2VQXA

Precursor of protealysin, metalloproteinase from serratia proteamaculans.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
336
structure length
322
Chain Sequence
ARSVIPPYMLRRIIEHGSLPQRDCALHTLNHVKTSTGGEVIRDIYDAENSTQLPGKQVRNEGQASNHDVAVDEAYDYLGVTYDFFWQAFKRNSLDNQGLPLTGSVHYGKEYQNAFWNGQQMVFGDGDGEIFNRFTIAIDVVGHALAHGVTESEAGLIYFQQAGALNESLSDVFGSLVKQFHLKQTADKADWLIGEGLLAKGINGKGLRSMSAPGTAYDDPLLGKDPQPASMKDYIQTKEDNGGVHLNSGIPNRAFYLAATALGGYAWEKAGYIWYDTLCDKALPQDADFATFARTTVKHAEQRFDSKVAQKVQQAWHQVGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLOPROTEINASE
publication title Crystal Structure of the Protealysin Precursor: Insights Into Propeptide Function.
pubmed doi rcsb
source organism Serratia proteamaculans
molecule tags Hydrolase
total genus 118
structure length 322
sequence length 336
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
A PF16485 PLN_propep Protealysin propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2vqxA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 2vqxA01
3B2PA 5FWQA 3FU0A 2WHZA 4K5PA 4XN8A 3MSFA 3FH7A 1TMNE 3CHSA 4K5LA 3FHEA 3NQYB 4XMXA 3FTUA 3QH5A 4K5MA 4OW3A 4R5XA 1KR6A 3P7PE 3FH5A 3B7RL 3CHOA 4ZW5A 1FJOA 1HS6A 2TLIA 3FLFA 1FJQA 1KTOA 1L3FE 2DQ6A 1PE7A 4XO3A 3SSBA 5FSJA 5LWDE 5L3UE 3F28A 2VJ8A 3NN7A 3FTXA 3MS3A 1KROA 3FU3A 3EBIA 3TLIA 3LS7A 1ESPA 2ZXGA 1BQBA 3FXPA 2A7GE 1TLPE 5FSSA 1THLA 6TMNE 5DPEE 3KEDA 4X2UA 1LNDE 3FUNA 4GERA 4XMWA 1QF2A 1FJWA 1OS0A 3FUIA 4ZX3A 3N21A 5JSSE 1TLIA 3FUMA 3FV4A 4TLNA 1LNCE 7TLNA 3TMNE 4ZW3A 4D9WA 4ZW7A 1LNFE 3NQXA 2GTQA 3P7UE 4MKTA 4TMNE 1KL6A 3T2HE 4XNAA 5FSPA 4GAAA 3B3BA 1FJ3A 3FUJA 1KKKA 3T8FA 1ZDPE 4MWPE 3T87A 3FTZA 3MSNA 4Q4IA 4MTWE 6TLIA 1TLXA 4N4EE 4XNBA 3T73A 3P7WE 2R59A 3FORA 3EIMA 3DNZA 3CHRA 3FGDA 4Q4EA 5JT9E 3FUFA 5JVIE 5DYFA 2HPTA 4ZX6A 4XMUA 4XMTA 1U4GA 5LIFE 4MS6A 3T8VA 3FTYA 8TLNE 3FTSA 4L2LA 4XO5A 3FVPA 1KS7A 4M65A 3ZI6A 2TMNE 4XMVA 1FJUA 3T8CA 1LNAE 2TLXA 3B34A 3P7VE 4H57A 4K89A 4PU2A 3U9WA 5AENA 1LNEE 3B7TA 3Q43A 3QJXA 3DO1A 2G4ZA 1Z9GE 3P7TE 2WI0A 1FJVA 4R5VA 3CHQA 1KEIA 1HYTA 2XPZA 5HQDA 4N66E 4RVBA 4K5NA 3FTVA 5TLNA 1QF1A 2DQMA 4MZNE 5TLIA 3T8DA 1LNBE 3QGOA 3T8HA 2XQ0A 3NQZB 4QIRA 4ZX5A 3CHPA 2HPOA 5K7TA 3FUKA 1GXWA 4OI5E 3FB0A 5L8PE 3T2IE 2VQXA 1KJOA 3FCQA 5DLHA 3DO2A 3FULA 1EZMA 3DBKA 3FU6A 4R7LA 5TMNE 4ZQTA 8TLIA 1H19A 4XN5A 4MXJE 3FTWA 3P7SE 4XO4A 5L41E 3B2XA 1PE5A 4N5PE 1PE8A 3B7UX 3FU5A 4XN4A 4XN1A 3CIAA 1NPCA 4D91A 4XN2A 2XPYA 3MSAA 1Y3GE 5DPFE 3FXSA 3QH1A 4XN7A 4TNLA 3P7QE 4TLIA 3FH8A 3FBOA 4QUOA 4ZW6A 3P7RE 3EBHA 4QPEA 7TLIA 3EBGA 3FUHA 1KJPA 1GW6A 3PUUA 3T74A 4QHPA 4K5OA 5FXNA 3T2JE 1SQMA 3FUEA 4XNDA 5JXNE 3DO0A 5DLLA 4J3BA 3B37A 4PVBA 4QMEA 4B52A 1FJTA 3Q44A 4XN9A 5BPPA 1TRLA 3T8GA 1QF0A 3F2PA 4PW4A 4RSYA 4ZW8A 4DPRA 5JS3E 4XMZA 4R5TA 4ZX4A 5A3YA 4K90A 3FUDA 3B7SA
chains in the Genus database with same CATH superfamily
3FHEA 3QH5A 4K5MA 3P7PE 4IHQA 1KTOA 5FSJA 3NN7A 3FXPA 5J6SA 1TLPE 4XMWA 3N21A 1TLIA 1LNCE 3TMNE 4ZW3A 3NQXA 4KX7A 1KL6A 4KX9A 4GAAA 1ZDPE 3T87A 6TLIA 3FORA 4NAQA 3CHRA 4Q4EA 3FUFA 4ZX6A 3FTSA 4L2LA 1KS7A 4XMVA 1LNAE 3Q43A 2YD0A 3P7TE 4E36A 1FJVA 3CHQA 1KEIA 1HYTA 4N66E 4RVBA 3FTVA 1QF1A 3T8DA 2XQ0A 3NQZB 4QIRA 3CHPA 2HPOA 4OI5E 3T2IE 1KJOA 4MXJE 4XO4A 5L41E 3B2XA 1Z5HA 3CIAA 1NPCA 4D91A 3MSAA 3FXSA 4XN7A 5LDSA 4QUOA 5EV7A 1LMLA 3EBHA 1KJPA 4XNDA 4FGMA 5BPPA 4KX8A 3FUDA 5FWQA 2WHZA 3FTUA 4FCAA 1KR6A 3FH5A 3B7RL 4ZW5A 3FLFA 2DQ6A 4FYSA 1PE7A 4XO3A 5L3UE 3MS3A 1KROA 3TLIA 4Z7IA 2A7GE 5DPEE 3KEDA 4X2UA 1LNDE 3FUIA 3FUMA 4D9WA 4ZW7A 4AR9A 1LNFE 4TMNE 3T2HE 3B3BA 1FJ3A 4MWPE 1TLXA 3T73A 3P7WE 3DNZA 5JT9E 4MS6A 3T8CA 4H57A 3P7VE 4KXCA 2G4ZA 1Z9GE 5K1VA 4WZ9A 5TLNA 2DQMA 5TLIA 4MZNE 4ZX5A 5K7TA 3FUKA 1GXWA 3FB0A 5DLHA 3FULA 4XMTA 1EZMA 3FU6A 8TLIA 4XN5A 1Z1WA 4XN1A 3QNFA 4ARFA 4TNLA 4TLIA 4QPEA 1GW6A 4K5OA 1SQMA 3FUEA 5DLLA 4P8QA 3B37A 4PVBA 4B52A 3T8GA 4XMZA 4K5PA 3QJXA 5DPFE 3B2PA 4XN8A 3MSFA 3FH7A 5AB0A 3CHSA 4K5LA 4JBSA 3MDJA 1FJOA 1FJQA 4KXBA 5LWDE 3FTXA 3FU3A 3EBIA 3LS7A 1ESPA 1THLA 6TMNE 1OS0A 4ZX3A 4TLNA 7TLNA 4XNAA 5FSPA 1KKKA 3MSNA 4MTWE 4XNBA 4N4EE 2R59A 4AR1A 3EIMA 3FGDA 2HPTA 4XMUA 3T8VA 8TLNE 4XO5A 4HOMA 2TMNE 2TLXA 3B34A 4K89A 4AR8A 3U9WA 1LNEE 3DO1A 4KXAA 4R5VA 2XPZA 5HQDA 5AB2A 4II7A 3QGOA 5L8PE 2VQXA 4F5CA 4R7LA 3FTWA 3P7SE 2XPYA 1Y3GE 4NZ8A 3FBOA 5CU5A 3PUUA 4FYTA 4QHPA 5FXNA 3T2JE 3DO0A 4J3BA 3Q44A 4XN9A 1TRLA 3Q7JA 3SE6A 4DPRA 4K90A 5TMNE 3B7SA 3FU0A 1TMNE 4XMXA 3NQYB 4OW3A 4R5XA 3CHOA 1HS6A 2TLIA 1L3FE 3SSBA 3F28A 2VJ8A 2ZXGA 1BQBA 5FSSA 4FYQA 3FUNA 4GERA 1QF2A 1FJWA 5JSSE 3FV4A 2GTQA 3P7UE 4MKTA 3FUJA 3T8FA 4KXDA 3FTZA 4Q4IA 4FYRA 5JVIE 5DYFA 1U4GA 5LIFE 3FTYA 3FVPA 4M65A 3ZI6A 1FJUA 5AENA 4PU2A 3B7TA 2WI0A 4K5NA 5LHDA 1LNBE 3T8HA 3FCQA 4ZQTA 3DO2A 3DBKA 4OU3A 1H19A 1PE5A 4N5PE 1PE8A 3B7UX 3FU5A 4XN4A 4FKKA 4FKEA 4XN2A 3QH1A 3P7QE 3FH8A 5LG6A 4PJ6A 4ZW6A 3P7RE 7TLIA 3EBGA 3FUHA 5C97A 3T74A 5JXNE 4QMEA 1FJTA 4FKHA 1QF0A 3F2PA 4PW4A 4RSYA 4ZW8A 5JS3E 4R5TA 4ZX4A 5A3YA
chains in the Genus database with same CATH topology
3B2PA 5FWQA 3FU0A 2WHZA 4K5PA 4XN8A 3MSFA 3FH7A 1TMNE 3CHSA 4K5LA 3FHEA 3NQYB 4XMXA 3FTUA 3QH5A 4K5MA 4OW3A 4R5XA 1KR6A 3P7PE 3FH5A 3B7RL 3CHOA 4ZW5A 1FJOA 1HS6A 2TLIA 3FLFA 1FJQA 1KTOA 1L3FE 2DQ6A 1PE7A 4XO3A 3SSBA 5FSJA 5LWDE 5L3UE 3F28A 2VJ8A 3NN7A 3FTXA 3MS3A 1KROA 3FU3A 3EBIA 3TLIA 3LS7A 1ESPA 2ZXGA 1BQBA 3FXPA 2A7GE 1TLPE 5FSSA 1THLA 6TMNE 5DPEE 3KEDA 4X2UA 1LNDE 3FUNA 4GERA 4XMWA 1QF2A 1FJWA 1OS0A 3FUIA 4ZX3A 3N21A 5JSSE 1TLIA 3FUMA 3FV4A 4TLNA 1LNCE 7TLNA 3TMNE 4ZW3A 4D9WA 4ZW7A 1LNFE 3NQXA 2GTQA 3P7UE 4MKTA 4TMNE 1KL6A 3T2HE 4XNAA 5FSPA 4GAAA 3B3BA 1FJ3A 3FUJA 1KKKA 3T8FA 1ZDPE 4MWPE 3T87A 3FTZA 3MSNA 4Q4IA 4MTWE 6TLIA 1TLXA 4N4EE 4XNBA 3T73A 3P7WE 2R59A 3FORA 3EIMA 3DNZA 3CHRA 3FGDA 4Q4EA 5JT9E 3FUFA 5JVIE 5DYFA 2HPTA 4ZX6A 4XMUA 4XMTA 1U4GA 5LIFE 4MS6A 3T8VA 3FTYA 8TLNE 3FTSA 4L2LA 4XO5A 3FVPA 1KS7A 4M65A 3ZI6A 2TMNE 4XMVA 1FJUA 3T8CA 1LNAE 2TLXA 3B34A 3P7VE 4H57A 4K89A 4PU2A 3U9WA 5AENA 1LNEE 3B7TA 3Q43A 3QJXA 3DO1A 2G4ZA 1Z9GE 3P7TE 2WI0A 1FJVA 4R5VA 3CHQA 1KEIA 1HYTA 2XPZA 5HQDA 4N66E 4RVBA 4K5NA 3FTVA 5TLNA 1QF1A 2DQMA 4MZNE 5TLIA 3T8DA 1LNBE 3QGOA 3T8HA 2XQ0A 3NQZB 4QIRA 4ZX5A 3CHPA 2HPOA 5K7TA 3FUKA 1GXWA 4OI5E 3FB0A 5L8PE 3T2IE 2VQXA 1KJOA 3FCQA 5DLHA 3DO2A 3FULA 1EZMA 3DBKA 3FU6A 4R7LA 5TMNE 4ZQTA 8TLIA 1H19A 4XN5A 4MXJE 3FTWA 3P7SE 4XO4A 5L41E 3B2XA 1PE5A 4N5PE 1PE8A 3B7UX 3FU5A 4XN4A 4XN1A 3CIAA 1NPCA 4D91A 4XN2A 2XPYA 3MSAA 1Y3GE 5DPFE 3FXSA 3QH1A 4XN7A 4TNLA 3P7QE 4TLIA 3FH8A 3FBOA 4QUOA 4ZW6A 3P7RE 1LMLA 3EBHA 4QPEA 7TLIA 3EBGA 3FUHA 1KJPA 1GW6A 3PUUA 3T74A 4QHPA 4K5OA 5FXNA 3T2JE 1SQMA 3FUEA 4XNDA 5JXNE 3DO0A 5DLLA 4J3BA 3B37A 4PVBA 4QMEA 4B52A 1FJTA 3Q44A 4XN9A 5BPPA 1TRLA 3T8GA 1QF0A 3F2PA 4PW4A 4RSYA 4ZW8A 4DPRA 5JS3E 4XMZA 4R5TA 4ZX4A 5A3YA 4K90A 3FUDA 3B7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2P A;  5FWQ A;  3FU0 A;  2WHZ A;  4K5P A;  4XN8 A;  3MSF A;  3FH7 A;  1TMN E;  3CHS A;  4K5L A;  3FHE A;  3NQY B;  4XMX A;  3FTU A;  3QH5 A;  4K5M A;  4OW3 A;  4R5X A;  1KR6 A;  3P7P E;  3FH5 A;  3B7R L;  3CHO A;  4ZW5 A;  1FJO A;  1HS6 A;  2TLI A;  3FLF A;  1FJQ A;  1KTO A;  1L3F E;  2DQ6 A;  1PE7 A;  4XO3 A;  3SSB A;  5FSJ A;  5LWD E;  5L3U E;  3F28 A;  2VJ8 A;  3NN7 A;  3FTX A;  3MS3 A;  1KRO A;  3FU3 A;  3EBI A;  3TLI A;  3LS7 A;  1ESP A;  2ZXG A;  1BQB A;  3FXP A;  2A7G E;  1TLP E;  5FSS A;  1THL A;  6TMN E;  5DPE E;  3KED A;  4X2U A;  1LND E;  3FUN A;  4GER A;  4XMW A;  1QF2 A;  1FJW A;  1OS0 A;  3FUI A;  4ZX3 A;  3N21 A;  5JSS E;  1TLI A;  3FUM A;  3FV4 A;  4TLN A;  1LNC E;  7TLN A;  3TMN E;  4ZW3 A;  4D9W A;  4ZW7 A;  1LNF E;  3NQX A;  2GTQ A;  3P7U E;  4MKT A;  4TMN E;  1KL6 A;  3T2H E;  4XNA A;  5FSP A;  4GAA A;  3B3B A;  1FJ3 A;  3FUJ A;  1KKK A;  3T8F A;  1ZDP E;  4MWP E;  3T87 A;  3FTZ A;  3MSN A;  4Q4I A;  4MTW E;  6TLI A;  1TLX A;  4N4E E;  4XNB A;  3T73 A;  3P7W E;  2R59 A;  3FOR A;  3EIM A;  3DNZ A;  3CHR A;  3FGD A;  4Q4E A;  5JT9 E;  3FUF A;  5JVI E;  5DYF A;  2HPT A;  4ZX6 A;  4XMU A;  4XMT A;  1U4G A;  5LIF E;  4MS6 A;  3T8V A;  3FTY A;  8TLN E;  3FTS A;  4L2L A;  4XO5 A;  3FVP A;  1KS7 A;  4M65 A;  3ZI6 A;  2TMN E;  4XMV A;  1FJU A;  3T8C A;  1LNA E;  2TLX A;  3B34 A;  3P7V E;  4H57 A;  4K89 A;  4PU2 A;  3U9W A;  5AEN A;  1LNE E;  3B7T A;  3Q43 A;  3QJX A;  3DO1 A;  2G4Z A;  1Z9G E;  3P7T E;  2WI0 A;  1FJV A;  4R5V A;  3CHQ A;  1KEI A;  1HYT A;  2XPZ A;  5HQD A;  4N66 E;  4RVB A;  4K5N A;  3FTV A;  5TLN A;  1QF1 A;  2DQM A;  4MZN E;  5TLI A;  3T8D A;  1LNB E;  3QGO A;  3T8H A;  2XQ0 A;  3NQZ B;  4QIR A;  4ZX5 A;  3CHP A;  2HPO A;  5K7T A;  3FUK A;  1GXW A;  4OI5 E;  3FB0 A;  5L8P E;  3T2I E;  2VQX A;  1KJO A;  3FCQ A;  5DLH A;  3DO2 A;  3FUL A;  1EZM A;  3DBK A;  3FU6 A;  4R7L A;  5TMN E;  4ZQT A;  8TLI A;  1H19 A;  4XN5 A;  4MXJ E;  3FTW A;  3P7S E;  4XO4 A;  5L41 E;  3B2X A;  1PE5 A;  4N5P E;  1PE8 A;  3B7U X;  3FU5 A;  4XN4 A;  4XN1 A;  3CIA A;  1NPC A;  4D91 A;  4XN2 A;  2XPY A;  3MSA A;  1Y3G E;  5DPF E;  3FXS A;  3QH1 A;  4XN7 A;  4TNL A;  3P7Q E;  4TLI A;  3FH8 A;  3FBO A;  4QUO A;  4ZW6 A;  3P7R E;  3EBH A;  4QPE A;  7TLI A;  3EBG A;  3FUH A;  1KJP A;  1GW6 A;  3PUU A;  3T74 A;  4QHP A;  4K5O A;  5FXN A;  3T2J E;  1SQM A;  3FUE A;  4XND A;  5JXN E;  3DO0 A;  5DLL A;  4J3B A;  3B37 A;  4PVB A;  4QME A;  4B52 A;  1FJT A;  3Q44 A;  4XN9 A;  5BPP A;  1TRL A;  3T8G A;  1QF0 A;  3F2P A;  4PW4 A;  4RSY A;  4ZW8 A;  4DPR A;  5JS3 E;  4XMZ A;  4R5T A;  4ZX4 A;  5A3Y A;  4K90 A;  3FUD A;  3B7S A; 
#chains in the Genus database with same CATH topology
 3FHE A;  3QH5 A;  4K5M A;  3P7P E;  4IHQ A;  1KTO A;  5FSJ A;  3NN7 A;  3FXP A;  5J6S A;  1TLP E;  4XMW A;  3N21 A;  1TLI A;  1LNC E;  3TMN E;  4ZW3 A;  3NQX A;  4KX7 A;  1KL6 A;  4KX9 A;  4GAA A;  1ZDP E;  3T87 A;  6TLI A;  3FOR A;  4NAQ A;  3CHR A;  4Q4E A;  3FUF A;  4ZX6 A;  3FTS A;  4L2L A;  1KS7 A;  4XMV A;  1LNA E;  3Q43 A;  2YD0 A;  3P7T E;  4E36 A;  1FJV A;  3CHQ A;  1KEI A;  1HYT A;  4N66 E;  4RVB A;  3FTV A;  1QF1 A;  3T8D A;  2XQ0 A;  3NQZ B;  4QIR A;  3CHP A;  2HPO A;  4OI5 E;  3T2I E;  1KJO A;  4MXJ E;  4XO4 A;  5L41 E;  3B2X A;  1Z5H A;  3CIA A;  1NPC A;  4D91 A;  3MSA A;  3FXS A;  4XN7 A;  5LDS A;  4QUO A;  5EV7 A;  1LML A;  3EBH A;  1KJP A;  4XND A;  4FGM A;  5BPP A;  4KX8 A;  3FUD A;  5FWQ A;  2WHZ A;  3FTU A;  4FCA A;  1KR6 A;  3FH5 A;  3B7R L;  4ZW5 A;  3FLF A;  2DQ6 A;  4FYS A;  1PE7 A;  4XO3 A;  5L3U E;  3MS3 A;  1KRO A;  3TLI A;  4Z7I A;  2A7G E;  5DPE E;  3KED A;  4X2U A;  1LND E;  3FUI A;  3FUM A;  4D9W A;  4ZW7 A;  4AR9 A;  1LNF E;  4TMN E;  3T2H E;  3B3B A;  1FJ3 A;  4MWP E;  1TLX A;  3T73 A;  3P7W E;  3DNZ A;  5JT9 E;  4MS6 A;  3T8C A;  4H57 A;  3P7V E;  4KXC A;  2G4Z A;  1Z9G E;  5K1V A;  4WZ9 A;  5TLN A;  2DQM A;  5TLI A;  4MZN E;  4ZX5 A;  5K7T A;  3FUK A;  1GXW A;  3FB0 A;  5DLH A;  3FUL A;  4XMT A;  1EZM A;  3FU6 A;  8TLI A;  4XN5 A;  1Z1W A;  4XN1 A;  3QNF A;  4ARF A;  4TNL A;  4TLI A;  4QPE A;  1GW6 A;  4K5O A;  1SQM A;  3FUE A;  5DLL A;  4P8Q A;  3B37 A;  4PVB A;  4B52 A;  3T8G A;  4XMZ A;  4K5P A;  3QJX A;  5DPF E;  3B2P A;  4XN8 A;  3MSF A;  3FH7 A;  5AB0 A;  3CHS A;  4K5L A;  4JBS A;  3MDJ A;  1FJO A;  1FJQ A;  4KXB A;  5LWD E;  3FTX A;  3FU3 A;  3EBI A;  3LS7 A;  1ESP A;  1THL A;  6TMN E;  1OS0 A;  4ZX3 A;  4TLN A;  7TLN A;  4XNA A;  5FSP A;  1KKK A;  3MSN A;  4MTW E;  4XNB A;  4N4E E;  2R59 A;  4AR1 A;  3EIM A;  3FGD A;  2HPT A;  4XMU A;  3T8V A;  8TLN E;  4XO5 A;  4HOM A;  2TMN E;  2TLX A;  3B34 A;  4K89 A;  4AR8 A;  3U9W A;  1LNE E;  3DO1 A;  4KXA A;  4R5V A;  2XPZ A;  5HQD A;  5AB2 A;  4II7 A;  3QGO A;  5L8P E;  2VQX A;  4F5C A;  4R7L A;  3FTW A;  3P7S E;  2XPY A;  1Y3G E;  4NZ8 A;  3FBO A;  5CU5 A;  3PUU A;  4FYT A;  4QHP A;  5FXN A;  3T2J E;  3DO0 A;  4J3B A;  3Q44 A;  4XN9 A;  1TRL A;  3Q7J A;  3SE6 A;  4DPR A;  4K90 A;  5TMN E;  3B7S A;  3FU0 A;  1TMN E;  4XMX A;  3NQY B;  4OW3 A;  4R5X A;  3CHO A;  1HS6 A;  2TLI A;  1L3F E;  3SSB A;  3F28 A;  2VJ8 A;  2ZXG A;  1BQB A;  5FSS A;  4FYQ A;  3FUN A;  4GER A;  1QF2 A;  1FJW A;  5JSS E;  3FV4 A;  2GTQ A;  3P7U E;  4MKT A;  3FUJ A;  3T8F A;  4KXD A;  3FTZ A;  4Q4I A;  4FYR A;  5JVI E;  5DYF A;  1U4G A;  5LIF E;  3FTY A;  3FVP A;  4M65 A;  3ZI6 A;  1FJU A;  5AEN A;  4PU2 A;  3B7T A;  2WI0 A;  4K5N A;  5LHD A;  1LNB E;  3T8H A;  3FCQ A;  4ZQT A;  3DO2 A;  3DBK A;  4OU3 A;  1H19 A;  1PE5 A;  4N5P E;  1PE8 A;  3B7U X;  3FU5 A;  4XN4 A;  4FKK A;  4FKE A;  4XN2 A;  3QH1 A;  3P7Q E;  3FH8 A;  5LG6 A;  4PJ6 A;  4ZW6 A;  3P7R E;  7TLI A;  3EBG A;  3FUH A;  5C97 A;  3T74 A;  5JXN E;  4QME A;  1FJT A;  4FKH A;  1QF0 A;  3F2P A;  4PW4 A;  4RSY A;  4ZW8 A;  5JS3 E;  4R5T A;  4ZX4 A;  5A3Y A; 
#chains in the Genus database with same CATH homology
 3B2P A;  5FWQ A;  3FU0 A;  2WHZ A;  4K5P A;  4XN8 A;  3MSF A;  3FH7 A;  1TMN E;  3CHS A;  4K5L A;  3FHE A;  3NQY B;  4XMX A;  3FTU A;  3QH5 A;  4K5M A;  4OW3 A;  4R5X A;  1KR6 A;  3P7P E;  3FH5 A;  3B7R L;  3CHO A;  4ZW5 A;  1FJO A;  1HS6 A;  2TLI A;  3FLF A;  1FJQ A;  1KTO A;  1L3F E;  2DQ6 A;  1PE7 A;  4XO3 A;  3SSB A;  5FSJ A;  5LWD E;  5L3U E;  3F28 A;  2VJ8 A;  3NN7 A;  3FTX A;  3MS3 A;  1KRO A;  3FU3 A;  3EBI A;  3TLI A;  3LS7 A;  1ESP A;  2ZXG A;  1BQB A;  3FXP A;  2A7G E;  1TLP E;  5FSS A;  1THL A;  6TMN E;  5DPE E;  3KED A;  4X2U A;  1LND E;  3FUN A;  4GER A;  4XMW A;  1QF2 A;  1FJW A;  1OS0 A;  3FUI A;  4ZX3 A;  3N21 A;  5JSS E;  1TLI A;  3FUM A;  3FV4 A;  4TLN A;  1LNC E;  7TLN A;  3TMN E;  4ZW3 A;  4D9W A;  4ZW7 A;  1LNF E;  3NQX A;  2GTQ A;  3P7U E;  4MKT A;  4TMN E;  1KL6 A;  3T2H E;  4XNA A;  5FSP A;  4GAA A;  3B3B A;  1FJ3 A;  3FUJ A;  1KKK A;  3T8F A;  1ZDP E;  4MWP E;  3T87 A;  3FTZ A;  3MSN A;  4Q4I A;  4MTW E;  6TLI A;  1TLX A;  4N4E E;  4XNB A;  3T73 A;  3P7W E;  2R59 A;  3FOR A;  3EIM A;  3DNZ A;  3CHR A;  3FGD A;  4Q4E A;  5JT9 E;  3FUF A;  5JVI E;  5DYF A;  2HPT A;  4ZX6 A;  4XMU A;  4XMT A;  1U4G A;  5LIF E;  4MS6 A;  3T8V A;  3FTY A;  8TLN E;  3FTS A;  4L2L A;  4XO5 A;  3FVP A;  1KS7 A;  4M65 A;  3ZI6 A;  2TMN E;  4XMV A;  1FJU A;  3T8C A;  1LNA E;  2TLX A;  3B34 A;  3P7V E;  4H57 A;  4K89 A;  4PU2 A;  3U9W A;  5AEN A;  1LNE E;  3B7T A;  3Q43 A;  3QJX A;  3DO1 A;  2G4Z A;  1Z9G E;  3P7T E;  2WI0 A;  1FJV A;  4R5V A;  3CHQ A;  1KEI A;  1HYT A;  2XPZ A;  5HQD A;  4N66 E;  4RVB A;  4K5N A;  3FTV A;  5TLN A;  1QF1 A;  2DQM A;  4MZN E;  5TLI A;  3T8D A;  1LNB E;  3QGO A;  3T8H A;  2XQ0 A;  3NQZ B;  4QIR A;  4ZX5 A;  3CHP A;  2HPO A;  5K7T A;  3FUK A;  1GXW A;  4OI5 E;  3FB0 A;  5L8P E;  3T2I E;  2VQX A;  1KJO A;  3FCQ A;  5DLH A;  3DO2 A;  3FUL A;  1EZM A;  3DBK A;  3FU6 A;  4R7L A;  5TMN E;  4ZQT A;  8TLI A;  1H19 A;  4XN5 A;  4MXJ E;  3FTW A;  3P7S E;  4XO4 A;  5L41 E;  3B2X A;  1PE5 A;  4N5P E;  1PE8 A;  3B7U X;  3FU5 A;  4XN4 A;  4XN1 A;  3CIA A;  1NPC A;  4D91 A;  4XN2 A;  2XPY A;  3MSA A;  1Y3G E;  5DPF E;  3FXS A;  3QH1 A;  4XN7 A;  4TNL A;  3P7Q E;  4TLI A;  3FH8 A;  3FBO A;  4QUO A;  4ZW6 A;  3P7R E;  1LML A;  3EBH A;  4QPE A;  7TLI A;  3EBG A;  3FUH A;  1KJP A;  1GW6 A;  3PUU A;  3T74 A;  4QHP A;  4K5O A;  5FXN A;  3T2J E;  1SQM A;  3FUE A;  4XND A;  5JXN E;  3DO0 A;  5DLL A;  4J3B A;  3B37 A;  4PVB A;  4QME A;  4B52 A;  1FJT A;  3Q44 A;  4XN9 A;  5BPP A;  1TRL A;  3T8G A;  1QF0 A;  3F2P A;  4PW4 A;  4RSY A;  4ZW8 A;  4DPR A;  5JS3 E;  4XMZ A;  4R5T A;  4ZX4 A;  5A3Y A;  4K90 A;  3FUD A;  3B7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...