7NB 1UWGL 2CE6A 3T2NH 4AH2B 1DQLL 3NJGA 3P3SA 4P23D 2F58L 4XP6L 5F8QC 2NDFA 4X80L 4NSKA 4AYFB 4HS8L 3ES6B 4KAQL 4JG5A 4YBLB 4MRCA 3HZ3A 4K71B 3NT0A 4UB0H 1MJJB 1CN4A 2GUOA 2JB6A 4UQ3A 2IG2L 2BIOA 1GGCL 4AKOA 5C3IA 3GZPA 4FKHA 1WG3A 1YO4A 1ID2A 3ARBB 4AX3A 2WB7A 5ADPH 2A1WH 3LZLA 4JO5A 1UQSA 1DUZA 3IU3B 3E8VA 3UX9B 5IESH 1FV1B 4M1GH 4DOHE 1RZJL 1D7BA 3DMMA 3KL3A 3SDAB 3VXQA 3CFJA 4NENA 5IW1B 3VI3B 2FGWH 1K4CB 3IDJB 5F9OL 3FQUA 3ZTJG 2R2EA 3RL1A 3FZUC 4N4EE 1PZSA 1WT5C 3C8DA 3G5YA 4HWBH 3MOBL 3KW8A 1BFVL 5ANME 1YEWA 2IBBA 3T0BA 3BSZH 3NVQA 2V5TA 1JXJA 5IVXB 4WUUB 4JRYA 4AKPA 3N21A 5DEFA 5C0DA 3FXPA 2QVIA 5HHNB 3DX8A 3CLEL 5T5FA 3U30C 7PCYA 1HFUA 5I8EB 2CJSA 4ETQB 4F7TB 1B0GB 3EJTA 4K5LA 3ARBD 3MRQA 4GQZA 1YEGL 2Q2EB 2G9HA 2FATL 3QEHA 1JNNH 1NJ9B 1G7MB 3MLRL 4OFQA 1NOLA 3SDAD 3UP1A 1G7LB 1MWAB 1WBYB 5EBGA 5KJRL 3MYZA 2K45A 3BZDA 5JDJA 3B7RL 3NTCH 3QJFA 1NBZB 2NMSA 1FH5L 4RAVA 1RPUA 3CHQA 4M7KL 3L2NA 1QYGH 3IETA 4E2OA 2X0WA 1HILB 2Y6SC 3LKSB 2UZXA 1GH7A 3CK0L 4XXCA 2HT4D 5I0XA 2AEOA 2WWMD 3L3GB 1DDTA 5F7DB 5KVMC 3H9SE 5I82A 4N87A 2DAVA 2EO7A 2LTQB 2VB5A 5DJ6B 5E99H 2H8PB 3NCWA 1E5UI 3MR9A 4Z9KB 4AGQA 1KKKA 4UBDD 3P4LA 1KB9K 3D9AH 2B9AA 2QKIC 5IROA 2BVQB 3UACA 5DQ9B 1JXFA 1ZVSB 1BOGB 4A63A 3SDCC 1OPGH 5H4YA 5LJYH 2X5PA 2Z4QB 3ILQD 2VZOA 4TLKA 1KBVA 2X4RB 4UTAH 2QKIB 3GKWL 3KLKA 3D33A 3F04A 2FLBT 5FECA 2VDRL 4OV6F 1ITBB 3U7WH 1H0DA 2XETA 3AGWA 3ULVL 4CKVX 3A6BL 3S4SA 4NRXA 4P59L 1T1WB 3RNKA 2EECA 4WEEA 5IHHA 4MNQA 2NY1C 1LJMA 5FYJD 3CPLB 4D7BA 1TCMA 5MEQA 4ODUB 1HX0A 3M7FB 5IW6B 3RGBA 4Z7OF 1MKFA 2Y0SA 3LH2H 1UH3A 4PG2C 5L8JB 2VXSH 4FI7A 2EDEA 3BKCH 4HIJB 3VA6A 5CLTA 5MERB 3VTMA 2ZICA 3P30L 4JY4B 4M7ZC 1WAPA 3DBSA 3L5XH 3V4PH 3VH8B 5HYFA 3ARFB 3BMWA 5FM4A 3FCSB 2WP3O 1UM5L 3D4CA 4K55A 3ZDYF 3WFEL 1BQLL 2DLFL 2GABA 1MCWM 5CGMA 1KTOA 2MWCA 1H5BA 1VIWA 4AK1A 5C0RH 3JQOB 4PQXA 1HHKA 5AWNL 3N04A 2IMNA 5KG9B 1D6EB 1KGCE 3NJXA 1SN5A 3EOTH 4P5SA 5B7EA 5I6PA 1EO8H 3OJ2C 3OHXB 3FRUA 1QUNB 4MAYA 3S37H 2H3KA 3QRFM 1VFBB 4RA0C 4LSUH 2QGDA 4ICXA 3ARFD 3JTSA 1T0MA 1JTOA 5KVFL 4YSTA 3PWJA 2JI3A 3GIZL 2CPCA 4L8CB 2WGXA 1G7PA 1Z0NA 2AXWA 3H7LA 1XB8A 1YNTA 1JMXA 5BZXA 1OGSA 3QDHA 3FUMA 2DI9A 3IF1B 2MOVA 3W9EB 2I7OA 1PQZA 4UAHA 1EHNA 1X5GA 4K7FA 1DJSA 3TFBA 2YD4A 4OJFL 3JTBA 3N0AA 3FTGA 2C7UA 2J7LA 2V9UA 3WMPA 4Z5RB 4MAYD 4DN3H 5JVIE 1O7SA 4GW5B 4FQQB 1NFDE 3IDXL 1MRDH 4QNPE 4ZD3H 4AWJC 4A7TA 4II7A 2ED9A 1U3NA 4P5MA 4YAQB 2F5BL 4H8PA 1F6FB 4F3FB 2P5EB 3Q05A 1JJUA 4Z0BL 5IBTL 3PIQB 5IT2L 3D0LA 4YC2C 4FYSA 2AQNA 2W94A 4YDKH 2Q1EA 3GSXB 5DLHA 3ZGHA 4U31A 4WI2A 4AJYV 4CJ1A 4NQCA 4ZAKA 4F92B 3UZVA 3UMTA 2XWXA 4G72B 4AMKH 3VWKA 2QMKA 2A74C 3QZMA 5K1JA 5JHLA 5JIPA 2VW4A 2J73A 5AOJA 2IGFH 3TCLA 4IGBA 3PHOA 3BH9B 3P7PE 1TZIA 2OR8A 3FQNB 4G6KH 3LXBA 1VFUA 5TK4A 3DOIA 1G9NH 2A74B 3EDDA 4GRWB 1PJWA 4RFEA 2CDEA 3HNSH 2P5ED 4OGAC 5EULV 2MOQA 5ITBL 3F62A 5L0QB 5AB0A 4UIKH 5JHDB 5AVQB 4KBPA 3CC5A 1LO4L 4P4RA 3ZRCC 1KUMA 3MLZL 4L4TE 4ZAKD 3EFDL 4V2CB 2PCXA 5I8OH 3ZZLA 1NL0H 1F18A 1P4BL 3ARDA 2XTJC 1HWWA 1R3HA 2EVJA 1UB5A 2NSMA 5HHPB 5G4OA 2CO1A 3S8WA 2FWUA 3Q3GB 3MUGA 3WY2A 5IEKB 3ZSSA 3NN8B 4FQIH 1JZDC 4N0YL 1XF4B 2XTJB 2IBGA 3V5KB 1DBAL 3FYIB 3OKOA 2DLIA 3GLZA 1QNZL 4NO2B 1EWHA 2WTRB 1PNCA 3BWZA 2EADA 2YQBA 1FL3A 2RTTA 3ARXA 3MRJA 1TMCB 1AO7B 3KYAA 3IDNB 4Z7IA 4HV8B 4MBRA 3BKYH 4PJBE 4AR8A 4NNXB 4KXDA 1UEYA 3FQTB 1H3TA 4YHKH 2ZNXA 3QCUL 2ODIA 5I1AA 5KVGE 5E4IA 4L3AA 2BVOB 4U3HA 4JO3L 3HLAA 2FAUA 2OMYA 3A22A 5F93C 1MFCH 4EZLA 3BP6B 4QCIA 1IIIA 4PJ7A 1AMXA 2LFEA 5C0NC 2OTWA 5EC2B 4WK0B 1MPAL 4J3SA 4GI9A 4XMLL 3ULAB 4KHTH 1THCA 1NCCH 1OP5K 1E9OB 1M2OA 2VN5A 5F7AA 3WTYA 3RNQA 2VXTL 3TEUA 3FTZA 1QNIA 1TTGA 5EOCJ 2JKIS 1IGML 2OSWA 1QW9A 4ONOA 4BCXA 4HG4K 3HBZA 4CW1A 1ADQL 3TA3B 3OJVC 4IBYA 1XVSA 2R56H 4I4WB 5TF1L 4JFQB 3GTNA 1F4XL 1UASA 1OW0C 1SXBA 3WNNA 2NYYD 1A3RH 1FNSH 3CVBA 1QPKA 3PHQB 3WD5H 4AG4L 4PV9B 5IQNA 1NBCA 1RJLB 4LLYB 4GP4B 5JR1L 1Y07A 3OPUA 2DQGH 3K71A 5HYQA 1RK0B 1HEHC 3BMVA 4LGSB 3I50H 3MREA 5IY5B 2P43B 2E4TA 4BZ1H 4HCRA 1BZ8A 1SDDB 3IKCA 1ESPA 8CGTA 4PVNA 2J8UB 5CXPA 3VFUB 4L8BA 4NGHH 3H7BA 5HVWA 2YD6A 4J2QA 3SQOL 3T1FA 5ACMA 1KPRA 3TN0B 4XMTA 3MRRA 1UKSA 2WMPA 3VXSD 4XO4A 3TP4A 4QRSB 4I0PA 4P5TA 4V11A 1KCRH 2DQFA 3TBVB 3SEPA 1ILSA 1Q72H 3C8KB 4KDWA 4Z7UB 1P5UB 2APVA 1AXIB 4OZHB 5D9SB 4NQVA 4O2FB 1GL4B 1COBA 2YXFA 2XC8A 5FA3A 1W91A 2D3LA 2X88A 3DO4A 4IS6B 4Y4KB 5MP6L 3VU1A 4EO5A 3AG2B 4JRYE 4N85A 4PLJC 5BUPA 3QXAA 4IIZA 5IESL 1Q9KB 3KVDD 5DPEE 1B4TA 4Q6IC 2YPLA 1EUTA 5IVXE 2XTLA 1VEPA 1BVZA 1DBBH 3OAZH 2CALA 5DS1A 2W8CA 4NUMA 1FC2D 3P7SE 3K2MC 25C8L 3IB4A 4GQQA 1UXLA 3TN0D 3BSZL 4FFZA 4Q6IB 4CDGC 1AHKA 4DT2A 2VM3A 5D71H 1IGTA 4KXCA 4OFYD 3DX0A 1XTLA 3D0VB 1DFXA 3OXRB 4XO5A 1T5WB 2AGJL 1X5AA 1KF9B 3RI5K 1TTCA 3CSYB 1WV7T 5T1DL 5F7FA 4KTEL 2YD3A 1QSEA 4LEEA 4OF7A 5AG8A 5BVPH 5A43C 1JV2A 4AE0A 4GKLA 4TV3A 5IB3B 3B3IB 1JNNL 1JAEA 4Y9EA 1I9IL 1G94A 1SXCA 2WVUA 3EO0B 3CVHL 5JZ7C 4HCFA 2KLTA 2CJ3A 3G04A 3IJEB 5FYJE 5ERWA 2BY2A 3SBWC 4WHYH 3TIEB 3V0JA 3CZLA 3P4NA 4GT7A 1BVLB 4Q9QH 4Z3GA 1A9BA 2B7DT 3CLFH 1DLHA 5C09B 3FN9A 2CBQA 4OLZL 3FQRB 4A39A 4P2RB 3JSSA 4YBQD 5JHAA 1U92A 2QTVA 4LSQL 4S1RH 5IK3A 2Q76B 4AL8C 4B52A 5KYXA 2EH7H 4AJ0A 1EUUA 4DGVH 3KJ4B 1D5IH 1NSNL 1C5DB 2TRHA 4MNQE 5CEYA 2ZOKB 5DDHA 2J1XA 4JKPL 5IFAH 4PIRF 3L95A 4JFVA 1QHPA 5I1DA 3BQUA 1OANA 1BSIA 4M4PA 3O3DB 3LEYH 3DJRA 5CZXC 1XF3B 4N0UB 1HNFA 2QT6A 1WCBB 5AZEL 1TTRA 5BZWB 5C09D 4I2XA 4DTGH 3L4TA 4ISVB 5EOQH 3AQZA 4XCCH 2VQ1A 4P2RD 4MA3A 1XGTB 4RMUA 3OKNA 5DZAA 4CMHC 1P7KA 4HOMA 2BVYA 1FORL 5J57B 4HEPG 5DJ0B 1IZJA 1WD8A 2NTSP 4K07A 3LH2L 4TQIA 4Y19B 1JCKA 3GSWA 1NBYB 4CMHB 1IBDA 1WZ1L 2BSRA 4JANB 4HUKB 3JWNC 1D9KB 4X9FA 2FJHB 5B1CA 1S7WA 1F56A 1MCOH 3EYQD 4UDUB 1ZLWK 1ES0B 2K9FB 1ZLVK 1TO4A 4JLRA 2Q8AL 4DK5A 4HAGA 5IF0A 4G7VL 2FX7H 3GO1H 4QHKJ 4NXKA 3FTWA 1S9VB 1ID5I 4OJDH 5HGAA 4YPGA 4HWNA 4DJMA 2DKMA 4N5UA 4LQ1A 1OGTB 3ETSA 5GGUB 5C0GB 3FRPB 2ZX6A 5C0RL 4Q9RH 1KC5L 3EJCA 1UXSA 4X2UA 4HKBB 4XZ4A 2G5BA 2ZWZA 3NQXA 1DR9A 2X7LB 2AANA 2DWDB 2FWOB 4OLWH 3EOTL 4LLDB 2AK1H 5CZRA 2CD0A 1B0RA 2YMXL 2VDRB 1J86A 3QQ4A 1SVCP 4XOEA 1D9KD 4WI5A 3MV7B 2EUWA 2J1ZA 4FXGB 3WTWA 3S8FB 1OB1B 2KKQA 3PL6A 4GBXA 1XSIA 1S6NA 2X2IA 3JWDC 4U05A 3OKKB 3RIFK 4B3VA 4LLQA 1LE9B 3AAZB 4Y1TA 1HT6A 4C4BA 2EQDA 3QQ9D 3ARSA 3F84A 2X41A 3HFML 3LB6D 1QLFA 1E6OH 2Y2YA 4MLIA 2G5RA 2ED8A 2QGEA 5CN3A 2R83A 2CUIA 4AQAA 2Q86A 2P5EE 5E8DL 4OIFA 5GGSY 2UXGA 3GJFB 4DN3L 1UOVA 4XPBH 3MRFB 2QDVA 3F7PC 3Q9PA 2VN7A 3ULVD 3X11A 3RDTC 1E5YA 2W07B 3QQDB 4IKIA 4NZUH 2EC9U 1FNGB 1KGYE 4YR6A 1Z3GL 5I0DA 1FJQA 2BVPA 4NM8H 4CC0A 1ZHNA 4YDKL 4ELMA 1EZVX 4DEPB 5HDBB 2R0WL 3G6AB 1S9YA 1UD4A 4NOFA 1BAFH 4HUXA 4O2CA 3P2BA 2W0KA 4MXQD 2ZQKA 3VRLF 3HPJA 1ZLUK 2J44A 3ILEA 2BP3A 5EBWA 4WFHD 3MRIA 3R06B 4LOUC 2C1PB 5D2NC 5CHNA 3RL2A 4CGUB 4CN4A 4F37K 1U8KB 4ZZFA 3UERA 4OI8A 2GT9B 2FEEI 3QUXA 2DM3A 4TUUA 3FB0A 1FVDA 3ZKMD 4LK4A 3CDYA 5JPNC 3FCBA 3GBDA 5DVKA 1CE1L 4QAWA 2FEDD 3JUYA 2B16A 2HX9A 4U6XA 3NFPB 1KYOK 1XSJA 2A4ZA 4PJ8C 5GRUL 1M7DB 3WCYA 2CJUL 4PD4K 1QRNB 2HT3D 3EYFA 5K69A 5JPNB 2CO7A 2XFXB 5C0IB 4KGJA 2BC4B 2ZUQC 4I8DA 4FQCH 4OZFB 3DGGB 3MRMA 5I0ZA 2H6PB 1HSAA 2WM0A 4U1HB 1XFPA 1NL0L 3JZYA 4PJ8B 4LKXA 4PWJA 3U4EA 3VH8G 1RIVH 1WISA 1NOAA 2B9BA 4MJ5B 3T9WA 3QUXD 4K3DL 1BM3H 1H3PL 3BDYH 4ZMXA 1THAA 5L8LB 4FQXA 3SZ6A 3WSQL 2HPTA 1VGKB 1MCIA 1I7TA 2VLMD 2DYRB 3SJVA 1ZLSH 1LO2H 3TZVC 5C0CA 1JN6A 3IJSA 1A7RH 1U4GA 4MA8L 1SZNA 4DESA 3RKDC 3OKEA 5HHVH 4W9ZA 2D7PA 5A6LA 1DQJA 4NAQA 1UM6H 1KL6A 2GSMB 3P4MB 1QRND 5KN5B 4GFTB 5FA4A 4DVRL 3BKYL 2NR6D 5BW7A 1BAGA 1LTXA 2XN9B 1CDUA 3HR5A 4NZJA 5C0AB 1PFOA 5IHWA 2A7GE 2ICWJ 2IPKB 5DEJA 2EDJA 2QMJA 4FQXD 5DR5L 2XA3A 2CKBH 3FQ2A 1KCSL 3NIFE 1LEIA 5GHWL 4NO0A 4B5EA 1IKNC 1YYLH 5C0CD 5IV2A 5I1EH 1IFHL 1W0VB 2UZYA 2P28B 5DRXA 5JA8B 2VE6B 2OMVA 5ES4B 1UEMA 3P7QE 1AXSA 1V7ML 4LCUA 3VXSE 3FB6B 1U8MB 3D08A 1QI5A 2I07B 4PJ9A 1YEHL 3TJHD 1DJYA 3BUQA 3H6AA 4MJ6A 1ZD6A 1LNDE 3H54A 1BXXA 4HH9A 4JDZB 4FA7B 2Y6TE 2XN9D 2YA2A 3HMXA 4L2YA 1S7XB 4GRLB 5E2VH 3FGDA 4LDEB 3RY4A 2FJGB 1XIWB 4PJGF 1SY6H 4PJ5A 4YDLC 1UXWB 3L2MA 2WQVA 3MLXL 4HC1A 4ABUA 1NGQL 5ID1A 4GG6A 2J4WH 3EF4A 5K5YA 3ZSTA 1A9EA 2GFBB 2J8UE 4HKJB 4Z7WB 4M4RB 5AAMA 2KQNA 3FOLA 4U1NA 5CZKA 5GS2H 3HZVB 2B59A 3G08A 4QRAA 1QTPA 4KXZH 4PUBH 5I0VA 4PJ9D 5IHZB 3OZLA 3HRPA 3I50L 3CFDA 1EEQA 4Z7UE 4KJYB 1VPOH 2X4SB 4NGHL 3VM7A 5B8CB 2IDCA 2DQ6A 4OZHE 4IRSC 5KBNC 4AR9A 3ATBA 5CINL 5EUOF 4LEXH 1FN4B 2Y06H 2FWLB 2JKJA 3SGJC 3OJMB 3EOAA 5C0EA 5CBAA 1IAOB 4GRLD 1KCRL 4IHOB 5DK2A 1DUYB 1XIWD 3OR6B 1BVOA 5DO8A 2EDMA 2UZIL 3SGDI 3QDJA 3TPKA 4IRSB 4MHHG 3MRHB 3IPEA 4WTWA 4UM8A 1TCRB 2V8LA 1GSKA 5BQ7B 4K7PY 2O5NA 1BZ7A 4OTXL 1MQKL 1YYML 1ZPUA 2OZ4H 4ODHH 2ED6A 4Y2DA 1OE3A 2R2HA 2BSED 4NO3B 2XWDA 4JG0H 1NC4A 1F2QA 4IIQA 3OB8A 3PWVB 2MKLC 3BE1H 3GS0A 3FCQA 4D94A 1OZTG 3NSFA 2YN5A 4TULL 3QDJD 3EBGA 3P11H 2C3WA 3KDMA 5DJYA 4XBGA 4JR9L 4FXKB 5HDLA 5FKAB 2QDWA 3ME0A 5J6SA 1GAFL 3I6KB 1KG0B 1FC1A 2BSBA 4NUPA 1XEUA 4XAWH 5A7EA 3DVNA 3QJUB 4Z7VF 3REVB 4FTVB 2A6DA 3IFLH 4AM0B 1N68A 1T6WA 1C12B 2W81C 3UJIH 4AIEA 1Z66A 1U93A 5C09E 1FJOA 4H4NA 5BXFA 5DD0L 2YQ3A 4P2RE 1JFQH 1N9PA 3MFFA 3BZ4B 4WCYL 5H8DA 4KDTA 1WBZB 2CSPA 3O2WH 4K2UL 2JLPA 3CLFL 4KI5D 1EXHA 3D7PA 3PAYA 1BW8A 1H6TA 4Z95H 2V2TB 4ZQKB 3L3HA 4PB9H 1I1AC 3EDEA 2DYPB 4MQ7B 4S1QH 2BHFA 1TUPA 1IC1A 2O5YL 5T1LA 4JZJC 4X0NA 1GC1C 4R5XA 12E8L 5D1QD 4FTVD 3QJSB 1FNEB 1YEFH 3TT3L 5IFAL 1ZDQA 5EDXA 4BK4A 4XNXH 2XVLA 1XGZA 4N8CH 3RQ3A 6PAZA 4Q9BA 1TKWB 3KYMA 3NPZB 4U6YB 1J0JA 3L3IA 3LEYL 3L5WA 2WQXA 3WEXB 5AW5B 3AC0A 4KH2A 2Y5QA 4DTGL 3L5IA 1OCOB 2Y23A 2CCWA 3GQFA 2YWZA 5EU6B 2BW5A 4YDNA 2H6OA 5JOPD 1E5BA 1ZOXA 2DYPD 3OR7A 4F15C 1CDGA 1OAXL 3CVHB 3MSFA 1QLRA 3PV6A 4ZSOB 4ZMVA 2CLRB 3WUWB 3QYNA 1I4FB 5H2BA 3S36L 2V5RA 1DEEB 5DJAA 4BWWA 1X5YA 4M62H 4YWGH 4EEEA 4GUPB 3EADA 1HKFA 3DURB 3RVXD 3L81A 32C2B 4ZFZA 2BNUB 4MCYB 5FR3A 3EJJX 4JG1H 1AD9A 3LKNB 5IGXL 3WL9A 4CGTA 2WNWA 4QGYA 4TVPH 3MRGA 3V8OA 4C56B 4AY0A 4BFFA 1CFTA 1JI2A 4KO6A 1Q0XH 1M56B 1AFVL 3ULVE 3FT1A 5EU6D 4HCIA 1KLUB 1PNDA 4Y8DC 2H45A 4PWHA 2GK0A 4PRPA 4W9DC 4Q9RL 1TJIL 4GKNB 3NA4A 5EBMA 1IV8A 2IH1B 3WDIA 1MCWW 2AK1L 3BDXA 3D3VA 2H0JA 3FOMB 1U58B 2WWNA 3B5TA 3CDZA 4IEFB 4KY1L 2X70A 1T0OA 2V8MA 2HJFB 3WE1A 5E8EA 3ZTNH 1Z9OA 5B7MA 2ZWLT 4FG0A 4O02L 3K0WA 4Y2OA 2EACA 5F1NA 1F42A 2A9AA 3JBG7 1T22B 5AOZA 5SV3A 3WEBA 4B9JA 4KPHH 1M4KA 2P44B 2VQUA 1AGFB 4M5YH 4WFHE 3MO1B 5D6DC 5JW4N 4A04A 4C56D 3B2DC 1IBHA 4JPIA 3K81A 4LLMA 1UFUA 1JD7A 1URZA 1FFPB 1HE8A 3KS0J 4M8QA 3UTQB 2L04A 4BKLA 5CF3A 4I5BB 5EA0H 3QS2A 3FUIA 5L4IA 4F2MA 1HINL 2VLLB 3D3VD 2EKSA 5DD1H 2X9WA 4LPYA 1G9HA 1ETZA 1QSFB 4EI0A 3O11A 3MBEC 5B1JC 5FCSH 1CTMA 4ELME 4NQSB 5TFSH 4I77L 5FO8A 2A0LC 1HH6B 2YXVA 1MXGA 1CXLA 1A7PH 1TQTA 4Z7OB 1VKXB 3ARGB 3KPOB 5DA4A 4GERA 3QUZC 1E2VA 2I26N 4G7RB 1M9WA 5DD6A 3VXPA 4URTB 3CN1A 1UC6A 2HJKA 1RURL 2GQHA 1PAZA 1DDHA 2QVMA 2V7HB 2OZNA 2CDGA 2V3EA 1JK8A 1SDYA 2EAEA 1E8WA 1L7TH 2ZKXA 3OMIB 5EC1A 1BG9A 2JSFA 1PZCA 1WPCA 2VLME 3UAJA 4MJIA 4HGKC 3VSQA 4D2NA 4M7LH 5KVFE 1QMUA 2IJ0C 2AXHA 2VRQA 4JGUA 3VQMA 2ZP8A 3AS1A 2XWJA 3DVGB 1K8IA 3EYOB 3GI8H 2FX9H 5G2NA 3ZDYB 1X5LA 2OK0L 4XBEL 1QSFD 4KKLC 1OARH 3U4KA 1T21B 4MA1C 3VX1A 5TLIA 1QRNE 3ASWA 1Q9OA 1FJ3A 4RGOL 4F8OA 2J88H 3E7JA 2VDQL 2N3JA 3U0PA 3ARGD 4BH7B 2ADIA 5HI3C 5F7YC 1CG9B 4MA1B 1XGPB 4OZIA 1XGYH 1DQIA 5DUPH 2FEEL 5JOFB 3ZE1F 1I9EA 1NDGB 1UZ6F 2XACC 3ABLB 3CFKA 5I1HH 1NAKL 2RHEA 5C0CE 3AB0B 1OK0A 4FQCL 2IANB 1MJ7H 1BEYH 2OW7A 4MDRA 4P2OA 4EN3C 4LCWA 1UJ3B 4UV4H 2AABL 4UM9B 1RIVL 3D85A 3OAWA 4JCWA 4OF3A 1Q8MA 5ABDE 3QIUB 4NHUA 1QHOA 1PKOA 3KMDA 4RFNB 5I15L 4L29B 3VB8A 1VA9A 2Y24A 3L1GA 1LLAA 3BGAA 3Q2CA 2WC7A 5KUMA 1A7RL 1TQSA 3FRPG 2XN9E 2Z1PA 4PJCA 4WVRA 1DEDA 3L4YA 3P3YA 2X38A 3P3RA 2A2QT 1NPNA 1YAIA 1F4HA 1UM6L 3O4LA 1NCBL 5IVZB 1WA2X 5HHMB 2XQBH 1P4LA 4WW2C 1IKFL 1CDCA 4YSPA 1G9NC 4GPVA 4HA1A 4OGQC 1BREA 4QWWD 4U4BA 5FB8A 4N90D 3HC2A 3B7UX 1NEUA 1AANA 1U95A 3QARA 4W9LC 4FG6D 3GRWA 2VLRA 2Q20A 4OD1H 1ERNA 1HHGB 1TLIA 2FT6A 3D2UB 2AV1B 2NW3B 4PJDF 3QIUD 3QAZC 1NPCA 5FHAH 2FSEA 4GAGH 1JE6A 2RFXA 5I1EL 2DY2A 1WEJL 2RQEA 2AJZB 3DO7B 1TQBC 2IADB 3OV6A 1X4ZA 5BRZA 2PW1A 2ZCHH 4ZUVA 3S35H 4FYQA 1IT9H 5IJBC 2NW2B 1KXQA 1M05B 1OTSC 3H2WA 4WAFA 5DWPA 5ETUA 2OXGA 1FJWA 5E8PB 4BZ2A 4D91A 2DWXA 4QOKB 1ND0B 3RVTC 1XMWA 4HOWA 3PQYB 3ZE2F 1MFBL 1TQBB 2A77H 2W9EH 3TBSA 3D8MA 4Q2ZA 5GGTH 5B3SB 4P07A 1CGYA 2KH2B 4Z7WE 1MCPL 2HLFC 2YEZB 4HPYH 5F3BB 1SY6L 2VN4A 4WK4B 4DP4X 3BKJH 1OAUH 4YHZH 5F0MB 4M3KB 4Y1AB 2J4WL 2IAMA 5ACZB 3CFEA 1RD6A 1S4IA 3PDOA 1D5ZA 2CM5A 2PLTA 3ZXAC 3AFLA 4PUBL 3LKQB 3SGKC 4F58H 3QDJE 5CSZB 1SJEA 3FONB 1Q1JH 4WGKA 2EJ1A 4HSAC 3VWJB 5KSAA 3GEFA 4PYGA 3RZCA 1SXSA 2VAAA 4QOKD 2IGLA 3PQYD 3QHTC 5DHYB 1CK0H 1AQDA 3K3QA 3IM1A 4QRTB 4ZUSB 1KPVB 3BUPA 2KT6A 3VD4A 4XH2A 2BNRA 3APDA 4YHMH 4QYOB 4ZTPH 2Q10A 3MV01 4X6EB 2CCVA 4POYA 3OMNB 4JFZH 4OZFG 1RZIB 2WCGA 4W9JC 1J05A 2WXHA 5I73C 1ASQA 3F83A 3UH8A 4KI5E 2VLKB 1LHZA 2O6FA 4XMXA 2WCSA 4I1RA 3OKLA 2OZ4L 4ODHL 3JV0A 5DUJA 5SWQA 1S2EA 3VWJD 4GO8A 1YY8B 3KBHE 1LWRA 3K8MA 3KPPB 5F9WC 5TDPA 5I73B 3D5OF 5F2FA 5FWRA 2F8XC 3WUZA 3VYNA 4OAWA 5D1QE 4NFBA 5I75B 4FTVE 3T3MF 5I6LA 5E03A 2ZCKL 5IMOA 2ZOUA 5IEHB 1RUML 1U8JB 2YWYA 1E8ZA 3OB0H 3MUZ1 2B8OT 1NMCB 5CFHA 1WK0A 2XPGA 4PP1D 2D3JA 2GAZA 3S5YA 2IQ9H 4I1NB 2YQGA 1R24B 1MFDH 3CXDL 4NRZB 5JMRA 2YUXA 4P0DA 4R4FH 4I85A 1T7YA 3KCWA 1MW2A 3QUYA 4UTCA 5EN2B 4PRNA 2DM4A 2VN6A 2IH9A 4HFUL 5DMIH 5JOPE 4K3JH 1KTLA 4M5ZL 4ZK8A 5DGQA 3ZPDA 4UQDA 4Q58C 3DXAB 3BN9C 2D03L 3ZMEA 5B38A 3C09C 3X12A 4AT6B 2WLHA 4X6FA 2YEQA 3DETD 2H32A 4BHUI 1ACZA 3ASNB 5T3XH 3DX6B 4YZFF 3TO2B 4NWTH 4APQB 1J48A 2WLNA 2AV7B 4WO4B 3LPGA 1WRFA 3FSZA 1PVHA 1QW8A 2CRMA 5AKVA 3QUYD 3TF7C 3LPOA 2VLJD 5F9JB 5CCGE 2HFTA 4LOFA 1EEZA 1AQ8A 4X5PA 1JZHA 2QADC 1N5YH 5EU6E 1A6UH 1U8NB 4PM1A 4XNQA 3P77B 1T0PB 3VQ2C 2IXQA 1YEIH 3N43F 2NY2D 4NQEB 4ZSOE 5CJQL 5K59F 1B2WL 4HULB 1BIHA 3DXAD 2R0KL 4UT9A 1KENH 1N5AB 2ATPB 3O6KH 3VFGL 3MODH 4BH8B 4TMNE 3DRTA 3CXHK 2IV8A 4KROB 5I1CL 3T4AB 4APQD 3LRSB 2MH4A 4N2HA 5CGYD 4R96B 4WO4D 3AS2A 4LBEA 1UZ8A 2APSA 3E3QE 3U6XS 3FHEA 4C56E 1Y18B 3EJZC 4PRPE 1TLPE 3RWFA 5L4JA 1UCBL 2B1HL 2EZ0D 1KBGH 3M1BB 3Q2WA 4A2MA 3MV9D 3CFQA 3A23A 4JG1L 1BJ1H 4F8TA 1UACH 4R2GD 1W80A 1T2QH 3D3VE 4XOBA 4YIQB 3EDFA 3MJ9H 3DX3A 1ZEAH 4NQED 1Q94B 4F2FA 2ICES 3MNDA 1E3FA 4ZMNA 4YX2H 2J20A 5LGHL 5IKCA 3TO4B 4UT6L 3W11D 1O7DE 5J0BA 1KTCA 2FX8H 5J9PA 4F8NA 1F90H 1S7TB 4KROD 1H3VA 2O5ZH 2ITCB 2O72A 3IGAA 2VC2H 4JKMA 2DD8H 1ORSB 2BFGA 3V55A 5EEZA 5FHBL 3GXFA 1YMHA 4XNUL 5EZJA 5I1GH 2FYYB 5D1ZI 3KYOA 1SF3A 2B0SH 1DVUA 43CAB 3GGWB 3ZTNL 1AYOA 1OSPL 5D7SH 3SKNA 4UQBA 2OMWB 2P24A 3M17B 4XC3H 4KUCF 4P49A 1K5NA 1V3MA 5DQDH 1QSFE 4TKWA 1WGOA 5FFGA 4R90H 1W0YT 1XGQA 4HUCA 2WUCH 3X14A 4FXTA 1MHPL 2YA0A 3TO4D 3WFHB 1Q9WB 1I8IB 1JD9A 1GGBL 2VQTA 2BOBB 3KPRD 4FHKA 3DC0A 1X4YA 4XMPH 2VUOA 2NNAA 1LL1A 3MLTB 1G7JB 3KWWB 3SOBL 2N56A 2NSQA 3WMSA 1UXMA 4Z23A 4MJIE 1M7XA 1V05A 4HEPA 3U6RA 5B7FA 1QSZA 2XZAL 2FB4L 1KJVA 1AHWA 5TH2B 2ZJSH 4P9HC 1UWYA 4TLUA 4X5WB 2I32A 4HUVA 1E67A 2UX7A 4I9WD 4OF0A 2EO9A 2JJVA 3L7EA 4P5KB 3TBYA 4ZMLA 3ZDYE 5L88L 2Z35B 3ESNA 4PGDA 4UDTA 1YG9A 1OP9A 1L7TL 5F7EL 2R1YA 1EDHA 4M5TA 4M7LL 4J3VA 4MWPE 1OZUA 4JM0A 5CEXB 3GI8L 1A1MB 3OKDA 1THLA 1JTPA 2GB2A 2UXTA 4O02B 3TPUA 1KROA 2CK2A 2ZKHH 1GPOH 1ZT1A 5JW4Q 1D5BA 2X2HA 5IFHH 2Z91B 1TETL 3PABA 3GT6A 2ADFH 2CR6A 5EO1B 2PWEA 3QNYB 1DCLA 4HWEH 1HZKA 1CLYH 3PLYA 4N90E 4WUUA 4XI5C 1WT5A 4BRJA 1AC6A 4ABWA 4LL9A 4N28A 1FIGL 2CO6A 5SV4A 1EAPA 4I3RL 3WUWG 1Z9PA 1LE5B 3L3OB 1N18A 1YRKA 4ZXBA 2MSPA 2X40A 1WA0X 4EBQH 3DTUB 3LPFA 3T3PE 5CMAB 1BEYL 2Z31B 3QFDB 1AJ7L 3FPXA 5IREA 2X6VA 3HKZA 3O4LE 3NYKA 2D9QB 3STZB 5D7JD 5DC2A 1FL5A 2MNJB 3KD4A 1NCAL 2Q3ZA 4K9JA 5DEGA 3ETBJ 1GXWA 4YFLF 4J3WA 3W9DB 2PW2A 5ESAA 5IW1A 3NQZB 2VL4A 2N7SA 3MACH 15C8H 1U21A 2GSGB 2VERN 4NNPL 4X99B 3FB8B 4HAKA 4MNGE 4MJ2A 4YFLI 4ZXBD 4ZODA 4AI7A 2WKGA 2H8PA 1LO3L 2APBA 1E27A 4G6FB 1P0SE 2B4CH 4PWEA 2FL5B 1T03L 4FHBD 3C5SB 5GSRB 2FUQA 3BVVA 3ORJA 3STLA 2EYRA 3MNVB 5C07A 1EJFA 1HHHB 1X9UA 1UWXK 1V8HA 2W5PA 2ZUWA 5FGRA 2Z31D 3HC4H 3NP3A 2XWBA 4WWNA 5K9QI 4KMTL 2WLJA 4OD1L 5JQ6H 2QKIA 1VZGA 2HLAB 5DJ2B 2ZSVB 3LRLA 3QHFH 1OAQL 2ARJB 5DJCB 3KL5A 1YLBB 3PQYE 2W65B 1AGDB 1EQWA 3AVEA 3SDCA 3TVMB 2RBLA 5IQ9A 5BO0D 4J6RH 4EN2A 1K3IA 2UWEA 1LEKA 1JPSL 1ZJBA 2BRRH 1AZNA 2ZCHL 1T5XB 1T1WA 3NFNA 4G80B 3SE8L 4H2AA 1U91A 1TQCC 3U82B 5CKGA 5DRNB 1ZANH 4LESA 4ZFOB 5C07D 3V52H 1RVFH 2VO8A 3T2PA 4N0CC 3TLRA 1BD2B 5ELIA 2WQRA 4M03A 1PG7H 2I5YL 3E1F1 4H0GA 1TQCB 3ZL2A 2PTTA 1XF2B 4OLXH 4BK5C 2BNQB 4UUJA 4ZNEA 2HX8A 4HIJA 4W6WB 3D4YA 4R9HA 1INEH 4KVCH 5KYUA 3BKJL 1OAUL 1S7RA 2EIBA 3D69A 3QW9A 5EO0A 1E3ZA 2KL6A 3MRCA 5TDNB 4YHZL 1BVKB 5INCB 2HP4A 4WJ5B 3NDYE 3KR3H 4N6RA 3QA3A 2NZ9D 3TVMD 4PG2A 5F1IB 4LLWA 1Z9SA 1C5CH 5FYLH 4F58L 1ZHKA 5I18L 2QTEA 1EO5A 4OF8A 2JKLA 2GCYA 4LIQL 3VE0A 4BFJA 5BZDA 4P8QA 2DQDH 1N8ZA 3DROB 1TQVA 4JFDB 1LD9A 1NBQA 3NABL 2JK5B 3FO9B 4NKIL 3GMRB 4LPUA 1BD2D 3L3JA 4AYID 4JFPB 3DDGA 1T0NA 4R4NC 2GSIA 4Z7AA 3ZHLA 5T5NF 1W72L 3DHUA 1CQYA 4DSYA 4YHML 3QSKB 2AXGB 4C8XA 5CD5C 4XCNA 5EFIB 1CFBA 5E8NB 1FPTH 2BX5A 2IH3A 1IGYA 3EO1B 4M7LT 3HZKB 3CFTA 4N8VB 4ZTEA 2X09A 1A22B 3PAUA 1GS6X 1SYSA 1VFAA 5D55A 1FO0H 2C34A 4KQ0A 1JK9A 2H0FA 3KLHC 2J71A 3MLWH 3T8CA 5T1KA 4F80A 4X6DE 3HZYB 4JFDD 1IC5L 3ZKND 4U6TA 3ZO9A 1MWOA 3H9HA 1E8YA 2WLMA 1TU2B 4XMWA 4E9YA 1RY7B 1U3JA 2VLJE 1F2XK 3RVUD 1I82A 1JVLA 4KK5D 4YDIL 3AY4C 2PYFB 2P42B 4KVNL 3AUWB 3Q5OA 1CE6A 4PJGB 1TR7A 2V2WB 5AVRB 2GBUA 6PCYA 1HQRA 3DXAE 1IBGL 1YEDB 1NCOA 1KELL 1MFDL 3LEXB 5T1KD 5TLNA 3IJHA 2VIRA 4FQLH 1I85C 4TYUA 1ZIBA 1OHZA 1U8OB 2OMZA 4HGWB 3SPGA 5IIEB 1OQOA 1SJMA 3LRKA 4TNFA 3Q6FA 4MNHA 1JYWA 3MZTA 4AVKA 1IVLA 3RGHA 3FHAA 1RZQA 2FZ3B 4G8GA 4FQ2L 3X13B 3KEDA 4HWZA 5EUOB 1LO5B 1VJSA 1I9RL 5T3XL 2EXWD 2A74A 1M57B 2NPLX 3US9A 3MV9E 5IMMB 2X1QA 5LBVA 4Y4FB 3RKPA 5LGKA