3NQZB

Crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
307
Chain Sequence
ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGTSGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQLQMRVHYSSNYENAFWDGSAMTFGDGQNTFYPLVSLDVSAHEVSHGFTEQNSGLIYNGKPGGLNAAFSDMAGEAAEFYMKGSNDWLVGKDIFKGNGALRYMNNPTQDGRSIDNQSNYYSGMDVHYSSGVYNKAFYNLATTPGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACDLNYDPNDVKAALAAVGVNSNLSSGSDCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
molecule keywords Secreted metalloprotease Mcp02
total genus 109
structure length 307
sequence length 307
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
B PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3nqzB02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3nqzB01
5JXNE 1Z9GE 2TLXA 4PW4A 4GAAA 5TLIA 3T8HA 4GERA 1ZDPE 2DQMA 3FTYA 1FJWA 4XMWA 4D91A 2TMNE 3DO0A 3QGOA 3FLFA 5L8PE 3TLIA 5JS3E 3FUKA 3CHRA 3FUNA 4QHPA 4ZW7A 5BPPA 3EIMA 1NPCA 5L3UE 2XPZA 3B3BA 5AENA 1Y3GE 3F2PA 3B37A 2WHZA 3F28A 4K5PA 3MSNA 2XPYA 4XN2A 2WI0A 3CHPA 4ZQTA 2XQ0A 1LNAE 4R5TA 1KEIA 3SSBA 3T8VA 1HYTA 3FUHA 4XN8A 3FU3A 4L2LA 3B2PA 4Q4EA 4MWPE 3N21A 3FUIA 3FU6A 3MSAA 4N4EE 3FUFA 3NQYB 3FTVA 4Q4IA 3FTUA 3FB0A 3FHEA 4MKTA 4XN1A 5FSPA 3Q43A 3B2XA 3T8DA 3TMNE 5JVIE 2VJ8A 1FJVA 5JT9E 1HS6A 3FTXA 3FTWA 4TNLA 5LIFE 3FH5A 4QUOA 4PVBA 8TLIA 3FUMA 3FVPA 4K5MA 4ZX5A 1TRLA 4QIRA 3FTSA 3T74A 4ZX3A 5FSSA 2A7GE 2GTQA 3QH5A 4N66E 5DLHA 1THLA 4XMXA 3ZI6A 3MS3A 3T8GA 5FSJA 3T2IE 3P7TE 2G4ZA 3T2JE 4J3BA 3DO1A 4MS6A 4XO3A 5DLLA 4R7LA 1FJTA 5K7TA 5JSSE 4MZNE 2R59A 4K5LA 4XN5A 4XO4A 3QH1A 3FUJA 4M65A 1TLXA 1LNFE 1ESPA 1EZMA 1KR6A 4RSYA 3FH7A 4RVBA 6TMNE 3T73A 5FWQA 8TLNE 1GXWA 4H57A 3B34A 1H19A 1PE5A 4K5OA 3Q44A 3NN7A 3T8FA 4DPRA 4OW3A 4TMNE 4ZW8A 3CIAA 1TMNE 2HPOA 4XNDA 6TLIA 1TLIA 3FTZA 1TLPE 2VQXA 4XMZA 1FJUA 3QJXA 1FJOA 4ZW6A 1KROA 5A3YA 3FXSA 3PUUA 4ZW5A 1PE7A 5FXNA 1KS7A 3FXPA 4TLIA 3FBOA 3P7VE 2TLIA 4R5XA 1OS0A 4TLNA 4ZX4A 3EBGA 1LNEE 4D9WA 3LS7A 4QMEA 4XN4A 3DNZA 3P7QE 2ZXGA 3FUEA 3NQXA 3B7TA 1KJOA 1QF0A 5TLNA 1KTOA 3B7UX 1GW6A 3T2HE 3FV4A 4MXJE 7TLIA 4XMVA 4XMTA 1U4GA 3T8CA 3U9WA 4PU2A 3FU0A 3NQZB 4XO5A 3EBHA 2DQ6A 3P7WE 3CHSA 1KKKA 3EBIA 3FH8A 4XNAA 1BQBA 4XMUA 1PE8A 4K5NA 1SQMA 1QF1A 1QF2A 3B7RL 3P7RE 4MTWE 3FCQA 4N5PE 3DBKA 4X2UA 7TLNA 5HQDA 4QPEA 1KJPA 1L3FE 2HPTA 3P7PE 1LNCE 4ZX6A 3FORA 4OI5E 3DO2A 4R5VA 3CHOA 5DYFA 4B52A 1FJ3A 3FULA 4ZW3A 1FJQA 3FGDA 3FU5A 5DPEE 4XN9A 5TMNE 3P7UE 3T87A 3MSFA 1KL6A 3CHQA 3P7SE 4XN7A 5L41E 1LNDE 3FUDA 3B7SA 1LNBE 4K90A 4XNBA 5DPFE 5LWDE 4K89A 3KEDA
chains in the Genus database with same CATH superfamily
5JXNE 1Z9GE 2TLXA 4PW4A 4GAAA 5TLIA 3T8HA 4GERA 4II7A 1ZDPE 4KX7A 2DQMA 3FTYA 1FJWA 4XMWA 4FYRA 5CU5A 2TMNE 4D91A 3DO0A 3QGOA 3FLFA 5L8PE 5EV7A 3TLIA 5JS3E 3FUKA 3CHRA 3FUNA 4QHPA 4ZW7A 5BPPA 3EIMA 1NPCA 4F5CA 5L3UE 4FKKA 2XPZA 3B3BA 4P8QA 4HOMA 1Y3GE 3F2PA 5AENA 1Z1WA 5LG6A 5C97A 3B37A 2WHZA 3F28A 4WZ9A 4K5PA 3MSNA 2XPYA 4XN2A 2WI0A 4NZ8A 4E36A 3CHPA 4ZQTA 2XQ0A 1LNAE 4R5TA 1KEIA 3SSBA 3T8VA 1HYTA 3FUHA 4XN8A 3FU3A 4L2LA 3B2PA 3Q7JA 4Q4EA 4MWPE 3N21A 3FUIA 3FU6A 3MSAA 4N4EE 3FUFA 3NQYB 3FTVA 4Q4IA 3FTUA 3FB0A 3FHEA 4MKTA 4XN1A 5FSPA 3Q43A 3B2XA 3T8DA 3TMNE 4Z7IA 2VJ8A 5JVIE 1LMLA 1FJVA 5JT9E 1HS6A 2YD0A 3FTXA 3FTWA 4TNLA 5LIFE 3FH5A 4QUOA 4PVBA 8TLIA 3FUMA 3FVPA 4K5MA 4ZX5A 1TRLA 4QIRA 3FTSA 5FXNA 3T74A 4ZX3A 5FSSA 2A7GE 2GTQA 3QH5A 4N66E 5DLHA 1THLA 4XMXA 4ARFA 3ZI6A 3MS3A 3T8GA 5FSJA 4KXDA 3T2IE 3P7TE 2G4ZA 3T2JE 4J3BA 3DO1A 4MS6A 4XO3A 5DLLA 4R7LA 4ZX4A 1FJTA 5K7TA 5JSSE 4MZNE 2R59A 4K5LA 4XN5A 4XO4A 3QH1A 3FUJA 4M65A 1TLXA 4FYTA 1LNFE 1ESPA 1EZMA 1KR6A 4RSYA 3FH7A 4RVBA 6TMNE 3T73A 5FWQA 8TLNE 1GXWA 4H57A 3B34A 1H19A 1PE5A 4K5OA 3Q44A 3NN7A 3T8FA 4DPRA 4OW3A 4TMNE 4ZW8A 3CIAA 1TMNE 2HPOA 4KXBA 4KX9A 4XNDA 6TLIA 1TLIA 3FTZA 1TLPE 2VQXA 4OU3A 4XMZA 1FJUA 3QJXA 4AR9A 1FJOA 4ZW6A 1KROA 5A3YA 3FXSA 3PUUA 4ZW5A 5AB0A 1PE7A 4IHQA 3QNFA 1KS7A 3FXPA 4TLIA 3FBOA 3P7VE 1Z5HA 2TLIA 4FCAA 1OS0A 4FGMA 4FKEA 4FKHA 4TLNA 3EBGA 1LNEE 4R5XA 3LS7A 4QMEA 4D9WA 4XN4A 3DNZA 3P7QE 2ZXGA 3FUEA 4PJ6A 3NQXA 3B7TA 1KJOA 1QF0A 5TLNA 1KTOA 3B7UX 1GW6A 3T2HE 3FV4A 4MXJE 7TLIA 4XMVA 4XMTA 1U4GA 3T8CA 4NAQA 3U9WA 4PU2A 3FU0A 3NQZB 4XO5A 3EBHA 5LHDA 2DQ6A 3P7WE 3CHSA 1KKKA 3EBIA 4KXAA 3FH8A 4XNAA 5LDSA 1BQBA 4JBSA 4XMUA 3SE6A 1PE8A 4K5NA 1SQMA 1QF1A 1QF2A 3B7RL 3P7RE 4MTWE 3FCQA 4N5PE 3DBKA 4X2UA 7TLNA 4KXCA 5HQDA 5J6SA 4QPEA 1KJPA 1L3FE 2HPTA 4AR8A 4FYQA 3P7PE 1LNCE 4ZX6A 4KX8A 3FORA 4OI5E 3DO2A 4R5VA 3CHOA 5DYFA 4B52A 1FJ3A 3FULA 3MDJA 1FJQA 3FGDA 3FU5A 5DPEE 4XN9A 5TMNE 4ZW3A 3P7UE 4AR1A 4FYSA 3MSFA 3T87A 1KL6A 3CHQA 3P7SE 4XN7A 5AB2A 5L41E 1LNDE 3FUDA 3B7SA 1LNBE 4K90A 4XNBA 5DPFE 5LWDE 4K89A 5K1VA 3KEDA
chains in the Genus database with same CATH topology
5JXNE 1Z9GE 2TLXA 4PW4A 4GAAA 5TLIA 3T8HA 4GERA 1ZDPE 2DQMA 3FTYA 1FJWA 4XMWA 4D91A 2TMNE 3DO0A 3QGOA 3FLFA 5L8PE 3TLIA 5JS3E 3FUKA 3CHRA 3FUNA 4QHPA 4ZW7A 5BPPA 3EIMA 1NPCA 5L3UE 2XPZA 3B3BA 5AENA 1Y3GE 3F2PA 3B37A 2WHZA 3F28A 4K5PA 3MSNA 2XPYA 4XN2A 2WI0A 3CHPA 4ZQTA 2XQ0A 1LNAE 4R5TA 1KEIA 3SSBA 3T8VA 1HYTA 3FUHA 4XN8A 3FU3A 4L2LA 3B2PA 4Q4EA 4MWPE 3N21A 3FUIA 3FU6A 3MSAA 4N4EE 3FUFA 3NQYB 3FTVA 4Q4IA 3FTUA 3FB0A 3FHEA 4MKTA 4XN1A 5FSPA 3Q43A 3B2XA 3T8DA 3TMNE 5JVIE 2VJ8A 1LMLA 1FJVA 5JT9E 1HS6A 3FTXA 3FTWA 4TNLA 5LIFE 3FH5A 4QUOA 4PVBA 8TLIA 3FUMA 3FVPA 4K5MA 4ZX5A 1TRLA 4QIRA 3FTSA 3T74A 4ZX3A 5FSSA 2A7GE 2GTQA 3QH5A 4N66E 5DLHA 1THLA 4XMXA 3ZI6A 3MS3A 3T8GA 5FSJA 3T2IE 3P7TE 2G4ZA 3T2JE 4J3BA 3DO1A 4MS6A 4XO3A 5DLLA 4R7LA 1FJTA 5K7TA 5JSSE 4MZNE 2R59A 4K5LA 4XN5A 4XO4A 3QH1A 3FUJA 4M65A 1TLXA 1LNFE 1ESPA 1EZMA 1KR6A 4RSYA 3FH7A 4RVBA 6TMNE 3T73A 5FWQA 8TLNE 1GXWA 4H57A 3B34A 1H19A 1PE5A 4K5OA 3Q44A 3NN7A 3T8FA 4DPRA 4OW3A 4TMNE 4ZW8A 3CIAA 1TMNE 2HPOA 4XNDA 6TLIA 1TLIA 3FTZA 1TLPE 2VQXA 4XMZA 1FJUA 3QJXA 1FJOA 4ZW6A 1KROA 5A3YA 3FXSA 3PUUA 4ZW5A 1PE7A 5FXNA 1KS7A 3FXPA 4TLIA 3FBOA 3P7VE 2TLIA 4R5XA 1OS0A 4TLNA 4ZX4A 3EBGA 1LNEE 4D9WA 3LS7A 4QMEA 4XN4A 3DNZA 3P7QE 2ZXGA 3FUEA 3NQXA 3B7TA 1KJOA 1QF0A 5TLNA 1KTOA 3B7UX 1GW6A 3T2HE 3FV4A 4MXJE 7TLIA 4XMVA 4XMTA 1U4GA 3T8CA 3U9WA 4PU2A 3FU0A 3NQZB 4XO5A 3EBHA 2DQ6A 3P7WE 3CHSA 1KKKA 3EBIA 3FH8A 4XNAA 1BQBA 4XMUA 1PE8A 4K5NA 1SQMA 1QF1A 1QF2A 3B7RL 3P7RE 4MTWE 3FCQA 4N5PE 3DBKA 4X2UA 7TLNA 5HQDA 4QPEA 1KJPA 1L3FE 2HPTA 3P7PE 1LNCE 4ZX6A 3FORA 4OI5E 3DO2A 4R5VA 3CHOA 5DYFA 4B52A 1FJ3A 3FULA 4ZW3A 1FJQA 3FGDA 3FU5A 5DPEE 4XN9A 5TMNE 3P7UE 3T87A 3MSFA 1KL6A 3CHQA 3P7SE 4XN7A 5L41E 1LNDE 3FUDA 3B7SA 1LNBE 4K90A 4XNBA 5DPFE 5LWDE 4K89A 3KEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXN E;  1Z9G E;  2TLX A;  4PW4 A;  4GAA A;  5TLI A;  3T8H A;  4GER A;  1ZDP E;  2DQM A;  3FTY A;  1FJW A;  4XMW A;  4D91 A;  2TMN E;  3DO0 A;  3QGO A;  3FLF A;  5L8P E;  3TLI A;  5JS3 E;  3FUK A;  3CHR A;  3FUN A;  4QHP A;  4ZW7 A;  5BPP A;  3EIM A;  1NPC A;  5L3U E;  2XPZ A;  3B3B A;  5AEN A;  1Y3G E;  3F2P A;  3B37 A;  2WHZ A;  3F28 A;  4K5P A;  3MSN A;  2XPY A;  4XN2 A;  2WI0 A;  3CHP A;  4ZQT A;  2XQ0 A;  1LNA E;  4R5T A;  1KEI A;  3SSB A;  3T8V A;  1HYT A;  3FUH A;  4XN8 A;  3FU3 A;  4L2L A;  3B2P A;  4Q4E A;  4MWP E;  3N21 A;  3FUI A;  3FU6 A;  3MSA A;  4N4E E;  3FUF A;  3NQY B;  3FTV A;  4Q4I A;  3FTU A;  3FB0 A;  3FHE A;  4MKT A;  4XN1 A;  5FSP A;  3Q43 A;  3B2X A;  3T8D A;  3TMN E;  5JVI E;  2VJ8 A;  1FJV A;  5JT9 E;  1HS6 A;  3FTX A;  3FTW A;  4TNL A;  5LIF E;  3FH5 A;  4QUO A;  4PVB A;  8TLI A;  3FUM A;  3FVP A;  4K5M A;  4ZX5 A;  1TRL A;  4QIR A;  3FTS A;  3T74 A;  4ZX3 A;  5FSS A;  2A7G E;  2GTQ A;  3QH5 A;  4N66 E;  5DLH A;  1THL A;  4XMX A;  3ZI6 A;  3MS3 A;  3T8G A;  5FSJ A;  3T2I E;  3P7T E;  2G4Z A;  3T2J E;  4J3B A;  3DO1 A;  4MS6 A;  4XO3 A;  5DLL A;  4R7L A;  1FJT A;  5K7T A;  5JSS E;  4MZN E;  2R59 A;  4K5L A;  4XN5 A;  4XO4 A;  3QH1 A;  3FUJ A;  4M65 A;  1TLX A;  1LNF E;  1ESP A;  1EZM A;  1KR6 A;  4RSY A;  3FH7 A;  4RVB A;  6TMN E;  3T73 A;  5FWQ A;  8TLN E;  1GXW A;  4H57 A;  3B34 A;  1H19 A;  1PE5 A;  4K5O A;  3Q44 A;  3NN7 A;  3T8F A;  4DPR A;  4OW3 A;  4TMN E;  4ZW8 A;  3CIA A;  1TMN E;  2HPO A;  4XND A;  6TLI A;  1TLI A;  3FTZ A;  1TLP E;  2VQX A;  4XMZ A;  1FJU A;  3QJX A;  1FJO A;  4ZW6 A;  1KRO A;  5A3Y A;  3FXS A;  3PUU A;  4ZW5 A;  1PE7 A;  5FXN A;  1KS7 A;  3FXP A;  4TLI A;  3FBO A;  3P7V E;  2TLI A;  4R5X A;  1OS0 A;  4TLN A;  4ZX4 A;  3EBG A;  1LNE E;  4D9W A;  3LS7 A;  4QME A;  4XN4 A;  3DNZ A;  3P7Q E;  2ZXG A;  3FUE A;  3NQX A;  3B7T A;  1KJO A;  1QF0 A;  5TLN A;  1KTO A;  3B7U X;  1GW6 A;  3T2H E;  3FV4 A;  4MXJ E;  7TLI A;  4XMV A;  4XMT A;  1U4G A;  3T8C A;  3U9W A;  4PU2 A;  3FU0 A;  3NQZ B;  4XO5 A;  3EBH A;  2DQ6 A;  3P7W E;  3CHS A;  1KKK A;  3EBI A;  3FH8 A;  4XNA A;  1BQB A;  4XMU A;  1PE8 A;  4K5N A;  1SQM A;  1QF1 A;  1QF2 A;  3B7R L;  3P7R E;  4MTW E;  3FCQ A;  4N5P E;  3DBK A;  4X2U A;  7TLN A;  5HQD A;  4QPE A;  1KJP A;  1L3F E;  2HPT A;  3P7P E;  1LNC E;  4ZX6 A;  3FOR A;  4OI5 E;  3DO2 A;  4R5V A;  3CHO A;  5DYF A;  4B52 A;  1FJ3 A;  3FUL A;  4ZW3 A;  1FJQ A;  3FGD A;  3FU5 A;  5DPE E;  4XN9 A;  5TMN E;  3P7U E;  3T87 A;  3MSF A;  1KL6 A;  3CHQ A;  3P7S E;  4XN7 A;  5L41 E;  1LND E;  3FUD A;  3B7S A;  1LNB E;  4K90 A;  4XNB A;  5DPF E;  5LWD E;  4K89 A;  3KED A; 
#chains in the Genus database with same CATH topology
 5JXN E;  1Z9G E;  2TLX A;  4PW4 A;  4GAA A;  5TLI A;  3T8H A;  4GER A;  4II7 A;  1ZDP E;  4KX7 A;  2DQM A;  3FTY A;  1FJW A;  4XMW A;  4FYR A;  5CU5 A;  2TMN E;  4D91 A;  3DO0 A;  3QGO A;  3FLF A;  5L8P E;  5EV7 A;  3TLI A;  5JS3 E;  3FUK A;  3CHR A;  3FUN A;  4QHP A;  4ZW7 A;  5BPP A;  3EIM A;  1NPC A;  4F5C A;  5L3U E;  4FKK A;  2XPZ A;  3B3B A;  4P8Q A;  4HOM A;  1Y3G E;  3F2P A;  5AEN A;  1Z1W A;  5LG6 A;  5C97 A;  3B37 A;  2WHZ A;  3F28 A;  4WZ9 A;  4K5P A;  3MSN A;  2XPY A;  4XN2 A;  2WI0 A;  4NZ8 A;  4E36 A;  3CHP A;  4ZQT A;  2XQ0 A;  1LNA E;  4R5T A;  1KEI A;  3SSB A;  3T8V A;  1HYT A;  3FUH A;  4XN8 A;  3FU3 A;  4L2L A;  3B2P A;  3Q7J A;  4Q4E A;  4MWP E;  3N21 A;  3FUI A;  3FU6 A;  3MSA A;  4N4E E;  3FUF A;  3NQY B;  3FTV A;  4Q4I A;  3FTU A;  3FB0 A;  3FHE A;  4MKT A;  4XN1 A;  5FSP A;  3Q43 A;  3B2X A;  3T8D A;  3TMN E;  4Z7I A;  2VJ8 A;  5JVI E;  1LML A;  1FJV A;  5JT9 E;  1HS6 A;  2YD0 A;  3FTX A;  3FTW A;  4TNL A;  5LIF E;  3FH5 A;  4QUO A;  4PVB A;  8TLI A;  3FUM A;  3FVP A;  4K5M A;  4ZX5 A;  1TRL A;  4QIR A;  3FTS A;  5FXN A;  3T74 A;  4ZX3 A;  5FSS A;  2A7G E;  2GTQ A;  3QH5 A;  4N66 E;  5DLH A;  1THL A;  4XMX A;  4ARF A;  3ZI6 A;  3MS3 A;  3T8G A;  5FSJ A;  4KXD A;  3T2I E;  3P7T E;  2G4Z A;  3T2J E;  4J3B A;  3DO1 A;  4MS6 A;  4XO3 A;  5DLL A;  4R7L A;  4ZX4 A;  1FJT A;  5K7T A;  5JSS E;  4MZN E;  2R59 A;  4K5L A;  4XN5 A;  4XO4 A;  3QH1 A;  3FUJ A;  4M65 A;  1TLX A;  4FYT A;  1LNF E;  1ESP A;  1EZM A;  1KR6 A;  4RSY A;  3FH7 A;  4RVB A;  6TMN E;  3T73 A;  5FWQ A;  8TLN E;  1GXW A;  4H57 A;  3B34 A;  1H19 A;  1PE5 A;  4K5O A;  3Q44 A;  3NN7 A;  3T8F A;  4DPR A;  4OW3 A;  4TMN E;  4ZW8 A;  3CIA A;  1TMN E;  2HPO A;  4KXB A;  4KX9 A;  4XND A;  6TLI A;  1TLI A;  3FTZ A;  1TLP E;  2VQX A;  4OU3 A;  4XMZ A;  1FJU A;  3QJX A;  4AR9 A;  1FJO A;  4ZW6 A;  1KRO A;  5A3Y A;  3FXS A;  3PUU A;  4ZW5 A;  5AB0 A;  1PE7 A;  4IHQ A;  3QNF A;  1KS7 A;  3FXP A;  4TLI A;  3FBO A;  3P7V E;  1Z5H A;  2TLI A;  4FCA A;  1OS0 A;  4FGM A;  4FKE A;  4FKH A;  4TLN A;  3EBG A;  1LNE E;  4R5X A;  3LS7 A;  4QME A;  4D9W A;  4XN4 A;  3DNZ A;  3P7Q E;  2ZXG A;  3FUE A;  4PJ6 A;  3NQX A;  3B7T A;  1KJO A;  1QF0 A;  5TLN A;  1KTO A;  3B7U X;  1GW6 A;  3T2H E;  3FV4 A;  4MXJ E;  7TLI A;  4XMV A;  4XMT A;  1U4G A;  3T8C A;  4NAQ A;  3U9W A;  4PU2 A;  3FU0 A;  3NQZ B;  4XO5 A;  3EBH A;  5LHD A;  2DQ6 A;  3P7W E;  3CHS A;  1KKK A;  3EBI A;  4KXA A;  3FH8 A;  4XNA A;  5LDS A;  1BQB A;  4JBS A;  4XMU A;  3SE6 A;  1PE8 A;  4K5N A;  1SQM A;  1QF1 A;  1QF2 A;  3B7R L;  3P7R E;  4MTW E;  3FCQ A;  4N5P E;  3DBK A;  4X2U A;  7TLN A;  4KXC A;  5HQD A;  5J6S A;  4QPE A;  1KJP A;  1L3F E;  2HPT A;  4AR8 A;  4FYQ A;  3P7P E;  1LNC E;  4ZX6 A;  4KX8 A;  3FOR A;  4OI5 E;  3DO2 A;  4R5V A;  3CHO A;  5DYF A;  4B52 A;  1FJ3 A;  3FUL A;  3MDJ A;  1FJQ A;  3FGD A;  3FU5 A;  5DPE E;  4XN9 A;  5TMN E;  4ZW3 A;  3P7U E;  4AR1 A;  4FYS A;  3MSF A;  3T87 A;  1KL6 A;  3CHQ A;  3P7S E;  4XN7 A;  5AB2 A;  5L41 E;  1LND E;  3FUD A;  3B7S A;  1LNB E;  4K90 A;  4XNB A;  5DPF E;  5LWD E;  4K89 A;  5K1V A;  3KED A; 
#chains in the Genus database with same CATH homology
 5JXN E;  1Z9G E;  2TLX A;  4PW4 A;  4GAA A;  5TLI A;  3T8H A;  4GER A;  1ZDP E;  2DQM A;  3FTY A;  1FJW A;  4XMW A;  4D91 A;  2TMN E;  3DO0 A;  3QGO A;  3FLF A;  5L8P E;  3TLI A;  5JS3 E;  3FUK A;  3CHR A;  3FUN A;  4QHP A;  4ZW7 A;  5BPP A;  3EIM A;  1NPC A;  5L3U E;  2XPZ A;  3B3B A;  5AEN A;  1Y3G E;  3F2P A;  3B37 A;  2WHZ A;  3F28 A;  4K5P A;  3MSN A;  2XPY A;  4XN2 A;  2WI0 A;  3CHP A;  4ZQT A;  2XQ0 A;  1LNA E;  4R5T A;  1KEI A;  3SSB A;  3T8V A;  1HYT A;  3FUH A;  4XN8 A;  3FU3 A;  4L2L A;  3B2P A;  4Q4E A;  4MWP E;  3N21 A;  3FUI A;  3FU6 A;  3MSA A;  4N4E E;  3FUF A;  3NQY B;  3FTV A;  4Q4I A;  3FTU A;  3FB0 A;  3FHE A;  4MKT A;  4XN1 A;  5FSP A;  3Q43 A;  3B2X A;  3T8D A;  3TMN E;  5JVI E;  2VJ8 A;  1LML A;  1FJV A;  5JT9 E;  1HS6 A;  3FTX A;  3FTW A;  4TNL A;  5LIF E;  3FH5 A;  4QUO A;  4PVB A;  8TLI A;  3FUM A;  3FVP A;  4K5M A;  4ZX5 A;  1TRL A;  4QIR A;  3FTS A;  3T74 A;  4ZX3 A;  5FSS A;  2A7G E;  2GTQ A;  3QH5 A;  4N66 E;  5DLH A;  1THL A;  4XMX A;  3ZI6 A;  3MS3 A;  3T8G A;  5FSJ A;  3T2I E;  3P7T E;  2G4Z A;  3T2J E;  4J3B A;  3DO1 A;  4MS6 A;  4XO3 A;  5DLL A;  4R7L A;  1FJT A;  5K7T A;  5JSS E;  4MZN E;  2R59 A;  4K5L A;  4XN5 A;  4XO4 A;  3QH1 A;  3FUJ A;  4M65 A;  1TLX A;  1LNF E;  1ESP A;  1EZM A;  1KR6 A;  4RSY A;  3FH7 A;  4RVB A;  6TMN E;  3T73 A;  5FWQ A;  8TLN E;  1GXW A;  4H57 A;  3B34 A;  1H19 A;  1PE5 A;  4K5O A;  3Q44 A;  3NN7 A;  3T8F A;  4DPR A;  4OW3 A;  4TMN E;  4ZW8 A;  3CIA A;  1TMN E;  2HPO A;  4XND A;  6TLI A;  1TLI A;  3FTZ A;  1TLP E;  2VQX A;  4XMZ A;  1FJU A;  3QJX A;  1FJO A;  4ZW6 A;  1KRO A;  5A3Y A;  3FXS A;  3PUU A;  4ZW5 A;  1PE7 A;  5FXN A;  1KS7 A;  3FXP A;  4TLI A;  3FBO A;  3P7V E;  2TLI A;  4R5X A;  1OS0 A;  4TLN A;  4ZX4 A;  3EBG A;  1LNE E;  4D9W A;  3LS7 A;  4QME A;  4XN4 A;  3DNZ A;  3P7Q E;  2ZXG A;  3FUE A;  3NQX A;  3B7T A;  1KJO A;  1QF0 A;  5TLN A;  1KTO A;  3B7U X;  1GW6 A;  3T2H E;  3FV4 A;  4MXJ E;  7TLI A;  4XMV A;  4XMT A;  1U4G A;  3T8C A;  3U9W A;  4PU2 A;  3FU0 A;  3NQZ B;  4XO5 A;  3EBH A;  2DQ6 A;  3P7W E;  3CHS A;  1KKK A;  3EBI A;  3FH8 A;  4XNA A;  1BQB A;  4XMU A;  1PE8 A;  4K5N A;  1SQM A;  1QF1 A;  1QF2 A;  3B7R L;  3P7R E;  4MTW E;  3FCQ A;  4N5P E;  3DBK A;  4X2U A;  7TLN A;  5HQD A;  4QPE A;  1KJP A;  1L3F E;  2HPT A;  3P7P E;  1LNC E;  4ZX6 A;  3FOR A;  4OI5 E;  3DO2 A;  4R5V A;  3CHO A;  5DYF A;  4B52 A;  1FJ3 A;  3FUL A;  4ZW3 A;  1FJQ A;  3FGD A;  3FU5 A;  5DPE E;  4XN9 A;  5TMN E;  3P7U E;  3T87 A;  3MSF A;  1KL6 A;  3CHQ A;  3P7S E;  4XN7 A;  5L41 E;  1LND E;  3FUD A;  3B7S A;  1LNB E;  4K90 A;  4XNB A;  5DPF E;  5LWD E;  4K89 A;  3KED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...