2VQXA

Precursor of protealysin, metalloproteinase from serratia proteamaculans.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
336
structure length
322
Chain Sequence
b'ARSVIPPYMLRRIIEHGSLPQRDCALHTLNHVKTSTGGEVIRDIYDAENSTQLPGKQVRNEGQASNHDVAVDEAYDYLGVTYDFFWQAFKRNSLDNQGLPLTGSVHYGKEYQNAFWNGQQMVFGDGDGEIFNRFTIAIDVVGHALAHGVTESEAGLIYFQQAGALNESLSDVFGSLVKQFHLKQTADKADWLIGEGLLAKGINGKGLRSMSAPGTAYDDPLLGKDPQPASMKDYIQTKEDNGGVHLNSGIPNRAFYLAATALGGYAWEKAGYIWYDTLCDKALPQDADFATFARTTVKHAEQRFDSKVAQKVQQAWHQVGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLOPROTEINASE
publication title Crystal Structure of the Protealysin Precursor: Insights Into Propeptide Function.
pubmed doi rcsb
source organism Serratia proteamaculans
molecule tags Hydrolase
total genus 118
structure length 322
sequence length 336
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
A PF16485 PLN_propep Protealysin propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2vqxA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 2vqxA01
4ZW6A 3B37A 4PVBA 1FJUA 4OI5E 2TLXA 3FUFA 1TRLA 4OW3A 5L8PE 4K90A 4XNDA 3FUNA 1U4GA 3EBGA 3P7WE 4QUOA 4XN4A 4XN9A 4K5MA 1TLXA 2HPOA 4K5OA 2VQXA 3B2PA 3CIAA 3FCQA 4X2UA 8TLIA 4XMTA 1SQMA 3CHPA 3FB0A 3FU6A 3CHSA 3EIMA 7TLNA 3FBOA 5DLHA 3QH5A 4MXJE 3NN7A 2DQMA 5A3YA 1KJOA 4XMXA 3NQYB 4R7LA 1LNAE 3FTVA 3Q43A 2TMNE 4XN2A 5FSPA 1L3FE 4ZX5A 1Z9GE 3CHRA 1FJTA 2A7GE 3FTZA 1KJPA 1ESPA 3F28A 5FSJA 5TLNA 4PU2A 5FWQA 3MSNA 4GERA 3QH1A 3FVPA 4XO5A 3Q44A 5LWDE 1FJVA 1FJOA 2VJ8A 1EZMA 1FJ3A 1KEIA 3P7VE 3DNZA 3T2HE 3T8HA 4ZW7A 4QIRA 1NPCA 3T2JE 1KS7A 3FV4A 1BQBA 3PUUA 3FUMA 4K5PA 2XQ0A 5DPEE 4TLNA 3FTSA 1LNFE 5HQDA 2G4ZA 3MS3A 3MSAA 5BPPA 5K7TA 3MSFA 5DLLA 1PE5A 3P7PE 4XN1A 3FHEA 3T2IE 4TMNE 3FUKA 3T73A 1KR6A 2R59A 1HYTA 4M65A 4XN8A 3FULA 4MTWE 3FU3A 3FUJA 5FSSA 5JSSE 3FGDA 4XMWA 3EBIA 4K89A 3SSBA 4MKTA 4DPRA 4XNAA 3FH8A 3FUHA 4XMZA 2XPYA 3T8GA 1ZDPE 1HS6A 3N21A 3DBKA 5JT9E 4B52A 4L2LA 5TLIA 3FUDA 1KROA 4RSYA 3FUEA 3T8FA 4ZX3A 6TMNE 4D91A 4TNLA 4K5NA 3T87A 3FU5A 3T74A 4K5LA 5TMNE 7TLIA 4MWPE 3QGOA 3B2XA 4H57A 4XN7A 1Y3GE 2TLIA 3FTUA 3U9WA 1THLA 1PE8A 3DO1A 3T8VA 3B7TA 3F2PA 3QJXA 4ZW5A 3FORA 3ZI6A 4ZW3A 1TMNE 3FXSA 4J3BA 5JS3E 3P7RE 5AENA 4QPEA 1KTOA 4ZQTA 3NQZB 3DO0A 1FJWA 1LNDE 4PW4A 3FH7A 4MS6A 3B7SA 3P7TE 8TLNE 1LNCE 3LS7A 4N4EE 1LNBE 4R5XA 3FTXA 1TLIA 3B7RL 4R5VA 3B34A 3TLIA 3P7QE 4Q4EA 4XMVA 4N66E 5JXNE 1GXWA 3FXPA 4ZX4A 5JVIE 4XMUA 4D9WA 2ZXGA 5LIFE 3CHQA 3FUIA 3EBHA 4XNBA 5L41E 5L3UE 3P7SE 4RVBA 4XO3A 2HPTA 5DYFA 4QHPA 1KL6A 4XO4A 1QF0A 1KKKA 3KEDA 3FLFA 1OS0A 1H19A 1QF1A 3NQXA 3FU0A 6TLIA 1PE7A 4R5TA 4ZX6A 3CHOA 2GTQA 1LNEE 3FTWA 3P7UE 4MZNE 4N5PE 1QF2A 2WI0A 2XPZA 4QMEA 3T8CA 1FJQA 1TLPE 2WHZA 3B7UX 3FTYA 4GAAA 4XN5A 3T8DA 3TMNE 3DO2A 3B3BA 5DPFE 4TLIA 3FH5A 5FXNA 4Q4IA 4ZW8A 1GW6A 2DQ6A
chains in the Genus database with same CATH superfamily
4K90A 3FUNA 3P7WE 4XN4A 3FCQA 1SQMA 3QH5A 4F5CA 2DQMA 1KJOA 3QNFA 2TMNE 7TLIA 5FWQA 3Q44A 1FJVA 1FJOA 3T8HA 4KXDA 1KS7A 4K5PA 4KX9A 5HQDA 3MS3A 3MSAA 4IHQA 3T2IE 4TMNE 3FUKA 2R59A 1HYTA 3FULA 4MTWE 3FUJA 3EBIA 4MKTA 3FH8A 1HS6A 4L2LA 4AR9A 3FUEA 3T87A 1Z1WA 4MWPE 3QGOA 1Y3GE 2TLIA 3T8VA 3B7TA 4QPEA 4PW4A 4R5XA 3FTXA 3B34A 3P7QE 3FXPA 4ZX4A 5LIFE 3EBHA 5L3UE 4XO3A 1OS0A 3FTYA 3DO2A 3B3BA 5FXNA 4E36A 4ZW8A 1GW6A 2YD0A 3B37A 4PVBA 5AB2A 1TRLA 4XNDA 1U4GA 2VQXA 3CIAA 4X2UA 4KXCA 3CHPA 3FU6A 7TLNA 4KX7A 4JBSA 5K7TA 1LNAE 3FTVA 3Q43A 3T73A 3FTZA 1FJTA 2A7GE 5TLNA 4PU2A 4XO5A 3MDJA 2VJ8A 3P7VE 4ZW7A 3T2JE 1BQBA 3PUUA 3FUMA 4TLNA 4NZ8A 4FKEA 5DLLA 1KR6A 3FU3A 4XMWA 4K89A 4DPRA 4FCAA 1ZDPE 5JT9E 3DBKA 4NAQA 4B52A 4FKHA 4D91A 4FYSA 4XN7A 3U9WA 3DO1A 3F2PA 3FORA 3ZI6A 4ZW3A 3FXSA 5JS3E 5AB0A 1KTOA 1LNDE 3FH7A 4AR1A 8TLNE 1LNCE 1LNBE 1TLIA 4Q4EA 5C97A 1GXWA 5K1VA 5JVIE 4Z7IA 4D9WA 3CHQA 4FYRA 4XNBA 5L41E 3P7SE 4ARFA 4QHPA 1QF0A 6TLIA 1PE7A 4KXAA 3P7UE 4MZNE 4N5PE 1QF2A 2WI0A 4QMEA 5DPFE 4TLIA 4Q4IA 1FJUA 4OW3A 3EBGA 2HPOA 4K5OA 3FB0A 3CHSA 3FBOA 5DLHA 4MXJE 3NN7A 4P8QA 5A3YA 4R7LA 5FSPA 4XN2A 4ZX5A 5J6SA 4OU3A 5FSJA 1ESPA 3SE6A 4PJ6A 5LWDE 1EZMA 3DNZA 3T2HE 1NPCA 5DPEE 1LNFE 5BPPA 1PE5A 5LDSA 4XN1A 5FSSA 3SSBA 3FUHA 2XPYA 3T8GA 3FUDA 1KROA 4RSYA 4ZX3A 4FYTA 4TNLA 4K5LA 5TMNE 3B2XA 4H57A 1THLA 1PE8A 4ZW5A 3QJXA 4J3BA 3P7RE 4ZQTA 3NQZB 3DO0A 4MS6A 3B7SA 4HOMA 3P7TE 4N4EE 4R5VA 4XMVA 5LG6A 4XO4A 1KL6A 3NQXA 3FU0A 4R5TA 3Q7JA 1LNEE 3FTWA 2XPZA 3T8CA 2WHZA 4XN5A 4GAAA 3FH5A 4II7A 4ZW6A 4OI5E 2TLXA 3FUFA 5L8PE 4XN9A 4QUOA 4K5MA 1TLXA 4FYQA 4AR8A 3B2PA 8TLIA 4XMTA 3EIMA 4XMXA 3NQYB 1L3FE 1Z9GE 3CHRA 1KJPA 4FGMA 3F28A 3MSNA 4GERA 3QH1A 3FVPA 1FJ3A 1KEIA 4QIRA 4WZ9A 3FV4A 2XQ0A 3FTSA 4FKKA 2G4ZA 3MSFA 1Z5HA 3P7PE 3FHEA 5CU5A 4M65A 4XN8A 5JSSE 3FGDA 4XNAA 4XMZA 3N21A 5TLIA 3T8FA 6TMNE 4K5NA 3FU5A 3T74A 3FTUA 1TMNE 5AENA 1FJWA 3LS7A 3B7RL 3TLIA 1LMLA 4N66E 5JXNE 4KX8A 4XMUA 2ZXGA 3FUIA 5EV7A 4RVBA 2HPTA 5DYFA 5LHDA 1KKKA 3KEDA 3FLFA 1H19A 1QF1A 4ZX6A 3CHOA 2GTQA 1FJQA 1TLPE 3B7UX 3TMNE 3T8DA 4KXBA 2DQ6A
chains in the Genus database with same CATH topology
4ZW6A 3B37A 4PVBA 1FJUA 4OI5E 2TLXA 3FUFA 1TRLA 4OW3A 5L8PE 4K90A 4XNDA 3FUNA 1U4GA 3EBGA 3P7WE 4QUOA 4XN4A 4XN9A 4K5MA 1TLXA 2HPOA 4K5OA 2VQXA 3B2PA 3CIAA 3FCQA 4X2UA 8TLIA 4XMTA 1SQMA 3CHPA 3FB0A 3FU6A 3CHSA 3EIMA 7TLNA 3FBOA 5DLHA 3QH5A 4MXJE 3NN7A 2DQMA 5A3YA 1KJOA 4XMXA 3NQYB 4R7LA 1LNAE 3FTVA 3Q43A 2TMNE 4XN2A 5FSPA 1L3FE 4ZX5A 1Z9GE 3CHRA 1FJTA 2A7GE 3FTZA 1KJPA 1ESPA 3F28A 5FSJA 5TLNA 4PU2A 5FWQA 3MSNA 4GERA 3QH1A 3FVPA 4XO5A 3Q44A 5LWDE 1FJVA 1FJOA 2VJ8A 1EZMA 1FJ3A 1KEIA 3P7VE 3DNZA 3T2HE 3T8HA 4ZW7A 4QIRA 1NPCA 3T2JE 1KS7A 3FV4A 1BQBA 3PUUA 3FUMA 4K5PA 2XQ0A 5DPEE 4TLNA 3FTSA 1LNFE 5HQDA 2G4ZA 3MS3A 3MSAA 5BPPA 5K7TA 3MSFA 5DLLA 1PE5A 3P7PE 4XN1A 3FHEA 3T2IE 4TMNE 3FUKA 3T73A 1KR6A 2R59A 1HYTA 4M65A 4XN8A 3FULA 4MTWE 3FU3A 3FUJA 5FSSA 5JSSE 3FGDA 4XMWA 3EBIA 4K89A 3SSBA 4MKTA 4DPRA 4XNAA 3FH8A 3FUHA 4XMZA 2XPYA 3T8GA 1ZDPE 1HS6A 3N21A 3DBKA 5JT9E 4B52A 4L2LA 5TLIA 3FUDA 1KROA 4RSYA 3FUEA 3T8FA 4ZX3A 6TMNE 4D91A 4TNLA 4K5NA 3T87A 3FU5A 3T74A 4K5LA 5TMNE 7TLIA 4MWPE 3QGOA 3B2XA 4H57A 4XN7A 1Y3GE 2TLIA 3FTUA 3U9WA 1THLA 1PE8A 3DO1A 3T8VA 3B7TA 3F2PA 3QJXA 4ZW5A 3FORA 3ZI6A 4ZW3A 1TMNE 3FXSA 4J3BA 5JS3E 3P7RE 5AENA 4QPEA 1KTOA 4ZQTA 3NQZB 3DO0A 1FJWA 1LNDE 4PW4A 3FH7A 4MS6A 3B7SA 3P7TE 8TLNE 1LNCE 3LS7A 4N4EE 1LNBE 4R5XA 3FTXA 1TLIA 3B7RL 4R5VA 3B34A 3TLIA 1LMLA 3P7QE 4Q4EA 4XMVA 4N66E 5JXNE 1GXWA 3FXPA 4ZX4A 5JVIE 4XMUA 4D9WA 2ZXGA 5LIFE 3CHQA 3FUIA 3EBHA 4XNBA 5L41E 5L3UE 3P7SE 4RVBA 4XO3A 2HPTA 5DYFA 4QHPA 1KL6A 4XO4A 1QF0A 1KKKA 3KEDA 3FLFA 1OS0A 1H19A 1QF1A 3NQXA 3FU0A 6TLIA 1PE7A 4R5TA 4ZX6A 3CHOA 2GTQA 1LNEE 3FTWA 3P7UE 4MZNE 4N5PE 1QF2A 2WI0A 2XPZA 4QMEA 3T8CA 1FJQA 1TLPE 2WHZA 3B7UX 3FTYA 4GAAA 4XN5A 3T8DA 3TMNE 3DO2A 3B3BA 5DPFE 4TLIA 3FH5A 5FXNA 4Q4IA 4ZW8A 1GW6A 2DQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZW6 A;  3B37 A;  4PVB A;  1FJU A;  4OI5 E;  2TLX A;  3FUF A;  1TRL A;  4OW3 A;  5L8P E;  4K90 A;  4XND A;  3FUN A;  1U4G A;  3EBG A;  3P7W E;  4QUO A;  4XN4 A;  4XN9 A;  4K5M A;  1TLX A;  2HPO A;  4K5O A;  2VQX A;  3B2P A;  3CIA A;  3FCQ A;  4X2U A;  8TLI A;  4XMT A;  1SQM A;  3CHP A;  3FB0 A;  3FU6 A;  3CHS A;  3EIM A;  7TLN A;  3FBO A;  5DLH A;  3QH5 A;  4MXJ E;  3NN7 A;  2DQM A;  5A3Y A;  1KJO A;  4XMX A;  3NQY B;  4R7L A;  1LNA E;  3FTV A;  3Q43 A;  2TMN E;  4XN2 A;  5FSP A;  1L3F E;  4ZX5 A;  1Z9G E;  3CHR A;  1FJT A;  2A7G E;  3FTZ A;  1KJP A;  1ESP A;  3F28 A;  5FSJ A;  5TLN A;  4PU2 A;  5FWQ A;  3MSN A;  4GER A;  3QH1 A;  3FVP A;  4XO5 A;  3Q44 A;  5LWD E;  1FJV A;  1FJO A;  2VJ8 A;  1EZM A;  1FJ3 A;  1KEI A;  3P7V E;  3DNZ A;  3T2H E;  3T8H A;  4ZW7 A;  4QIR A;  1NPC A;  3T2J E;  1KS7 A;  3FV4 A;  1BQB A;  3PUU A;  3FUM A;  4K5P A;  2XQ0 A;  5DPE E;  4TLN A;  3FTS A;  1LNF E;  5HQD A;  2G4Z A;  3MS3 A;  3MSA A;  5BPP A;  5K7T A;  3MSF A;  5DLL A;  1PE5 A;  3P7P E;  4XN1 A;  3FHE A;  3T2I E;  4TMN E;  3FUK A;  3T73 A;  1KR6 A;  2R59 A;  1HYT A;  4M65 A;  4XN8 A;  3FUL A;  4MTW E;  3FU3 A;  3FUJ A;  5FSS A;  5JSS E;  3FGD A;  4XMW A;  3EBI A;  4K89 A;  3SSB A;  4MKT A;  4DPR A;  4XNA A;  3FH8 A;  3FUH A;  4XMZ A;  2XPY A;  3T8G A;  1ZDP E;  1HS6 A;  3N21 A;  3DBK A;  5JT9 E;  4B52 A;  4L2L A;  5TLI A;  3FUD A;  1KRO A;  4RSY A;  3FUE A;  3T8F A;  4ZX3 A;  6TMN E;  4D91 A;  4TNL A;  4K5N A;  3T87 A;  3FU5 A;  3T74 A;  4K5L A;  5TMN E;  7TLI A;  4MWP E;  3QGO A;  3B2X A;  4H57 A;  4XN7 A;  1Y3G E;  2TLI A;  3FTU A;  3U9W A;  1THL A;  1PE8 A;  3DO1 A;  3T8V A;  3B7T A;  3F2P A;  3QJX A;  4ZW5 A;  3FOR A;  3ZI6 A;  4ZW3 A;  1TMN E;  3FXS A;  4J3B A;  5JS3 E;  3P7R E;  5AEN A;  4QPE A;  1KTO A;  4ZQT A;  3NQZ B;  3DO0 A;  1FJW A;  1LND E;  4PW4 A;  3FH7 A;  4MS6 A;  3B7S A;  3P7T E;  8TLN E;  1LNC E;  3LS7 A;  4N4E E;  1LNB E;  4R5X A;  3FTX A;  1TLI A;  3B7R L;  4R5V A;  3B34 A;  3TLI A;  3P7Q E;  4Q4E A;  4XMV A;  4N66 E;  5JXN E;  1GXW A;  3FXP A;  4ZX4 A;  5JVI E;  4XMU A;  4D9W A;  2ZXG A;  5LIF E;  3CHQ A;  3FUI A;  3EBH A;  4XNB A;  5L41 E;  5L3U E;  3P7S E;  4RVB A;  4XO3 A;  2HPT A;  5DYF A;  4QHP A;  1KL6 A;  4XO4 A;  1QF0 A;  1KKK A;  3KED A;  3FLF A;  1OS0 A;  1H19 A;  1QF1 A;  3NQX A;  3FU0 A;  6TLI A;  1PE7 A;  4R5T A;  4ZX6 A;  3CHO A;  2GTQ A;  1LNE E;  3FTW A;  3P7U E;  4MZN E;  4N5P E;  1QF2 A;  2WI0 A;  2XPZ A;  4QME A;  3T8C A;  1FJQ A;  1TLP E;  2WHZ A;  3B7U X;  3FTY A;  4GAA A;  4XN5 A;  3T8D A;  3TMN E;  3DO2 A;  3B3B A;  5DPF E;  4TLI A;  3FH5 A;  5FXN A;  4Q4I A;  4ZW8 A;  1GW6 A;  2DQ6 A; 
#chains in the Genus database with same CATH topology
 4K90 A;  3FUN A;  3P7W E;  4XN4 A;  3FCQ A;  1SQM A;  3QH5 A;  4F5C A;  2DQM A;  1KJO A;  3QNF A;  2TMN E;  7TLI A;  5FWQ A;  3Q44 A;  1FJV A;  1FJO A;  3T8H A;  4KXD A;  1KS7 A;  4K5P A;  4KX9 A;  5HQD A;  3MS3 A;  3MSA A;  4IHQ A;  3T2I E;  4TMN E;  3FUK A;  2R59 A;  1HYT A;  3FUL A;  4MTW E;  3FUJ A;  3EBI A;  4MKT A;  3FH8 A;  1HS6 A;  4L2L A;  4AR9 A;  3FUE A;  3T87 A;  1Z1W A;  4MWP E;  3QGO A;  1Y3G E;  2TLI A;  3T8V A;  3B7T A;  4QPE A;  4PW4 A;  4R5X A;  3FTX A;  3B34 A;  3P7Q E;  3FXP A;  4ZX4 A;  5LIF E;  3EBH A;  5L3U E;  4XO3 A;  1OS0 A;  3FTY A;  3DO2 A;  3B3B A;  5FXN A;  4E36 A;  4ZW8 A;  1GW6 A;  2YD0 A;  3B37 A;  4PVB A;  5AB2 A;  1TRL A;  4XND A;  1U4G A;  2VQX A;  3CIA A;  4X2U A;  4KXC A;  3CHP A;  3FU6 A;  7TLN A;  4KX7 A;  4JBS A;  5K7T A;  1LNA E;  3FTV A;  3Q43 A;  3T73 A;  3FTZ A;  1FJT A;  2A7G E;  5TLN A;  4PU2 A;  4XO5 A;  3MDJ A;  2VJ8 A;  3P7V E;  4ZW7 A;  3T2J E;  1BQB A;  3PUU A;  3FUM A;  4TLN A;  4NZ8 A;  4FKE A;  5DLL A;  1KR6 A;  3FU3 A;  4XMW A;  4K89 A;  4DPR A;  4FCA A;  1ZDP E;  5JT9 E;  3DBK A;  4NAQ A;  4B52 A;  4FKH A;  4D91 A;  4FYS A;  4XN7 A;  3U9W A;  3DO1 A;  3F2P A;  3FOR A;  3ZI6 A;  4ZW3 A;  3FXS A;  5JS3 E;  5AB0 A;  1KTO A;  1LND E;  3FH7 A;  4AR1 A;  8TLN E;  1LNC E;  1LNB E;  1TLI A;  4Q4E A;  5C97 A;  1GXW A;  5K1V A;  5JVI E;  4Z7I A;  4D9W A;  3CHQ A;  4FYR A;  4XNB A;  5L41 E;  3P7S E;  4ARF A;  4QHP A;  1QF0 A;  6TLI A;  1PE7 A;  4KXA A;  3P7U E;  4MZN E;  4N5P E;  1QF2 A;  2WI0 A;  4QME A;  5DPF E;  4TLI A;  4Q4I A;  1FJU A;  4OW3 A;  3EBG A;  2HPO A;  4K5O A;  3FB0 A;  3CHS A;  3FBO A;  5DLH A;  4MXJ E;  3NN7 A;  4P8Q A;  5A3Y A;  4R7L A;  5FSP A;  4XN2 A;  4ZX5 A;  5J6S A;  4OU3 A;  5FSJ A;  1ESP A;  3SE6 A;  4PJ6 A;  5LWD E;  1EZM A;  3DNZ A;  3T2H E;  1NPC A;  5DPE E;  1LNF E;  5BPP A;  1PE5 A;  5LDS A;  4XN1 A;  5FSS A;  3SSB A;  3FUH A;  2XPY A;  3T8G A;  3FUD A;  1KRO A;  4RSY A;  4ZX3 A;  4FYT A;  4TNL A;  4K5L A;  5TMN E;  3B2X A;  4H57 A;  1THL A;  1PE8 A;  4ZW5 A;  3QJX A;  4J3B A;  3P7R E;  4ZQT A;  3NQZ B;  3DO0 A;  4MS6 A;  3B7S A;  4HOM A;  3P7T E;  4N4E E;  4R5V A;  4XMV A;  5LG6 A;  4XO4 A;  1KL6 A;  3NQX A;  3FU0 A;  4R5T A;  3Q7J A;  1LNE E;  3FTW A;  2XPZ A;  3T8C A;  2WHZ A;  4XN5 A;  4GAA A;  3FH5 A;  4II7 A;  4ZW6 A;  4OI5 E;  2TLX A;  3FUF A;  5L8P E;  4XN9 A;  4QUO A;  4K5M A;  1TLX A;  4FYQ A;  4AR8 A;  3B2P A;  8TLI A;  4XMT A;  3EIM A;  4XMX A;  3NQY B;  1L3F E;  1Z9G E;  3CHR A;  1KJP A;  4FGM A;  3F28 A;  3MSN A;  4GER A;  3QH1 A;  3FVP A;  1FJ3 A;  1KEI A;  4QIR A;  4WZ9 A;  3FV4 A;  2XQ0 A;  3FTS A;  4FKK A;  2G4Z A;  3MSF A;  1Z5H A;  3P7P E;  3FHE A;  5CU5 A;  4M65 A;  4XN8 A;  5JSS E;  3FGD A;  4XNA A;  4XMZ A;  3N21 A;  5TLI A;  3T8F A;  6TMN E;  4K5N A;  3FU5 A;  3T74 A;  3FTU A;  1TMN E;  5AEN A;  1FJW A;  3LS7 A;  3B7R L;  3TLI A;  1LML A;  4N66 E;  5JXN E;  4KX8 A;  4XMU A;  2ZXG A;  3FUI A;  5EV7 A;  4RVB A;  2HPT A;  5DYF A;  5LHD A;  1KKK A;  3KED A;  3FLF A;  1H19 A;  1QF1 A;  4ZX6 A;  3CHO A;  2GTQ A;  1FJQ A;  1TLP E;  3B7U X;  3TMN E;  3T8D A;  4KXB A;  2DQ6 A; 
#chains in the Genus database with same CATH homology
 4ZW6 A;  3B37 A;  4PVB A;  1FJU A;  4OI5 E;  2TLX A;  3FUF A;  1TRL A;  4OW3 A;  5L8P E;  4K90 A;  4XND A;  3FUN A;  1U4G A;  3EBG A;  3P7W E;  4QUO A;  4XN4 A;  4XN9 A;  4K5M A;  1TLX A;  2HPO A;  4K5O A;  2VQX A;  3B2P A;  3CIA A;  3FCQ A;  4X2U A;  8TLI A;  4XMT A;  1SQM A;  3CHP A;  3FB0 A;  3FU6 A;  3CHS A;  3EIM A;  7TLN A;  3FBO A;  5DLH A;  3QH5 A;  4MXJ E;  3NN7 A;  2DQM A;  5A3Y A;  1KJO A;  4XMX A;  3NQY B;  4R7L A;  1LNA E;  3FTV A;  3Q43 A;  2TMN E;  4XN2 A;  5FSP A;  1L3F E;  4ZX5 A;  1Z9G E;  3CHR A;  1FJT A;  2A7G E;  3FTZ A;  1KJP A;  1ESP A;  3F28 A;  5FSJ A;  5TLN A;  4PU2 A;  5FWQ A;  3MSN A;  4GER A;  3QH1 A;  3FVP A;  4XO5 A;  3Q44 A;  5LWD E;  1FJV A;  1FJO A;  2VJ8 A;  1EZM A;  1FJ3 A;  1KEI A;  3P7V E;  3DNZ A;  3T2H E;  3T8H A;  4ZW7 A;  4QIR A;  1NPC A;  3T2J E;  1KS7 A;  3FV4 A;  1BQB A;  3PUU A;  3FUM A;  4K5P A;  2XQ0 A;  5DPE E;  4TLN A;  3FTS A;  1LNF E;  5HQD A;  2G4Z A;  3MS3 A;  3MSA A;  5BPP A;  5K7T A;  3MSF A;  5DLL A;  1PE5 A;  3P7P E;  4XN1 A;  3FHE A;  3T2I E;  4TMN E;  3FUK A;  3T73 A;  1KR6 A;  2R59 A;  1HYT A;  4M65 A;  4XN8 A;  3FUL A;  4MTW E;  3FU3 A;  3FUJ A;  5FSS A;  5JSS E;  3FGD A;  4XMW A;  3EBI A;  4K89 A;  3SSB A;  4MKT A;  4DPR A;  4XNA A;  3FH8 A;  3FUH A;  4XMZ A;  2XPY A;  3T8G A;  1ZDP E;  1HS6 A;  3N21 A;  3DBK A;  5JT9 E;  4B52 A;  4L2L A;  5TLI A;  3FUD A;  1KRO A;  4RSY A;  3FUE A;  3T8F A;  4ZX3 A;  6TMN E;  4D91 A;  4TNL A;  4K5N A;  3T87 A;  3FU5 A;  3T74 A;  4K5L A;  5TMN E;  7TLI A;  4MWP E;  3QGO A;  3B2X A;  4H57 A;  4XN7 A;  1Y3G E;  2TLI A;  3FTU A;  3U9W A;  1THL A;  1PE8 A;  3DO1 A;  3T8V A;  3B7T A;  3F2P A;  3QJX A;  4ZW5 A;  3FOR A;  3ZI6 A;  4ZW3 A;  1TMN E;  3FXS A;  4J3B A;  5JS3 E;  3P7R E;  5AEN A;  4QPE A;  1KTO A;  4ZQT A;  3NQZ B;  3DO0 A;  1FJW A;  1LND E;  4PW4 A;  3FH7 A;  4MS6 A;  3B7S A;  3P7T E;  8TLN E;  1LNC E;  3LS7 A;  4N4E E;  1LNB E;  4R5X A;  3FTX A;  1TLI A;  3B7R L;  4R5V A;  3B34 A;  3TLI A;  1LML A;  3P7Q E;  4Q4E A;  4XMV A;  4N66 E;  5JXN E;  1GXW A;  3FXP A;  4ZX4 A;  5JVI E;  4XMU A;  4D9W A;  2ZXG A;  5LIF E;  3CHQ A;  3FUI A;  3EBH A;  4XNB A;  5L41 E;  5L3U E;  3P7S E;  4RVB A;  4XO3 A;  2HPT A;  5DYF A;  4QHP A;  1KL6 A;  4XO4 A;  1QF0 A;  1KKK A;  3KED A;  3FLF A;  1OS0 A;  1H19 A;  1QF1 A;  3NQX A;  3FU0 A;  6TLI A;  1PE7 A;  4R5T A;  4ZX6 A;  3CHO A;  2GTQ A;  1LNE E;  3FTW A;  3P7U E;  4MZN E;  4N5P E;  1QF2 A;  2WI0 A;  2XPZ A;  4QME A;  3T8C A;  1FJQ A;  1TLP E;  2WHZ A;  3B7U X;  3FTY A;  4GAA A;  4XN5 A;  3T8D A;  3TMN E;  3DO2 A;  3B3B A;  5DPF E;  4TLI A;  3FH5 A;  5FXN A;  4Q4I A;  4ZW8 A;  1GW6 A;  2DQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...