3NQZB

Crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
307
Chain Sequence
ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGTSGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQLQMRVHYSSNYENAFWDGSAMTFGDGQNTFYPLVSLDVSAHEVSHGFTEQNSGLIYNGKPGGLNAAFSDMAGEAAEFYMKGSNDWLVGKDIFKGNGALRYMNNPTQDGRSIDNQSNYYSGMDVHYSSGVYNKAFYNLATTPGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACDLNYDPNDVKAALAAVGVNSNLSSGSDCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted metalloprotease Mcp02
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 109
structure length 307
sequence length 307
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
B PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3nqzB02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3nqzB01
3T8GA 5L8PE 1HYTA 1TLIA 3B2PA 3T2IE 3TLIA 5JS3E 3EBIA 5DLLA 3FVPA 1KKKA 3FUFA 4ZW8A 5FWQA 3FB0A 3T74A 5JXNE 3FULA 4XMZA 4ZQTA 4K5LA 3FU3A 3FHEA 3FUDA 4QMEA 1QF0A 3CIAA 1TLXA 3P7WE 4TLIA 3FV4A 3FUKA 4XMUA 5JSSE 3FTVA 4RVBA 4ZW7A 1KS7A 2XPYA 4MTWE 3MSNA 3PUUA 4K90A 3N21A 3B7UX 4R5TA 1EZMA 3FBOA 4XNAA 3FH7A 3DBKA 4XN2A 1GW6A 4D9WA 3B7RL 3Q44A 3EBGA 1PE7A 4XN5A 1THLA 4XMTA 4R7LA 4OW3A 3P7RE 3SSBA 4ZW3A 3T8FA 7TLNA 4N66E 1KR6A 6TMNE 2DQMA 3CHRA 5FSPA 4MKTA 1FJOA 5FSSA 4MS6A 5L3UE 1LNEE 5DLHA 3MS3A 1QF2A 4Q4IA 3EBHA 4QIRA 4GAAA 4M65A 2GTQA 5TLNA 7TLIA 3EIMA 5L41E 3FU0A 4GERA 4X2UA 5TLIA 3FXPA 4QPEA 3FH8A 3B3BA 2HPOA 2HPTA 3P7PE 4XO3A 4K5OA 5A3YA 1U4GA 1ZDPE 3FTYA 3T87A 4XNBA 4PVBA 2VQXA 3FU5A 3T8CA 3P7SE 3ZI6A 5LIFE 4QUOA 1FJUA 3FUMA 2R59A 3KEDA 3T8HA 4DPRA 4TNLA 4K5NA 5LWDE 4Q4EA 3FUIA 4XMXA 4XN8A 3TMNE 5AENA 3FORA 3FUNA 5JVIE 3CHQA 4XN4A 2TMNE 1TLPE 4MXJE 3CHPA 4RSYA 2TLIA 4XMVA 4XN1A 1HS6A 3T8VA 4PU2A 1PE5A 4B52A 1KJPA 1OS0A 3FU6A 3QGOA 3FTZA 4XN7A 3FH5A 1KROA 3FTUA 4H57A 2TLXA 3QJXA 3DO1A 1GXWA 3FUEA 1FJTA 4XO4A 3T73A 8TLNE 3QH5A 3LS7A 2XQ0A 2ZXGA 4J3BA 3NQXA 3F2PA 1H19A 3MSAA 4OI5E 3F28A 4TMNE 5DPFE 3B37A 3FTXA 5FXNA 3T8DA 8TLIA 3B2XA 4R5VA 3QH1A 4QHPA 3P7QE 3FUHA 3DNZA 4ZX3A 3NN7A 1PE8A 4N5PE 3B7TA 4N4EE 1LNCE 3FGDA 4ZX5A 1LNAE 4MZNE 4TLNA 1SQMA 4ZW6A 3B7SA 3FCQA 3P7VE 4K5PA 3FTSA 5DYFA 1Y3GE 3DO2A 3NQYB 4ZX6A 3FXSA 2WI0A 2XPZA 4L2LA 1KEIA 3CHSA 3T2HE 1KTOA 4D91A 4R5XA 4PW4A 5HQDA 2VJ8A 3NQZB 4K89A 1FJ3A 5JT9E 1NPCA 2G4ZA 4ZW5A 2WHZA 5BPPA 1FJWA 1Z9GE 1L3FE 4XNDA 1FJQA 3B34A 1KJOA 1QF1A 3Q43A 3CHOA 5DPEE 3P7UE 6TLIA 1KL6A 1LNDE 3T2JE 1ESPA 5TMNE 5K7TA 3DO0A 3FUJA 2DQ6A 3P7TE 1LNFE 3FLFA 2A7GE 4XO5A 4ZX4A 3FTWA 1LNBE 3U9WA 4XMWA 5FSJA 1TRLA 3MSFA 1FJVA 4K5MA 1TMNE 4XN9A 1BQBA 4MWPE
chains in the Genus database with same CATH superfamily
1HYTA 3FUFA 4ZQTA 4K5LA 5JSSE 1KS7A 2XPYA 3PUUA 1EZMA 5EV7A 3EBGA 7TLNA 2DQMA 3MS3A 1QF2A 3EBHA 4X2UA 3FXPA 5A3YA 3FTYA 3T8CA 3P7SE 3T8HA 4DPRA 3FUIA 4FKHA 4XN4A 2TMNE 3CHPA 4XMVA 4XN1A 4PU2A 1PE5A 3FU6A 3QGOA 3FTZA 1KROA 3FTUA 8TLNE 3MSAA 1H19A 4OI5E 5DPFE 3FTXA 4F5CA 1LMLA 3QH1A 4QHPA 1PE8A 5AB2A 3FGDA 4ZW6A 3B7SA 1Y3GE 3NQYB 3T2HE 3QNFA 3SE6A 4R5XA 3NQZB 4AR1A 2G4ZA 2WHZA 1KJOA 5DPEE 6TLIA 1LNDE 3FUJA 3P7TE 4E36A 1TMNE 4P8QA 3T8GA 5L8PE 3T2IE 3EBIA 3FB0A 3T74A 3FULA 4QMEA 3FU3A 1QF0A 3CIAA 4TLIA 4RVBA 4XNAA 3FH7A 3B7RL 4XN5A 4Z7IA 4OW3A 6TMNE 4KX8A 5DLHA 5TLNA 5AB0A 4KX9A 5L41E 4FGMA 4QPEA 2HPOA 3T87A 1ZDPE 4AR8A 4XNBA 4PVBA 3ZI6A 3FUMA 2R59A 3KEDA 4FCAA 4K5NA 4II7A 5JVIE 3CHQA 4RSYA 4H57A 2TLXA 3DO1A 3FUEA 3T73A 1FJTA 4FYSA 3LS7A 4NZ8A 3MDJA 3T8DA 5C97A 3P7QE 4N4EE 1SQMA 3FTSA 2WI0A 2XPZA 4KXAA 1KEIA 5HQDA 2VJ8A 4K89A 5LDSA 1NPCA 1Z9GE 3Q43A 5LWDE 1ESPA 3DO0A 2DQ6A 4XO5A 4ZX4A 5LG6A 3FTWA 1LNBE 1TRLA 1BQBA 4MWPE 4FYTA 1TLIA 5DLLA 1KKKA 4ZW8A 4XMZA 3FHEA 3FUDA 3P7WE 3FUKA 4KXCA 4HOMA 3FTVA 4ZW7A 5K1VA 4K90A 3N21A 3B7UX 3FBOA 4D9WA 1GW6A 1PE7A 4XMTA 3SSBA 4N66E 5FSPA 4MKTA 3Q7JA 5L3UE 1LNEE 4Q4IA 4QIRA 4GAAA 2YD0A 3FU0A 4GERA 5TLIA 3B3BA 2HPTA 4XO3A 4K5OA 1Z5HA 2VQXA 3FU5A 5LIFE 4QUOA 4Q4EA 5AENA 3FORA 3FUNA 1TLPE 2TLIA 3T8VA 4KXDA 4B52A 1OS0A 3FH5A 4FKEA 3QJXA 4XO4A 2XQ0A 4J3BA 3F28A 4TMNE 8TLIA 3B2XA 3FUHA 4ZX3A 3NN7A 4ZX5A 1LNAE 3P7VE 4K5PA 4JBSA 3FXSA 4L2LA 4NAQA 3CHSA 1KTOA 1FJ3A 5JT9E 1FJWA 4XNDA 3B34A 4KXBA 3P7UE 5K7TA 4XMWA 5FSJA 1FJVA 3B2PA 3TLIA 5JS3E 4FYQA 3FVPA 5FWQA 5JXNE 1TLXA 3FV4A 4PJ6A 4XMUA 4MTWE 3MSNA 4R5TA 3DBKA 4XN2A 3Q44A 1THLA 4R7LA 3P7RE 4ZW3A 3T8FA 1KR6A 3CHRA 4WZ9A 1FJOA 5FSSA 4MS6A 4M65A 1Z1WA 2GTQA 7TLIA 3EIMA 5J6SA 4KX7A 3FH8A 5LHDA 3P7PE 4AR9A 1U4GA 1FJUA 4FKKA 4TNLA 5CU5A 4XMXA 3TMNE 4MXJE 1HS6A 1KJPA 4XN7A 4FYRA 1GXWA 4ARFA 3QH5A 2ZXGA 3NQXA 3F2PA 3B37A 5FXNA 4R5VA 3DNZA 4N5PE 3B7TA 1LNCE 4MZNE 4TLNA 3FCQA 5DYFA 4ZX6A 3DO2A 4D91A 4PW4A 4OU3A 4IHQA 4ZW5A 5BPPA 1L3FE 1FJQA 1QF1A 3CHOA 1KL6A 3T2JE 5TMNE 1LNFE 3FLFA 2A7GE 3U9WA 3MSFA 4K5MA 4XN9A 4XN8A
chains in the Genus database with same CATH topology
3T8GA 5L8PE 1HYTA 1TLIA 3B2PA 3T2IE 3TLIA 5JS3E 3EBIA 5DLLA 3FVPA 1KKKA 3FUFA 4ZW8A 5FWQA 3FB0A 3T74A 5JXNE 3FULA 4XMZA 4ZQTA 4K5LA 3FU3A 3FHEA 3FUDA 4QMEA 1QF0A 3CIAA 1TLXA 3P7WE 4TLIA 3FV4A 3FUKA 4XMUA 5JSSE 3FTVA 4RVBA 4ZW7A 1KS7A 2XPYA 4MTWE 3MSNA 3PUUA 4K90A 3N21A 3B7UX 4R5TA 1EZMA 3FBOA 4XNAA 3FH7A 3DBKA 4XN2A 1GW6A 4D9WA 3B7RL 3Q44A 3EBGA 1PE7A 4XN5A 1THLA 4XMTA 4R7LA 4OW3A 3P7RE 3SSBA 4ZW3A 3T8FA 7TLNA 4N66E 1KR6A 6TMNE 2DQMA 3CHRA 5FSPA 4MKTA 1FJOA 5FSSA 4MS6A 5L3UE 1LNEE 5DLHA 3MS3A 1QF2A 4Q4IA 3EBHA 4QIRA 4GAAA 4M65A 2GTQA 5TLNA 7TLIA 3EIMA 5L41E 3FU0A 4GERA 4X2UA 5TLIA 3FXPA 4QPEA 3FH8A 3B3BA 2HPOA 2HPTA 3P7PE 4XO3A 4K5OA 5A3YA 1U4GA 1ZDPE 3FTYA 3T87A 4XNBA 4PVBA 2VQXA 3FU5A 3T8CA 3P7SE 3ZI6A 5LIFE 4QUOA 1FJUA 3FUMA 2R59A 3KEDA 3T8HA 4DPRA 4TNLA 4K5NA 5LWDE 4Q4EA 3FUIA 4XMXA 4XN8A 3TMNE 5AENA 3FORA 3FUNA 5JVIE 3CHQA 4XN4A 2TMNE 1TLPE 4MXJE 3CHPA 4RSYA 2TLIA 4XMVA 4XN1A 1HS6A 3T8VA 4PU2A 1PE5A 4B52A 1KJPA 1OS0A 3FU6A 3QGOA 3FTZA 4XN7A 3FH5A 1KROA 3FTUA 4H57A 2TLXA 3QJXA 3DO1A 1GXWA 3FUEA 1FJTA 4XO4A 3T73A 8TLNE 3QH5A 3LS7A 2XQ0A 2ZXGA 4J3BA 3NQXA 3F2PA 1H19A 3MSAA 4OI5E 3F28A 4TMNE 5DPFE 3B37A 3FTXA 5FXNA 3T8DA 8TLIA 3B2XA 4R5VA 1LMLA 3QH1A 4QHPA 3P7QE 3FUHA 3DNZA 4ZX3A 3NN7A 1PE8A 4N5PE 3B7TA 4N4EE 1LNCE 3FGDA 4ZX5A 1LNAE 4MZNE 4TLNA 1SQMA 4ZW6A 3B7SA 3FCQA 3P7VE 4K5PA 3FTSA 5DYFA 1Y3GE 3DO2A 3NQYB 4ZX6A 3FXSA 2WI0A 2XPZA 4L2LA 1KEIA 3CHSA 3T2HE 1KTOA 4D91A 4R5XA 4PW4A 5HQDA 2VJ8A 3NQZB 4K89A 1FJ3A 5JT9E 1NPCA 2G4ZA 4ZW5A 2WHZA 5BPPA 1FJWA 1Z9GE 1L3FE 4XNDA 1FJQA 3B34A 1KJOA 1QF1A 3Q43A 3CHOA 5DPEE 3P7UE 6TLIA 1KL6A 1LNDE 3T2JE 1ESPA 5TMNE 5K7TA 3DO0A 3FUJA 2DQ6A 3P7TE 1LNFE 3FLFA 2A7GE 4XO5A 4ZX4A 3FTWA 1LNBE 3U9WA 4XMWA 5FSJA 1TRLA 3MSFA 1FJVA 4K5MA 1TMNE 4XN9A 1BQBA 4MWPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T8G A;  5L8P E;  1HYT A;  1TLI A;  3B2P A;  3T2I E;  3TLI A;  5JS3 E;  3EBI A;  5DLL A;  3FVP A;  1KKK A;  3FUF A;  4ZW8 A;  5FWQ A;  3FB0 A;  3T74 A;  5JXN E;  3FUL A;  4XMZ A;  4ZQT A;  4K5L A;  3FU3 A;  3FHE A;  3FUD A;  4QME A;  1QF0 A;  3CIA A;  1TLX A;  3P7W E;  4TLI A;  3FV4 A;  3FUK A;  4XMU A;  5JSS E;  3FTV A;  4RVB A;  4ZW7 A;  1KS7 A;  2XPY A;  4MTW E;  3MSN A;  3PUU A;  4K90 A;  3N21 A;  3B7U X;  4R5T A;  1EZM A;  3FBO A;  4XNA A;  3FH7 A;  3DBK A;  4XN2 A;  1GW6 A;  4D9W A;  3B7R L;  3Q44 A;  3EBG A;  1PE7 A;  4XN5 A;  1THL A;  4XMT A;  4R7L A;  4OW3 A;  3P7R E;  3SSB A;  4ZW3 A;  3T8F A;  7TLN A;  4N66 E;  1KR6 A;  6TMN E;  2DQM A;  3CHR A;  5FSP A;  4MKT A;  1FJO A;  5FSS A;  4MS6 A;  5L3U E;  1LNE E;  5DLH A;  3MS3 A;  1QF2 A;  4Q4I A;  3EBH A;  4QIR A;  4GAA A;  4M65 A;  2GTQ A;  5TLN A;  7TLI A;  3EIM A;  5L41 E;  3FU0 A;  4GER A;  4X2U A;  5TLI A;  3FXP A;  4QPE A;  3FH8 A;  3B3B A;  2HPO A;  2HPT A;  3P7P E;  4XO3 A;  4K5O A;  5A3Y A;  1U4G A;  1ZDP E;  3FTY A;  3T87 A;  4XNB A;  4PVB A;  2VQX A;  3FU5 A;  3T8C A;  3P7S E;  3ZI6 A;  5LIF E;  4QUO A;  1FJU A;  3FUM A;  2R59 A;  3KED A;  3T8H A;  4DPR A;  4TNL A;  4K5N A;  5LWD E;  4Q4E A;  3FUI A;  4XMX A;  4XN8 A;  3TMN E;  5AEN A;  3FOR A;  3FUN A;  5JVI E;  3CHQ A;  4XN4 A;  2TMN E;  1TLP E;  4MXJ E;  3CHP A;  4RSY A;  2TLI A;  4XMV A;  4XN1 A;  1HS6 A;  3T8V A;  4PU2 A;  1PE5 A;  4B52 A;  1KJP A;  1OS0 A;  3FU6 A;  3QGO A;  3FTZ A;  4XN7 A;  3FH5 A;  1KRO A;  3FTU A;  4H57 A;  2TLX A;  3QJX A;  3DO1 A;  1GXW A;  3FUE A;  1FJT A;  4XO4 A;  3T73 A;  8TLN E;  3QH5 A;  3LS7 A;  2XQ0 A;  2ZXG A;  4J3B A;  3NQX A;  3F2P A;  1H19 A;  3MSA A;  4OI5 E;  3F28 A;  4TMN E;  5DPF E;  3B37 A;  3FTX A;  5FXN A;  3T8D A;  8TLI A;  3B2X A;  4R5V A;  3QH1 A;  4QHP A;  3P7Q E;  3FUH A;  3DNZ A;  4ZX3 A;  3NN7 A;  1PE8 A;  4N5P E;  3B7T A;  4N4E E;  1LNC E;  3FGD A;  4ZX5 A;  1LNA E;  4MZN E;  4TLN A;  1SQM A;  4ZW6 A;  3B7S A;  3FCQ A;  3P7V E;  4K5P A;  3FTS A;  5DYF A;  1Y3G E;  3DO2 A;  3NQY B;  4ZX6 A;  3FXS A;  2WI0 A;  2XPZ A;  4L2L A;  1KEI A;  3CHS A;  3T2H E;  1KTO A;  4D91 A;  4R5X A;  4PW4 A;  5HQD A;  2VJ8 A;  3NQZ B;  4K89 A;  1FJ3 A;  5JT9 E;  1NPC A;  2G4Z A;  4ZW5 A;  2WHZ A;  5BPP A;  1FJW A;  1Z9G E;  1L3F E;  4XND A;  1FJQ A;  3B34 A;  1KJO A;  1QF1 A;  3Q43 A;  3CHO A;  5DPE E;  3P7U E;  6TLI A;  1KL6 A;  1LND E;  3T2J E;  1ESP A;  5TMN E;  5K7T A;  3DO0 A;  3FUJ A;  2DQ6 A;  3P7T E;  1LNF E;  3FLF A;  2A7G E;  4XO5 A;  4ZX4 A;  3FTW A;  1LNB E;  3U9W A;  4XMW A;  5FSJ A;  1TRL A;  3MSF A;  1FJV A;  4K5M A;  1TMN E;  4XN9 A;  1BQB A;  4MWP E; 
#chains in the Genus database with same CATH topology
 1HYT A;  3FUF A;  4ZQT A;  4K5L A;  5JSS E;  1KS7 A;  2XPY A;  3PUU A;  1EZM A;  5EV7 A;  3EBG A;  7TLN A;  2DQM A;  3MS3 A;  1QF2 A;  3EBH A;  4X2U A;  3FXP A;  5A3Y A;  3FTY A;  3T8C A;  3P7S E;  3T8H A;  4DPR A;  3FUI A;  4FKH A;  4XN4 A;  2TMN E;  3CHP A;  4XMV A;  4XN1 A;  4PU2 A;  1PE5 A;  3FU6 A;  3QGO A;  3FTZ A;  1KRO A;  3FTU A;  8TLN E;  3MSA A;  1H19 A;  4OI5 E;  5DPF E;  3FTX A;  4F5C A;  1LML A;  3QH1 A;  4QHP A;  1PE8 A;  5AB2 A;  3FGD A;  4ZW6 A;  3B7S A;  1Y3G E;  3NQY B;  3T2H E;  3QNF A;  3SE6 A;  4R5X A;  3NQZ B;  4AR1 A;  2G4Z A;  2WHZ A;  1KJO A;  5DPE E;  6TLI A;  1LND E;  3FUJ A;  3P7T E;  4E36 A;  1TMN E;  4P8Q A;  3T8G A;  5L8P E;  3T2I E;  3EBI A;  3FB0 A;  3T74 A;  3FUL A;  4QME A;  3FU3 A;  1QF0 A;  3CIA A;  4TLI A;  4RVB A;  4XNA A;  3FH7 A;  3B7R L;  4XN5 A;  4Z7I A;  4OW3 A;  6TMN E;  4KX8 A;  5DLH A;  5TLN A;  5AB0 A;  4KX9 A;  5L41 E;  4FGM A;  4QPE A;  2HPO A;  3T87 A;  1ZDP E;  4AR8 A;  4XNB A;  4PVB A;  3ZI6 A;  3FUM A;  2R59 A;  3KED A;  4FCA A;  4K5N A;  4II7 A;  5JVI E;  3CHQ A;  4RSY A;  4H57 A;  2TLX A;  3DO1 A;  3FUE A;  3T73 A;  1FJT A;  4FYS A;  3LS7 A;  4NZ8 A;  3MDJ A;  3T8D A;  5C97 A;  3P7Q E;  4N4E E;  1SQM A;  3FTS A;  2WI0 A;  2XPZ A;  4KXA A;  1KEI A;  5HQD A;  2VJ8 A;  4K89 A;  5LDS A;  1NPC A;  1Z9G E;  3Q43 A;  5LWD E;  1ESP A;  3DO0 A;  2DQ6 A;  4XO5 A;  4ZX4 A;  5LG6 A;  3FTW A;  1LNB E;  1TRL A;  1BQB A;  4MWP E;  4FYT A;  1TLI A;  5DLL A;  1KKK A;  4ZW8 A;  4XMZ A;  3FHE A;  3FUD A;  3P7W E;  3FUK A;  4KXC A;  4HOM A;  3FTV A;  4ZW7 A;  5K1V A;  4K90 A;  3N21 A;  3B7U X;  3FBO A;  4D9W A;  1GW6 A;  1PE7 A;  4XMT A;  3SSB A;  4N66 E;  5FSP A;  4MKT A;  3Q7J A;  5L3U E;  1LNE E;  4Q4I A;  4QIR A;  4GAA A;  2YD0 A;  3FU0 A;  4GER A;  5TLI A;  3B3B A;  2HPT A;  4XO3 A;  4K5O A;  1Z5H A;  2VQX A;  3FU5 A;  5LIF E;  4QUO A;  4Q4E A;  5AEN A;  3FOR A;  3FUN A;  1TLP E;  2TLI A;  3T8V A;  4KXD A;  4B52 A;  1OS0 A;  3FH5 A;  4FKE A;  3QJX A;  4XO4 A;  2XQ0 A;  4J3B A;  3F28 A;  4TMN E;  8TLI A;  3B2X A;  3FUH A;  4ZX3 A;  3NN7 A;  4ZX5 A;  1LNA E;  3P7V E;  4K5P A;  4JBS A;  3FXS A;  4L2L A;  4NAQ A;  3CHS A;  1KTO A;  1FJ3 A;  5JT9 E;  1FJW A;  4XND A;  3B34 A;  4KXB A;  3P7U E;  5K7T A;  4XMW A;  5FSJ A;  1FJV A;  3B2P A;  3TLI A;  5JS3 E;  4FYQ A;  3FVP A;  5FWQ A;  5JXN E;  1TLX A;  3FV4 A;  4PJ6 A;  4XMU A;  4MTW E;  3MSN A;  4R5T A;  3DBK A;  4XN2 A;  3Q44 A;  1THL A;  4R7L A;  3P7R E;  4ZW3 A;  3T8F A;  1KR6 A;  3CHR A;  4WZ9 A;  1FJO A;  5FSS A;  4MS6 A;  4M65 A;  1Z1W A;  2GTQ A;  7TLI A;  3EIM A;  5J6S A;  4KX7 A;  3FH8 A;  5LHD A;  3P7P E;  4AR9 A;  1U4G A;  1FJU A;  4FKK A;  4TNL A;  5CU5 A;  4XMX A;  3TMN E;  4MXJ E;  1HS6 A;  1KJP A;  4XN7 A;  4FYR A;  1GXW A;  4ARF A;  3QH5 A;  2ZXG A;  3NQX A;  3F2P A;  3B37 A;  5FXN A;  4R5V A;  3DNZ A;  4N5P E;  3B7T A;  1LNC E;  4MZN E;  4TLN A;  3FCQ A;  5DYF A;  4ZX6 A;  3DO2 A;  4D91 A;  4PW4 A;  4OU3 A;  4IHQ A;  4ZW5 A;  5BPP A;  1L3F E;  1FJQ A;  1QF1 A;  3CHO A;  1KL6 A;  3T2J E;  5TMN E;  1LNF E;  3FLF A;  2A7G E;  3U9W A;  3MSF A;  4K5M A;  4XN9 A;  4XN8 A; 
#chains in the Genus database with same CATH homology
 3T8G A;  5L8P E;  1HYT A;  1TLI A;  3B2P A;  3T2I E;  3TLI A;  5JS3 E;  3EBI A;  5DLL A;  3FVP A;  1KKK A;  3FUF A;  4ZW8 A;  5FWQ A;  3FB0 A;  3T74 A;  5JXN E;  3FUL A;  4XMZ A;  4ZQT A;  4K5L A;  3FU3 A;  3FHE A;  3FUD A;  4QME A;  1QF0 A;  3CIA A;  1TLX A;  3P7W E;  4TLI A;  3FV4 A;  3FUK A;  4XMU A;  5JSS E;  3FTV A;  4RVB A;  4ZW7 A;  1KS7 A;  2XPY A;  4MTW E;  3MSN A;  3PUU A;  4K90 A;  3N21 A;  3B7U X;  4R5T A;  1EZM A;  3FBO A;  4XNA A;  3FH7 A;  3DBK A;  4XN2 A;  1GW6 A;  4D9W A;  3B7R L;  3Q44 A;  3EBG A;  1PE7 A;  4XN5 A;  1THL A;  4XMT A;  4R7L A;  4OW3 A;  3P7R E;  3SSB A;  4ZW3 A;  3T8F A;  7TLN A;  4N66 E;  1KR6 A;  6TMN E;  2DQM A;  3CHR A;  5FSP A;  4MKT A;  1FJO A;  5FSS A;  4MS6 A;  5L3U E;  1LNE E;  5DLH A;  3MS3 A;  1QF2 A;  4Q4I A;  3EBH A;  4QIR A;  4GAA A;  4M65 A;  2GTQ A;  5TLN A;  7TLI A;  3EIM A;  5L41 E;  3FU0 A;  4GER A;  4X2U A;  5TLI A;  3FXP A;  4QPE A;  3FH8 A;  3B3B A;  2HPO A;  2HPT A;  3P7P E;  4XO3 A;  4K5O A;  5A3Y A;  1U4G A;  1ZDP E;  3FTY A;  3T87 A;  4XNB A;  4PVB A;  2VQX A;  3FU5 A;  3T8C A;  3P7S E;  3ZI6 A;  5LIF E;  4QUO A;  1FJU A;  3FUM A;  2R59 A;  3KED A;  3T8H A;  4DPR A;  4TNL A;  4K5N A;  5LWD E;  4Q4E A;  3FUI A;  4XMX A;  4XN8 A;  3TMN E;  5AEN A;  3FOR A;  3FUN A;  5JVI E;  3CHQ A;  4XN4 A;  2TMN E;  1TLP E;  4MXJ E;  3CHP A;  4RSY A;  2TLI A;  4XMV A;  4XN1 A;  1HS6 A;  3T8V A;  4PU2 A;  1PE5 A;  4B52 A;  1KJP A;  1OS0 A;  3FU6 A;  3QGO A;  3FTZ A;  4XN7 A;  3FH5 A;  1KRO A;  3FTU A;  4H57 A;  2TLX A;  3QJX A;  3DO1 A;  1GXW A;  3FUE A;  1FJT A;  4XO4 A;  3T73 A;  8TLN E;  3QH5 A;  3LS7 A;  2XQ0 A;  2ZXG A;  4J3B A;  3NQX A;  3F2P A;  1H19 A;  3MSA A;  4OI5 E;  3F28 A;  4TMN E;  5DPF E;  3B37 A;  3FTX A;  5FXN A;  3T8D A;  8TLI A;  3B2X A;  4R5V A;  1LML A;  3QH1 A;  4QHP A;  3P7Q E;  3FUH A;  3DNZ A;  4ZX3 A;  3NN7 A;  1PE8 A;  4N5P E;  3B7T A;  4N4E E;  1LNC E;  3FGD A;  4ZX5 A;  1LNA E;  4MZN E;  4TLN A;  1SQM A;  4ZW6 A;  3B7S A;  3FCQ A;  3P7V E;  4K5P A;  3FTS A;  5DYF A;  1Y3G E;  3DO2 A;  3NQY B;  4ZX6 A;  3FXS A;  2WI0 A;  2XPZ A;  4L2L A;  1KEI A;  3CHS A;  3T2H E;  1KTO A;  4D91 A;  4R5X A;  4PW4 A;  5HQD A;  2VJ8 A;  3NQZ B;  4K89 A;  1FJ3 A;  5JT9 E;  1NPC A;  2G4Z A;  4ZW5 A;  2WHZ A;  5BPP A;  1FJW A;  1Z9G E;  1L3F E;  4XND A;  1FJQ A;  3B34 A;  1KJO A;  1QF1 A;  3Q43 A;  3CHO A;  5DPE E;  3P7U E;  6TLI A;  1KL6 A;  1LND E;  3T2J E;  1ESP A;  5TMN E;  5K7T A;  3DO0 A;  3FUJ A;  2DQ6 A;  3P7T E;  1LNF E;  3FLF A;  2A7G E;  4XO5 A;  4ZX4 A;  3FTW A;  1LNB E;  3U9W A;  4XMW A;  5FSJ A;  1TRL A;  3MSF A;  1FJV A;  4K5M A;  1TMN E;  4XN9 A;  1BQB A;  4MWP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...