2VQXA

Precursor of protealysin, metalloproteinase from serratia proteamaculans.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
336
structure length
322
Chain Sequence
ARSVIPPYMLRRIIEHGSLPQRDCALHTLNHVKTSTGGEVIRDIYDAENSTQLPGKQVRNEGQASNHDVAVDEAYDYLGVTYDFFWQAFKRNSLDNQGLPLTGSVHYGKEYQNAFWNGQQMVFGDGDGEIFNRFTIAIDVVGHALAHGVTESEAGLIYFQQAGALNESLSDVFGSLVKQFHLKQTADKADWLIGEGLLAKGINGKGLRSMSAPGTAYDDPLLGKDPQPASMKDYIQTKEDNGGVHLNSGIPNRAFYLAATALGGYAWEKAGYIWYDTLCDKALPQDADFATFARTTVKHAEQRFDSKVAQKVQQAWHQVGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Protealysin Precursor: Insights Into Propeptide Function.
pubmed doi rcsb
source organism Serratia proteamaculans
molecule tags Hydrolase
molecule keywords METALLOPROTEINASE
total genus 118
structure length 322
sequence length 336
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
A PF16485 PLN_propep Protealysin propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2vqxA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 2vqxA01
3B7UX 5JS3E 3T73A 3PUUA 3FB0A 1FJTA 2A7GE 3EIMA 4ZX3A 4XN2A 4MXJE 4ZX4A 1FJQA 1H19A 4MKTA 3NQZB 4ZW8A 3MSNA 4XMVA 4TLNA 3P7TE 4K89A 1LNAE 1FJVA 3P7SE 4MWPE 3NQXA 4XMWA 4XN9A 1TLIA 3P7UE 4GAAA 4K5NA 3FUNA 5JT9E 3ZI6A 4XNAA 1SQMA 4ZQTA 4ZW5A 1L3FE 3FH8A 3FUMA 5AENA 3B7TA 3QH1A 4Q4IA 4XN7A 5DLLA 5L41E 1QF1A 5DLHA 5A3YA 8TLIA 1KS7A 3T8CA 2DQMA 3FV4A 3FORA 4QPEA 4XO5A 3FUJA 4RSYA 4R7LA 4N5PE 3FTVA 3T2HE 4OI5E 4K5PA 5FXNA 3FTZA 3FTXA 3FUFA 4D9WA 3EBIA 3FBOA 2TMNE 5FWQA 1ZDPE 3FTSA 3LS7A 4ZX5A 3FTWA 4PU2A 2HPTA 5HQDA 5DPEE 5TLIA 3FUIA 1FJOA 4QHPA 3Q43A 1KJOA 3P7QE 4M65A 4XO3A 1PE5A 3F28A 2DQ6A 2R59A 3MS3A 1QF2A 3QGOA 3NN7A 4MS6A 4MZNE 4K5OA 4H57A 2HPOA 4DPRA 3EBGA 1KROA 3FUHA 4Q4EA 3FU0A 4X2UA 4XNDA 3T87A 1PE8A 4TMNE 5JXNE 6TMNE 3B2XA 3MSFA 5LIFE 4OW3A 3DBKA 3T2IE 3FLFA 1FJWA 4RVBA 5BPPA 3FCQA 3FXPA 4XN5A 1Z9GE 1Y3GE 3T8FA 3MSAA 3B3BA 4XN1A 4J3BA 4XMZA 3T2JE 3B34A 4ZW7A 4ZX6A 3DNZA 4N4EE 5DYFA 3N21A 1LNEE 1LNBE 3FH5A 1U4GA 4R5VA 3T8VA 3B37A 3CHSA 3FU6A 4R5TA 3TMNE 3TLIA 4ZW3A 5L8PE 5DPFE 3NQYB 4XO4A 2WHZA 3B7RL 5FSPA 7TLNA 1PE7A 1GXWA 2VQXA 3DO2A 3P7WE 3FUEA 4XN8A 4QMEA 5L3UE 4D91A 7TLIA 2XPZA 3CHQA 3CIAA 3FGDA 3CHPA 5K7TA 5TLNA 1KJPA 4GERA 1TRLA 1HS6A 2XPYA 4K5LA 3CHRA 8TLNE 4QUOA 1OS0A 3P7VE 3T8HA 4XMTA 3B7SA 5TMNE 1KKKA 1ESPA 1HYTA 1TLXA 4TNLA 3T8DA 1QF0A 3SSBA 3U9WA 2GTQA 1NPCA 3FUKA 4QIRA 3FVPA 3FHEA 5FSSA 5LWDE 1EZMA 3FXSA 4PW4A 4ZW6A 1KEIA 1KL6A 3QH5A 1TMNE 3FU3A 2TLIA 3KEDA 3T74A 1FJUA 4B52A 3F2PA 3FTYA 4L2LA 4XN4A 1FJ3A 3DO1A 1GW6A 1KTOA 1LNDE 3EBHA 2TLXA 3B2PA 4MTWE 3FTUA 2VJ8A 4N66E 4TLIA 3P7PE 4XNBA 5FSJA 4XMXA 4PVBA 6TLIA 1LNFE 1KR6A 2XQ0A 2G4ZA 4R5XA 3FU5A 2ZXGA 5JSSE 5JVIE 4K90A 3P7RE 3Q44A 4XMUA 3FH7A 3DO0A 2WI0A 3FUDA 3FULA 1THLA 1BQBA 4K5MA 1TLPE 1LNCE 3T8GA 3CHOA 3QJXA
chains in the Genus database with same CATH superfamily
3B7UX 5JS3E 3T73A 3PUUA 3FB0A 1FJTA 2A7GE 3EIMA 4II7A 4ZX3A 4XN2A 4MXJE 4ZX4A 1FJQA 1H19A 4MKTA 3NQZB 4ZW8A 3MSNA 4XMVA 4Z7IA 4TLNA 5LG6A 4NZ8A 3P7TE 4K89A 1LNAE 1FJVA 3P7SE 4MWPE 3NQXA 4XMWA 4XN9A 1TLIA 3P7UE 4GAAA 4K5NA 3FUNA 3Q7JA 5JT9E 3ZI6A 4XNAA 1SQMA 4ZQTA 4ZW5A 1L3FE 3FH8A 3FUMA 5AENA 4KXBA 3B7TA 5C97A 3QH1A 4Q4IA 4XN7A 5DLLA 5L41E 4FYQA 1QF1A 5DLHA 5A3YA 8TLIA 1KS7A 5LDSA 3T8CA 2DQMA 3FV4A 3FORA 4QPEA 4FKHA 3FUJA 4RSYA 4XO5A 4IHQA 4R7LA 4N5PE 3FTVA 3T2HE 4HOMA 4OI5E 4KX9A 4K5PA 5FXNA 3FTZA 3FTXA 3FUFA 4D9WA 3EBIA 3FBOA 4JBSA 2TMNE 5FWQA 1ZDPE 3FTSA 3LS7A 4ZX5A 3FTWA 4PU2A 2HPTA 5HQDA 4WZ9A 5DPEE 4KXCA 5TLIA 3FUIA 1FJOA 4QHPA 3Q43A 1KJOA 3P7QE 4M65A 4KXDA 4XO3A 1PE5A 3F28A 2DQ6A 2R59A 3MS3A 1QF2A 3QGOA 3NN7A 4MS6A 4MZNE 4K5OA 4PJ6A 5K1VA 4AR1A 4H57A 2HPOA 5AB0A 4DPRA 3EBGA 1KROA 3FUHA 4FKEA 3FU0A 4Q4EA 4X2UA 3T87A 1PE8A 4TMNE 4XNDA 5JXNE 3MDJA 6TMNE 3B2XA 3MSFA 5LIFE 4OW3A 3QNFA 4FGMA 3DBKA 3T2IE 3FLFA 1FJWA 4RVBA 5BPPA 3FCQA 3FXPA 4XN5A 1Z9GE 1Y3GE 3T8FA 4AR9A 3MSAA 3B3BA 4XN1A 4J3BA 4XMZA 3T2JE 4F5CA 2YD0A 3B34A 4ZW7A 4ZX6A 3DNZA 4N4EE 5DYFA 3N21A 1LNEE 1LNBE 4P8QA 3FH5A 3SE6A 1LMLA 1U4GA 4FYRA 4R5VA 3T8VA 3B37A 3CHSA 3FU6A 4R5TA 3TMNE 3TLIA 4E36A 4ZW3A 5L8PE 5DPFE 3NQYB 4XO4A 2WHZA 3B7RL 4KX7A 5FSPA 7TLNA 1PE7A 1GXWA 2VQXA 3DO2A 3P7WE 3FUEA 4FKKA 4QMEA 4XN8A 5L3UE 4D91A 5CU5A 7TLIA 2XPZA 3CHQA 3CIAA 3FGDA 5AB2A 3CHPA 5K7TA 5TLNA 4FCAA 1KJPA 4GERA 1TRLA 1HS6A 2XPYA 4K5LA 3CHRA 8TLNE 4QUOA 1OS0A 3P7VE 3T8HA 4XMTA 3B7SA 5TMNE 1KKKA 1ESPA 1HYTA 1TLXA 4FYTA 4TNLA 3T8DA 5LHDA 1QF0A 3SSBA 3U9WA 2GTQA 1NPCA 3FUKA 4QIRA 1Z1WA 3FHEA 3FVPA 4KXAA 5FSSA 5LWDE 1EZMA 3FXSA 4PW4A 4FYSA 4KX8A 1KEIA 1KL6A 3QH5A 1TMNE 3FU3A 4ZW6A 2TLIA 3KEDA 3T74A 1FJUA 4B52A 3F2PA 3FTYA 4L2LA 4XN4A 1FJ3A 3DO1A 1GW6A 1KTOA 1LNDE 3EBHA 2TLXA 3B2PA 4MTWE 3FTUA 2VJ8A 4N66E 4TLIA 3P7PE 4XNBA 5FSJA 4XMXA 4PVBA 6TLIA 1LNFE 1KR6A 2XQ0A 2G4ZA 4R5XA 3FU5A 2ZXGA 5JSSE 5JVIE 4K90A 3P7RE 3Q44A 4XMUA 5EV7A 3FH7A 3DO0A 4NAQA 2WI0A 4ARFA 4AR8A 3FUDA 3FULA 1THLA 1BQBA 4K5MA 1TLPE 4OU3A 5J6SA 1LNCE 3T8GA 1Z5HA 3CHOA 3QJXA
chains in the Genus database with same CATH topology
3B7UX 5JS3E 3T73A 3PUUA 3FB0A 1FJTA 2A7GE 3EIMA 4ZX3A 4XN2A 4MXJE 4ZX4A 1FJQA 1H19A 4MKTA 3NQZB 4ZW8A 3MSNA 4XMVA 4TLNA 3P7TE 4K89A 1LNAE 1FJVA 3P7SE 4MWPE 3NQXA 4XMWA 4XN9A 1TLIA 3P7UE 4GAAA 4K5NA 3FUNA 5JT9E 3ZI6A 4XNAA 1SQMA 4ZQTA 4ZW5A 1L3FE 3FH8A 3FUMA 5AENA 3B7TA 3QH1A 4Q4IA 4XN7A 5DLLA 5L41E 1QF1A 5DLHA 5A3YA 8TLIA 1KS7A 3T8CA 2DQMA 3FV4A 3FORA 4QPEA 4XO5A 3FUJA 4RSYA 4R7LA 4N5PE 3FTVA 3T2HE 4OI5E 4K5PA 5FXNA 3FTZA 3FTXA 3FUFA 4D9WA 3EBIA 3FBOA 2TMNE 5FWQA 1ZDPE 3FTSA 3LS7A 4ZX5A 3FTWA 4PU2A 2HPTA 5HQDA 5DPEE 5TLIA 3FUIA 1FJOA 4QHPA 3Q43A 1KJOA 3P7QE 4M65A 4XO3A 1PE5A 3F28A 2DQ6A 2R59A 3MS3A 1QF2A 3QGOA 3NN7A 4MS6A 4MZNE 4K5OA 4H57A 2HPOA 4DPRA 3EBGA 1KROA 3FUHA 4Q4EA 3FU0A 4X2UA 4XNDA 3T87A 1PE8A 4TMNE 5JXNE 6TMNE 3B2XA 3MSFA 5LIFE 4OW3A 3DBKA 3T2IE 3FLFA 1FJWA 4RVBA 5BPPA 3FCQA 3FXPA 4XN5A 1Z9GE 1Y3GE 3T8FA 3MSAA 3B3BA 4XN1A 4J3BA 4XMZA 3T2JE 3B34A 4ZW7A 4ZX6A 3DNZA 4N4EE 5DYFA 3N21A 1LNEE 1LNBE 3FH5A 1LMLA 1U4GA 4R5VA 3T8VA 3B37A 3CHSA 3FU6A 4R5TA 3TMNE 3TLIA 4ZW3A 5L8PE 5DPFE 3NQYB 4XO4A 2WHZA 3B7RL 5FSPA 7TLNA 1PE7A 1GXWA 2VQXA 3DO2A 3P7WE 3FUEA 4XN8A 4QMEA 5L3UE 4D91A 7TLIA 2XPZA 3CHQA 3CIAA 3FGDA 3CHPA 5K7TA 5TLNA 1KJPA 4GERA 1TRLA 1HS6A 2XPYA 4K5LA 3CHRA 8TLNE 4QUOA 1OS0A 3P7VE 3T8HA 4XMTA 3B7SA 5TMNE 1KKKA 1ESPA 1HYTA 1TLXA 4TNLA 3T8DA 1QF0A 3SSBA 3U9WA 2GTQA 1NPCA 3FUKA 4QIRA 3FVPA 3FHEA 5FSSA 5LWDE 1EZMA 3FXSA 4PW4A 4ZW6A 1KEIA 1KL6A 3QH5A 1TMNE 3FU3A 2TLIA 3KEDA 3T74A 1FJUA 4B52A 3F2PA 3FTYA 4L2LA 4XN4A 1FJ3A 3DO1A 1GW6A 1KTOA 1LNDE 3EBHA 2TLXA 3B2PA 4MTWE 3FTUA 2VJ8A 4N66E 4TLIA 3P7PE 4XNBA 5FSJA 4XMXA 4PVBA 6TLIA 1LNFE 1KR6A 2XQ0A 2G4ZA 4R5XA 3FU5A 2ZXGA 5JSSE 5JVIE 4K90A 3P7RE 3Q44A 4XMUA 3FH7A 3DO0A 2WI0A 3FUDA 3FULA 1THLA 1BQBA 4K5MA 1TLPE 1LNCE 3T8GA 3CHOA 3QJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7U X;  5JS3 E;  3T73 A;  3PUU A;  3FB0 A;  1FJT A;  2A7G E;  3EIM A;  4ZX3 A;  4XN2 A;  4MXJ E;  4ZX4 A;  1FJQ A;  1H19 A;  4MKT A;  3NQZ B;  4ZW8 A;  3MSN A;  4XMV A;  4TLN A;  3P7T E;  4K89 A;  1LNA E;  1FJV A;  3P7S E;  4MWP E;  3NQX A;  4XMW A;  4XN9 A;  1TLI A;  3P7U E;  4GAA A;  4K5N A;  3FUN A;  5JT9 E;  3ZI6 A;  4XNA A;  1SQM A;  4ZQT A;  4ZW5 A;  1L3F E;  3FH8 A;  3FUM A;  5AEN A;  3B7T A;  3QH1 A;  4Q4I A;  4XN7 A;  5DLL A;  5L41 E;  1QF1 A;  5DLH A;  5A3Y A;  8TLI A;  1KS7 A;  3T8C A;  2DQM A;  3FV4 A;  3FOR A;  4QPE A;  4XO5 A;  3FUJ A;  4RSY A;  4R7L A;  4N5P E;  3FTV A;  3T2H E;  4OI5 E;  4K5P A;  5FXN A;  3FTZ A;  3FTX A;  3FUF A;  4D9W A;  3EBI A;  3FBO A;  2TMN E;  5FWQ A;  1ZDP E;  3FTS A;  3LS7 A;  4ZX5 A;  3FTW A;  4PU2 A;  2HPT A;  5HQD A;  5DPE E;  5TLI A;  3FUI A;  1FJO A;  4QHP A;  3Q43 A;  1KJO A;  3P7Q E;  4M65 A;  4XO3 A;  1PE5 A;  3F28 A;  2DQ6 A;  2R59 A;  3MS3 A;  1QF2 A;  3QGO A;  3NN7 A;  4MS6 A;  4MZN E;  4K5O A;  4H57 A;  2HPO A;  4DPR A;  3EBG A;  1KRO A;  3FUH A;  4Q4E A;  3FU0 A;  4X2U A;  4XND A;  3T87 A;  1PE8 A;  4TMN E;  5JXN E;  6TMN E;  3B2X A;  3MSF A;  5LIF E;  4OW3 A;  3DBK A;  3T2I E;  3FLF A;  1FJW A;  4RVB A;  5BPP A;  3FCQ A;  3FXP A;  4XN5 A;  1Z9G E;  1Y3G E;  3T8F A;  3MSA A;  3B3B A;  4XN1 A;  4J3B A;  4XMZ A;  3T2J E;  3B34 A;  4ZW7 A;  4ZX6 A;  3DNZ A;  4N4E E;  5DYF A;  3N21 A;  1LNE E;  1LNB E;  3FH5 A;  1U4G A;  4R5V A;  3T8V A;  3B37 A;  3CHS A;  3FU6 A;  4R5T A;  3TMN E;  3TLI A;  4ZW3 A;  5L8P E;  5DPF E;  3NQY B;  4XO4 A;  2WHZ A;  3B7R L;  5FSP A;  7TLN A;  1PE7 A;  1GXW A;  2VQX A;  3DO2 A;  3P7W E;  3FUE A;  4XN8 A;  4QME A;  5L3U E;  4D91 A;  7TLI A;  2XPZ A;  3CHQ A;  3CIA A;  3FGD A;  3CHP A;  5K7T A;  5TLN A;  1KJP A;  4GER A;  1TRL A;  1HS6 A;  2XPY A;  4K5L A;  3CHR A;  8TLN E;  4QUO A;  1OS0 A;  3P7V E;  3T8H A;  4XMT A;  3B7S A;  5TMN E;  1KKK A;  1ESP A;  1HYT A;  1TLX A;  4TNL A;  3T8D A;  1QF0 A;  3SSB A;  3U9W A;  2GTQ A;  1NPC A;  3FUK A;  4QIR A;  3FVP A;  3FHE A;  5FSS A;  5LWD E;  1EZM A;  3FXS A;  4PW4 A;  4ZW6 A;  1KEI A;  1KL6 A;  3QH5 A;  1TMN E;  3FU3 A;  2TLI A;  3KED A;  3T74 A;  1FJU A;  4B52 A;  3F2P A;  3FTY A;  4L2L A;  4XN4 A;  1FJ3 A;  3DO1 A;  1GW6 A;  1KTO A;  1LND E;  3EBH A;  2TLX A;  3B2P A;  4MTW E;  3FTU A;  2VJ8 A;  4N66 E;  4TLI A;  3P7P E;  4XNB A;  5FSJ A;  4XMX A;  4PVB A;  6TLI A;  1LNF E;  1KR6 A;  2XQ0 A;  2G4Z A;  4R5X A;  3FU5 A;  2ZXG A;  5JSS E;  5JVI E;  4K90 A;  3P7R E;  3Q44 A;  4XMU A;  3FH7 A;  3DO0 A;  2WI0 A;  3FUD A;  3FUL A;  1THL A;  1BQB A;  4K5M A;  1TLP E;  1LNC E;  3T8G A;  3CHO A;  3QJX A; 
#chains in the Genus database with same CATH topology
 3B7U X;  5JS3 E;  3T73 A;  3PUU A;  3FB0 A;  1FJT A;  2A7G E;  3EIM A;  4II7 A;  4ZX3 A;  4XN2 A;  4MXJ E;  4ZX4 A;  1FJQ A;  1H19 A;  4MKT A;  3NQZ B;  4ZW8 A;  3MSN A;  4XMV A;  4Z7I A;  4TLN A;  5LG6 A;  4NZ8 A;  3P7T E;  4K89 A;  1LNA E;  1FJV A;  3P7S E;  4MWP E;  3NQX A;  4XMW A;  4XN9 A;  1TLI A;  3P7U E;  4GAA A;  4K5N A;  3FUN A;  3Q7J A;  5JT9 E;  3ZI6 A;  4XNA A;  1SQM A;  4ZQT A;  4ZW5 A;  1L3F E;  3FH8 A;  3FUM A;  5AEN A;  4KXB A;  3B7T A;  5C97 A;  3QH1 A;  4Q4I A;  4XN7 A;  5DLL A;  5L41 E;  4FYQ A;  1QF1 A;  5DLH A;  5A3Y A;  8TLI A;  1KS7 A;  5LDS A;  3T8C A;  2DQM A;  3FV4 A;  3FOR A;  4QPE A;  4FKH A;  3FUJ A;  4RSY A;  4XO5 A;  4IHQ A;  4R7L A;  4N5P E;  3FTV A;  3T2H E;  4HOM A;  4OI5 E;  4KX9 A;  4K5P A;  5FXN A;  3FTZ A;  3FTX A;  3FUF A;  4D9W A;  3EBI A;  3FBO A;  4JBS A;  2TMN E;  5FWQ A;  1ZDP E;  3FTS A;  3LS7 A;  4ZX5 A;  3FTW A;  4PU2 A;  2HPT A;  5HQD A;  4WZ9 A;  5DPE E;  4KXC A;  5TLI A;  3FUI A;  1FJO A;  4QHP A;  3Q43 A;  1KJO A;  3P7Q E;  4M65 A;  4KXD A;  4XO3 A;  1PE5 A;  3F28 A;  2DQ6 A;  2R59 A;  3MS3 A;  1QF2 A;  3QGO A;  3NN7 A;  4MS6 A;  4MZN E;  4K5O A;  4PJ6 A;  5K1V A;  4AR1 A;  4H57 A;  2HPO A;  5AB0 A;  4DPR A;  3EBG A;  1KRO A;  3FUH A;  4FKE A;  3FU0 A;  4Q4E A;  4X2U A;  3T87 A;  1PE8 A;  4TMN E;  4XND A;  5JXN E;  3MDJ A;  6TMN E;  3B2X A;  3MSF A;  5LIF E;  4OW3 A;  3QNF A;  4FGM A;  3DBK A;  3T2I E;  3FLF A;  1FJW A;  4RVB A;  5BPP A;  3FCQ A;  3FXP A;  4XN5 A;  1Z9G E;  1Y3G E;  3T8F A;  4AR9 A;  3MSA A;  3B3B A;  4XN1 A;  4J3B A;  4XMZ A;  3T2J E;  4F5C A;  2YD0 A;  3B34 A;  4ZW7 A;  4ZX6 A;  3DNZ A;  4N4E E;  5DYF A;  3N21 A;  1LNE E;  1LNB E;  4P8Q A;  3FH5 A;  3SE6 A;  1LML A;  1U4G A;  4FYR A;  4R5V A;  3T8V A;  3B37 A;  3CHS A;  3FU6 A;  4R5T A;  3TMN E;  3TLI A;  4E36 A;  4ZW3 A;  5L8P E;  5DPF E;  3NQY B;  4XO4 A;  2WHZ A;  3B7R L;  4KX7 A;  5FSP A;  7TLN A;  1PE7 A;  1GXW A;  2VQX A;  3DO2 A;  3P7W E;  3FUE A;  4FKK A;  4QME A;  4XN8 A;  5L3U E;  4D91 A;  5CU5 A;  7TLI A;  2XPZ A;  3CHQ A;  3CIA A;  3FGD A;  5AB2 A;  3CHP A;  5K7T A;  5TLN A;  4FCA A;  1KJP A;  4GER A;  1TRL A;  1HS6 A;  2XPY A;  4K5L A;  3CHR A;  8TLN E;  4QUO A;  1OS0 A;  3P7V E;  3T8H A;  4XMT A;  3B7S A;  5TMN E;  1KKK A;  1ESP A;  1HYT A;  1TLX A;  4FYT A;  4TNL A;  3T8D A;  5LHD A;  1QF0 A;  3SSB A;  3U9W A;  2GTQ A;  1NPC A;  3FUK A;  4QIR A;  1Z1W A;  3FHE A;  3FVP A;  4KXA A;  5FSS A;  5LWD E;  1EZM A;  3FXS A;  4PW4 A;  4FYS A;  4KX8 A;  1KEI A;  1KL6 A;  3QH5 A;  1TMN E;  3FU3 A;  4ZW6 A;  2TLI A;  3KED A;  3T74 A;  1FJU A;  4B52 A;  3F2P A;  3FTY A;  4L2L A;  4XN4 A;  1FJ3 A;  3DO1 A;  1GW6 A;  1KTO A;  1LND E;  3EBH A;  2TLX A;  3B2P A;  4MTW E;  3FTU A;  2VJ8 A;  4N66 E;  4TLI A;  3P7P E;  4XNB A;  5FSJ A;  4XMX A;  4PVB A;  6TLI A;  1LNF E;  1KR6 A;  2XQ0 A;  2G4Z A;  4R5X A;  3FU5 A;  2ZXG A;  5JSS E;  5JVI E;  4K90 A;  3P7R E;  3Q44 A;  4XMU A;  5EV7 A;  3FH7 A;  3DO0 A;  4NAQ A;  2WI0 A;  4ARF A;  4AR8 A;  3FUD A;  3FUL A;  1THL A;  1BQB A;  4K5M A;  1TLP E;  4OU3 A;  5J6S A;  1LNC E;  3T8G A;  1Z5H A;  3CHO A;  3QJX A; 
#chains in the Genus database with same CATH homology
 3B7U X;  5JS3 E;  3T73 A;  3PUU A;  3FB0 A;  1FJT A;  2A7G E;  3EIM A;  4ZX3 A;  4XN2 A;  4MXJ E;  4ZX4 A;  1FJQ A;  1H19 A;  4MKT A;  3NQZ B;  4ZW8 A;  3MSN A;  4XMV A;  4TLN A;  3P7T E;  4K89 A;  1LNA E;  1FJV A;  3P7S E;  4MWP E;  3NQX A;  4XMW A;  4XN9 A;  1TLI A;  3P7U E;  4GAA A;  4K5N A;  3FUN A;  5JT9 E;  3ZI6 A;  4XNA A;  1SQM A;  4ZQT A;  4ZW5 A;  1L3F E;  3FH8 A;  3FUM A;  5AEN A;  3B7T A;  3QH1 A;  4Q4I A;  4XN7 A;  5DLL A;  5L41 E;  1QF1 A;  5DLH A;  5A3Y A;  8TLI A;  1KS7 A;  3T8C A;  2DQM A;  3FV4 A;  3FOR A;  4QPE A;  4XO5 A;  3FUJ A;  4RSY A;  4R7L A;  4N5P E;  3FTV A;  3T2H E;  4OI5 E;  4K5P A;  5FXN A;  3FTZ A;  3FTX A;  3FUF A;  4D9W A;  3EBI A;  3FBO A;  2TMN E;  5FWQ A;  1ZDP E;  3FTS A;  3LS7 A;  4ZX5 A;  3FTW A;  4PU2 A;  2HPT A;  5HQD A;  5DPE E;  5TLI A;  3FUI A;  1FJO A;  4QHP A;  3Q43 A;  1KJO A;  3P7Q E;  4M65 A;  4XO3 A;  1PE5 A;  3F28 A;  2DQ6 A;  2R59 A;  3MS3 A;  1QF2 A;  3QGO A;  3NN7 A;  4MS6 A;  4MZN E;  4K5O A;  4H57 A;  2HPO A;  4DPR A;  3EBG A;  1KRO A;  3FUH A;  4Q4E A;  3FU0 A;  4X2U A;  4XND A;  3T87 A;  1PE8 A;  4TMN E;  5JXN E;  6TMN E;  3B2X A;  3MSF A;  5LIF E;  4OW3 A;  3DBK A;  3T2I E;  3FLF A;  1FJW A;  4RVB A;  5BPP A;  3FCQ A;  3FXP A;  4XN5 A;  1Z9G E;  1Y3G E;  3T8F A;  3MSA A;  3B3B A;  4XN1 A;  4J3B A;  4XMZ A;  3T2J E;  3B34 A;  4ZW7 A;  4ZX6 A;  3DNZ A;  4N4E E;  5DYF A;  3N21 A;  1LNE E;  1LNB E;  3FH5 A;  1LML A;  1U4G A;  4R5V A;  3T8V A;  3B37 A;  3CHS A;  3FU6 A;  4R5T A;  3TMN E;  3TLI A;  4ZW3 A;  5L8P E;  5DPF E;  3NQY B;  4XO4 A;  2WHZ A;  3B7R L;  5FSP A;  7TLN A;  1PE7 A;  1GXW A;  2VQX A;  3DO2 A;  3P7W E;  3FUE A;  4XN8 A;  4QME A;  5L3U E;  4D91 A;  7TLI A;  2XPZ A;  3CHQ A;  3CIA A;  3FGD A;  3CHP A;  5K7T A;  5TLN A;  1KJP A;  4GER A;  1TRL A;  1HS6 A;  2XPY A;  4K5L A;  3CHR A;  8TLN E;  4QUO A;  1OS0 A;  3P7V E;  3T8H A;  4XMT A;  3B7S A;  5TMN E;  1KKK A;  1ESP A;  1HYT A;  1TLX A;  4TNL A;  3T8D A;  1QF0 A;  3SSB A;  3U9W A;  2GTQ A;  1NPC A;  3FUK A;  4QIR A;  3FVP A;  3FHE A;  5FSS A;  5LWD E;  1EZM A;  3FXS A;  4PW4 A;  4ZW6 A;  1KEI A;  1KL6 A;  3QH5 A;  1TMN E;  3FU3 A;  2TLI A;  3KED A;  3T74 A;  1FJU A;  4B52 A;  3F2P A;  3FTY A;  4L2L A;  4XN4 A;  1FJ3 A;  3DO1 A;  1GW6 A;  1KTO A;  1LND E;  3EBH A;  2TLX A;  3B2P A;  4MTW E;  3FTU A;  2VJ8 A;  4N66 E;  4TLI A;  3P7P E;  4XNB A;  5FSJ A;  4XMX A;  4PVB A;  6TLI A;  1LNF E;  1KR6 A;  2XQ0 A;  2G4Z A;  4R5X A;  3FU5 A;  2ZXG A;  5JSS E;  5JVI E;  4K90 A;  3P7R E;  3Q44 A;  4XMU A;  3FH7 A;  3DO0 A;  2WI0 A;  3FUD A;  3FUL A;  1THL A;  1BQB A;  4K5M A;  1TLP E;  1LNC E;  3T8G A;  3CHO A;  3QJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...