3NQZB

Crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
307
Chain Sequence
b'ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGTSGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQLQMRVHYSSNYENAFWDGSAMTFGDGQNTFYPLVSLDVSAHEVSHGFTEQNSGLIYNGKPGGLNAAFSDMAGEAAEFYMKGSNDWLVGKDIFKGNGALRYMNNPTQDGRSIDNQSNYYSGMDVHYSSGVYNKAFYNLATTPGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACDLNYDPNDVKAALAAVGVNSNLSSGSDCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted metalloprotease Mcp02
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 109
structure length 307
sequence length 307
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
B PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3nqzB02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3nqzB01
4Q4IA 4XMUA 2HPOA 1FJ3A 3FUHA 3KEDA 3FUIA 3T2JE 3T87A 4ZX6A 3FH8A 3FTYA 4J3BA 2R59A 4XN7A 5FSJA 1TRLA 3B37A 2XQ0A 3FVPA 4OW3A 1FJVA 1L3FE 3FUEA 3FU3A 4R7LA 4XN4A 4QPEA 4R5XA 5FWQA 1FJQA 1FJWA 1LNDE 3EBHA 3QH5A 3T8CA 3T8HA 3U9WA 1TMNE 5JSSE 1LNFE 3P7TE 3CHQA 3MSFA 4K90A 4M65A 1FJTA 4K5OA 4MTWE 4XNBA 3B34A 3FHEA 4XNAA 5JS3E 3B7TA 3B7UX 4PU2A 4K5LA 4ZW5A 4L2LA 1KROA 2TLXA 3F2PA 4TMNE 1TLPE 4DPRA 3FTWA 1QF0A 3NQZB 5FSSA 3FUJA 4XNDA 1EZMA 7TLNA 4XN5A 2XPZA 3B7RL 4Q4EA 3FTXA 4K5NA 4XMWA 3QH1A 3DO0A 5AENA 3T74A 3CHOA 6TMNE 1HYTA 1GW6A 1H19A 3FU6A 1GXWA 4RVBA 3FXPA 1LNBE 5L3UE 3CIAA 3FTZA 4XN2A 3FXSA 5DYFA 6TLIA 1Y3GE 3P7PE 3T8VA 1LNAE 1PE8A 3FLFA 5HQDA 5L41E 3Q43A 3CHRA 4QHPA 4X2UA 3P7SE 4ZW8A 4K89A 2VJ8A 1KEIA 3FB0A 3MSAA 4R5TA 4XN8A 2GTQA 2WHZA 1FJOA 4XN1A 1KL6A 3QGOA 2G4ZA 2HPTA 3T8GA 3QJXA 4R5VA 2XPYA 1U4GA 4K5MA 2WI0A 1THLA 1KR6A 3N21A 3FUKA 5LWDE 5TMNE 4ZQTA 1TLIA 4MKTA 5TLNA 4MXJE 3LS7A 1LNEE 5K7TA 3CHPA 3B7SA 3SSBA 4ZX3A 1QF2A 1ESPA 3CHSA 4GAAA 4K5PA 4MZNE 3FU5A 3P7WE 3T8DA 5JT9E 4XMXA 3B2XA 4ZW7A 2A7GE 4MS6A 3EBIA 2TLIA 3FUDA 3FBOA 1QF1A 1KKKA 2DQMA 4PVBA 3P7QE 3B2PA 1SQMA 1TLXA 3FU0A 2ZXGA 4N5PE 3TLIA 3ZI6A 4ZX4A 3F28A 3T8FA 3MS3A 1PE7A 4QUOA 4ZW3A 4TNLA 3P7RE 4PW4A 1KJPA 4GERA 3FUFA 5FXNA 4D91A 3FTVA 4H57A 4TLNA 4XMTA 4TLIA 3DO1A 3DO2A 3FH5A 4B52A 5DPEE 2VQXA 3FGDA 1OS0A 3T73A 3FCQA 3T2IE 3TMNE 3P7VE 4XMZA 4XN9A 3NN7A 4N4EE 5JVIE 3FTUA 5DLHA 4ZW6A 3FULA 4XMVA 1PE5A 4QIRA 5FSPA 3P7UE 4D9WA 3FH7A 4QMEA 8TLIA 3T2HE 3B3BA 1KTOA 3FORA 3FUMA 4RSYA 1BQBA 4N66E 5DPFE 3Q44A 5BPPA 7TLIA 5DLLA 1Z9GE 4OI5E 5LIFE 4ZX5A 4XO3A 5JXNE 3FV4A 8TLNE 3DNZA 5A3YA 3PUUA 3FUNA 1FJUA 1NPCA 3EBGA 3DBKA 4XO4A 1LNCE 3EIMA 1HS6A 3FTSA 3NQYB 3NQXA 1ZDPE 4MWPE 1KJOA 2TMNE 5TLIA 2DQ6A 3MSNA 1KS7A 4XO5A 5L8PE
chains in the Genus database with same CATH superfamily
4Q4IA 2HPOA 5LHDA 4FCAA 4ZX6A 3FTYA 2R59A 4IHQA 4XN4A 3Q7JA 3T8CA 3QH5A 1LNDE 3T8HA 4K5OA 4PU2A 4ZW5A 4KX9A 1TLPE 7TLNA 3FU6A 4FYQA 1GXWA 5L3UE 3FTZA 4XN2A 5DYFA 3P7PE 4KX7A 3FLFA 3CHRA 4X2UA 4XN1A 2HPTA 3T8GA 2G4ZA 4R5VA 4ZQTA 4MKTA 5TLNA 5AB2A 4GAAA 4MZNE 3FU5A 4AR8A 2A7GE 3EBIA 2TLIA 3B2PA 4KXBA 3T8FA 5FXNA 3FTVA 4H57A 4TLIA 3DO1A 1OS0A 3T73A 3FTUA 3FULA 4F5CA 3P7UE 3B3BA 3FUMA 4RSYA 1BQBA 5LIFE 4XO3A 1FJUA 1LNCE 4FYRA 3NQYB 1KS7A 4XMUA 4PJ6A 3FUIA 1Z1WA 3FH8A 4J3BA 3B37A 3FU3A 4R7LA 3P7TE 3MSFA 4M65A 4MTWE 3FHEA 1Z5HA 3B7TA 5JS3E 4K5LA 5EV7A 4L2LA 1KROA 2TLXA 4XN5A 4Q4EA 3B7RL 3FTXA 4XMWA 3QH1A 3DO0A 3T74A 3CHOA 6TMNE 1GW6A 1LNAE 1PE8A 5HQDA 4ZW8A 4K89A 1KL6A 3QGOA 3QJXA 2XPYA 1U4GA 1KR6A 3N21A 3FUKA 4MXJE 3LS7A 4Z7IA 5K7TA 4ZX3A 3CHSA 4FYTA 3B2XA 2DQMA 4WZ9A 4PVBA 3ZI6A 1TLXA 3FU0A 4ZX4A 3MS3A 4QUOA 4PW4A 4FKHA 1LMLA 4XMTA 3DO2A 5LDSA 3FCQA 3P7VE 3NN7A 4N4EE 5JVIE 5DLHA 1PE5A 5FSPA 3FH7A 1KTOA 5BPPA 1Z9GE 4ZX5A 3FV4A 8TLNE 1NPCA 3EIMA 3FTSA 3NQXA 4FKEA 4ARFA 3MSNA 1FJ3A 3KEDA 3T2JE 4AR1A 3U9WA 5FSJA 3FVPA 1FJVA 1L3FE 3FUEA 5FWQA 4R5XA 1FJQA 3EBHA 5JSSE 1TMNE 1LNFE 3CHQA 4K90A 1FJTA 4KX8A 3B7UX 4JBSA 3FTWA 1QF0A 2YD0A 3FUJA 4XNDA 1EZMA 1HYTA 1H19A 4OU3A 3FXPA 3CIAA 3FXSA 3T8VA 3Q43A 4QHPA 2VJ8A 3MSAA 4R5TA 4XN8A 2GTQA 2WHZA 1FJOA 5CU5A 4K5MA 5LWDE 5TMNE 1TLIA 1LNEE 3CHPA 3B7SA 3SSBA 1QF2A 1ESPA 4K5PA 4XMXA 4MS6A 3FUDA 5J6SA 1QF1A 8TLIA 3TLIA 4NZ8A 3F28A 4ZW3A 3P7RE 3FUFA 4B52A 5DPEE 3T2IE 4XN9A 3SE6A 4XMVA 4QMEA 5C97A 5DPFE 3Q44A 4FKKA 4OI5E 5JXNE 3DNZA 4KXDA 3EBGA 1HS6A 1ZDPE 4MWPE 3FBOA 2DQ6A 4XO5A 3FUHA 3T87A 4XN7A 1TRLA 4OW3A 2XQ0A 4HOMA 4QPEA 1FJWA 4XNBA 4XNAA 3B34A 4NAQA 4II7A 3F2PA 4TMNE 4DPRA 4FYSA 3NQZB 5FSSA 2XPZA 5LG6A 4K5NA 5AENA 4RVBA 5K1VA 1LNBE 3QNFA 6TLIA 1Y3GE 5L41E 5AB0A 3P7SE 1KEIA 3FB0A 4P8QA 2WI0A 1THLA 4KXCA 3P7WE 3T8DA 5JT9E 4ZW7A 1KKKA 3P7QE 1SQMA 4N5PE 2ZXGA 1PE7A 4TNLA 1KJPA 4GERA 4E36A 4D91A 4TLNA 3FH5A 4FGMA 2VQXA 3FGDA 4AR9A 3TMNE 4XMZA 4ZW6A 4QIRA 4D9WA 3T2HE 3FORA 7TLIA 4N66E 5DLLA 5A3YA 3PUUA 3FUNA 4KXAA 4XO4A 3DBKA 1KJOA 2TMNE 5TLIA 5L8PE 3MDJA
chains in the Genus database with same CATH topology
4Q4IA 4XMUA 2HPOA 1FJ3A 3FUHA 3KEDA 3FUIA 3T2JE 3T87A 4ZX6A 3FH8A 3FTYA 4J3BA 2R59A 4XN7A 5FSJA 1TRLA 3B37A 2XQ0A 3FVPA 4OW3A 1FJVA 1L3FE 3FUEA 3FU3A 4R7LA 4XN4A 4QPEA 4R5XA 5FWQA 1FJQA 1FJWA 1LNDE 3EBHA 3QH5A 3T8CA 3T8HA 3U9WA 1TMNE 5JSSE 1LNFE 3P7TE 3CHQA 3MSFA 4K90A 4M65A 1FJTA 4K5OA 4MTWE 4XNBA 3B34A 3FHEA 4XNAA 5JS3E 3B7TA 3B7UX 4PU2A 4K5LA 4ZW5A 4L2LA 1KROA 2TLXA 3F2PA 4TMNE 1TLPE 4DPRA 3FTWA 1QF0A 3NQZB 5FSSA 3FUJA 4XNDA 1EZMA 7TLNA 4XN5A 2XPZA 3B7RL 4Q4EA 3FTXA 4K5NA 4XMWA 3QH1A 3DO0A 5AENA 3T74A 3CHOA 6TMNE 1HYTA 1GW6A 1H19A 3FU6A 1GXWA 4RVBA 3FXPA 1LNBE 5L3UE 3CIAA 3FTZA 4XN2A 3FXSA 5DYFA 6TLIA 1Y3GE 3P7PE 3T8VA 1LNAE 1PE8A 3FLFA 5HQDA 5L41E 3Q43A 3CHRA 4QHPA 4X2UA 3P7SE 4ZW8A 4K89A 2VJ8A 1KEIA 3FB0A 3MSAA 4R5TA 4XN8A 2GTQA 2WHZA 1FJOA 4XN1A 1KL6A 3QGOA 2G4ZA 2HPTA 3T8GA 3QJXA 4R5VA 2XPYA 1U4GA 4K5MA 2WI0A 1THLA 1KR6A 3N21A 3FUKA 5LWDE 5TMNE 4ZQTA 1TLIA 4MKTA 5TLNA 4MXJE 3LS7A 1LNEE 5K7TA 3CHPA 3B7SA 3SSBA 4ZX3A 1QF2A 1ESPA 3CHSA 4GAAA 4K5PA 4MZNE 3FU5A 3P7WE 3T8DA 5JT9E 4XMXA 3B2XA 4ZW7A 2A7GE 4MS6A 3EBIA 2TLIA 3FUDA 3FBOA 1QF1A 1KKKA 2DQMA 4PVBA 3P7QE 3B2PA 1SQMA 1TLXA 3FU0A 2ZXGA 4N5PE 3TLIA 3ZI6A 4ZX4A 3F28A 3T8FA 3MS3A 1PE7A 4QUOA 4ZW3A 4TNLA 3P7RE 4PW4A 1KJPA 4GERA 3FUFA 5FXNA 4D91A 1LMLA 3FTVA 4H57A 4TLNA 4XMTA 4TLIA 3DO1A 3DO2A 3FH5A 4B52A 5DPEE 2VQXA 3FGDA 1OS0A 3T73A 3FCQA 3T2IE 3TMNE 3P7VE 4XMZA 4XN9A 3NN7A 4N4EE 5JVIE 3FTUA 5DLHA 4ZW6A 3FULA 4XMVA 1PE5A 4QIRA 5FSPA 3P7UE 4D9WA 3FH7A 4QMEA 8TLIA 3T2HE 3B3BA 1KTOA 3FORA 3FUMA 4RSYA 1BQBA 4N66E 5DPFE 3Q44A 5BPPA 7TLIA 5DLLA 1Z9GE 4OI5E 5LIFE 4ZX5A 4XO3A 5JXNE 3FV4A 8TLNE 3DNZA 5A3YA 3PUUA 3FUNA 1FJUA 1NPCA 3EBGA 3DBKA 4XO4A 1LNCE 3EIMA 1HS6A 3FTSA 3NQYB 3NQXA 1ZDPE 4MWPE 1KJOA 2TMNE 5TLIA 2DQ6A 3MSNA 1KS7A 4XO5A 5L8PE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q4I A;  4XMU A;  2HPO A;  1FJ3 A;  3FUH A;  3KED A;  3FUI A;  3T2J E;  3T87 A;  4ZX6 A;  3FH8 A;  3FTY A;  4J3B A;  2R59 A;  4XN7 A;  5FSJ A;  1TRL A;  3B37 A;  2XQ0 A;  3FVP A;  4OW3 A;  1FJV A;  1L3F E;  3FUE A;  3FU3 A;  4R7L A;  4XN4 A;  4QPE A;  4R5X A;  5FWQ A;  1FJQ A;  1FJW A;  1LND E;  3EBH A;  3QH5 A;  3T8C A;  3T8H A;  3U9W A;  1TMN E;  5JSS E;  1LNF E;  3P7T E;  3CHQ A;  3MSF A;  4K90 A;  4M65 A;  1FJT A;  4K5O A;  4MTW E;  4XNB A;  3B34 A;  3FHE A;  4XNA A;  5JS3 E;  3B7T A;  3B7U X;  4PU2 A;  4K5L A;  4ZW5 A;  4L2L A;  1KRO A;  2TLX A;  3F2P A;  4TMN E;  1TLP E;  4DPR A;  3FTW A;  1QF0 A;  3NQZ B;  5FSS A;  3FUJ A;  4XND A;  1EZM A;  7TLN A;  4XN5 A;  2XPZ A;  3B7R L;  4Q4E A;  3FTX A;  4K5N A;  4XMW A;  3QH1 A;  3DO0 A;  5AEN A;  3T74 A;  3CHO A;  6TMN E;  1HYT A;  1GW6 A;  1H19 A;  3FU6 A;  1GXW A;  4RVB A;  3FXP A;  1LNB E;  5L3U E;  3CIA A;  3FTZ A;  4XN2 A;  3FXS A;  5DYF A;  6TLI A;  1Y3G E;  3P7P E;  3T8V A;  1LNA E;  1PE8 A;  3FLF A;  5HQD A;  5L41 E;  3Q43 A;  3CHR A;  4QHP A;  4X2U A;  3P7S E;  4ZW8 A;  4K89 A;  2VJ8 A;  1KEI A;  3FB0 A;  3MSA A;  4R5T A;  4XN8 A;  2GTQ A;  2WHZ A;  1FJO A;  4XN1 A;  1KL6 A;  3QGO A;  2G4Z A;  2HPT A;  3T8G A;  3QJX A;  4R5V A;  2XPY A;  1U4G A;  4K5M A;  2WI0 A;  1THL A;  1KR6 A;  3N21 A;  3FUK A;  5LWD E;  5TMN E;  4ZQT A;  1TLI A;  4MKT A;  5TLN A;  4MXJ E;  3LS7 A;  1LNE E;  5K7T A;  3CHP A;  3B7S A;  3SSB A;  4ZX3 A;  1QF2 A;  1ESP A;  3CHS A;  4GAA A;  4K5P A;  4MZN E;  3FU5 A;  3P7W E;  3T8D A;  5JT9 E;  4XMX A;  3B2X A;  4ZW7 A;  2A7G E;  4MS6 A;  3EBI A;  2TLI A;  3FUD A;  3FBO A;  1QF1 A;  1KKK A;  2DQM A;  4PVB A;  3P7Q E;  3B2P A;  1SQM A;  1TLX A;  3FU0 A;  2ZXG A;  4N5P E;  3TLI A;  3ZI6 A;  4ZX4 A;  3F28 A;  3T8F A;  3MS3 A;  1PE7 A;  4QUO A;  4ZW3 A;  4TNL A;  3P7R E;  4PW4 A;  1KJP A;  4GER A;  3FUF A;  5FXN A;  4D91 A;  3FTV A;  4H57 A;  4TLN A;  4XMT A;  4TLI A;  3DO1 A;  3DO2 A;  3FH5 A;  4B52 A;  5DPE E;  2VQX A;  3FGD A;  1OS0 A;  3T73 A;  3FCQ A;  3T2I E;  3TMN E;  3P7V E;  4XMZ A;  4XN9 A;  3NN7 A;  4N4E E;  5JVI E;  3FTU A;  5DLH A;  4ZW6 A;  3FUL A;  4XMV A;  1PE5 A;  4QIR A;  5FSP A;  3P7U E;  4D9W A;  3FH7 A;  4QME A;  8TLI A;  3T2H E;  3B3B A;  1KTO A;  3FOR A;  3FUM A;  4RSY A;  1BQB A;  4N66 E;  5DPF E;  3Q44 A;  5BPP A;  7TLI A;  5DLL A;  1Z9G E;  4OI5 E;  5LIF E;  4ZX5 A;  4XO3 A;  5JXN E;  3FV4 A;  8TLN E;  3DNZ A;  5A3Y A;  3PUU A;  3FUN A;  1FJU A;  1NPC A;  3EBG A;  3DBK A;  4XO4 A;  1LNC E;  3EIM A;  1HS6 A;  3FTS A;  3NQY B;  3NQX A;  1ZDP E;  4MWP E;  1KJO A;  2TMN E;  5TLI A;  2DQ6 A;  3MSN A;  1KS7 A;  4XO5 A;  5L8P E; 
#chains in the Genus database with same CATH topology
 4Q4I A;  2HPO A;  5LHD A;  4FCA A;  4ZX6 A;  3FTY A;  2R59 A;  4IHQ A;  4XN4 A;  3Q7J A;  3T8C A;  3QH5 A;  1LND E;  3T8H A;  4K5O A;  4PU2 A;  4ZW5 A;  4KX9 A;  1TLP E;  7TLN A;  3FU6 A;  4FYQ A;  1GXW A;  5L3U E;  3FTZ A;  4XN2 A;  5DYF A;  3P7P E;  4KX7 A;  3FLF A;  3CHR A;  4X2U A;  4XN1 A;  2HPT A;  3T8G A;  2G4Z A;  4R5V A;  4ZQT A;  4MKT A;  5TLN A;  5AB2 A;  4GAA A;  4MZN E;  3FU5 A;  4AR8 A;  2A7G E;  3EBI A;  2TLI A;  3B2P A;  4KXB A;  3T8F A;  5FXN A;  3FTV A;  4H57 A;  4TLI A;  3DO1 A;  1OS0 A;  3T73 A;  3FTU A;  3FUL A;  4F5C A;  3P7U E;  3B3B A;  3FUM A;  4RSY A;  1BQB A;  5LIF E;  4XO3 A;  1FJU A;  1LNC E;  4FYR A;  3NQY B;  1KS7 A;  4XMU A;  4PJ6 A;  3FUI A;  1Z1W A;  3FH8 A;  4J3B A;  3B37 A;  3FU3 A;  4R7L A;  3P7T E;  3MSF A;  4M65 A;  4MTW E;  3FHE A;  1Z5H A;  3B7T A;  5JS3 E;  4K5L A;  5EV7 A;  4L2L A;  1KRO A;  2TLX A;  4XN5 A;  4Q4E A;  3B7R L;  3FTX A;  4XMW A;  3QH1 A;  3DO0 A;  3T74 A;  3CHO A;  6TMN E;  1GW6 A;  1LNA E;  1PE8 A;  5HQD A;  4ZW8 A;  4K89 A;  1KL6 A;  3QGO A;  3QJX A;  2XPY A;  1U4G A;  1KR6 A;  3N21 A;  3FUK A;  4MXJ E;  3LS7 A;  4Z7I A;  5K7T A;  4ZX3 A;  3CHS A;  4FYT A;  3B2X A;  2DQM A;  4WZ9 A;  4PVB A;  3ZI6 A;  1TLX A;  3FU0 A;  4ZX4 A;  3MS3 A;  4QUO A;  4PW4 A;  4FKH A;  1LML A;  4XMT A;  3DO2 A;  5LDS A;  3FCQ A;  3P7V E;  3NN7 A;  4N4E E;  5JVI E;  5DLH A;  1PE5 A;  5FSP A;  3FH7 A;  1KTO A;  5BPP A;  1Z9G E;  4ZX5 A;  3FV4 A;  8TLN E;  1NPC A;  3EIM A;  3FTS A;  3NQX A;  4FKE A;  4ARF A;  3MSN A;  1FJ3 A;  3KED A;  3T2J E;  4AR1 A;  3U9W A;  5FSJ A;  3FVP A;  1FJV A;  1L3F E;  3FUE A;  5FWQ A;  4R5X A;  1FJQ A;  3EBH A;  5JSS E;  1TMN E;  1LNF E;  3CHQ A;  4K90 A;  1FJT A;  4KX8 A;  3B7U X;  4JBS A;  3FTW A;  1QF0 A;  2YD0 A;  3FUJ A;  4XND A;  1EZM A;  1HYT A;  1H19 A;  4OU3 A;  3FXP A;  3CIA A;  3FXS A;  3T8V A;  3Q43 A;  4QHP A;  2VJ8 A;  3MSA A;  4R5T A;  4XN8 A;  2GTQ A;  2WHZ A;  1FJO A;  5CU5 A;  4K5M A;  5LWD E;  5TMN E;  1TLI A;  1LNE E;  3CHP A;  3B7S A;  3SSB A;  1QF2 A;  1ESP A;  4K5P A;  4XMX A;  4MS6 A;  3FUD A;  5J6S A;  1QF1 A;  8TLI A;  3TLI A;  4NZ8 A;  3F28 A;  4ZW3 A;  3P7R E;  3FUF A;  4B52 A;  5DPE E;  3T2I E;  4XN9 A;  3SE6 A;  4XMV A;  4QME A;  5C97 A;  5DPF E;  3Q44 A;  4FKK A;  4OI5 E;  5JXN E;  3DNZ A;  4KXD A;  3EBG A;  1HS6 A;  1ZDP E;  4MWP E;  3FBO A;  2DQ6 A;  4XO5 A;  3FUH A;  3T87 A;  4XN7 A;  1TRL A;  4OW3 A;  2XQ0 A;  4HOM A;  4QPE A;  1FJW A;  4XNB A;  4XNA A;  3B34 A;  4NAQ A;  4II7 A;  3F2P A;  4TMN E;  4DPR A;  4FYS A;  3NQZ B;  5FSS A;  2XPZ A;  5LG6 A;  4K5N A;  5AEN A;  4RVB A;  5K1V A;  1LNB E;  3QNF A;  6TLI A;  1Y3G E;  5L41 E;  5AB0 A;  3P7S E;  1KEI A;  3FB0 A;  4P8Q A;  2WI0 A;  1THL A;  4KXC A;  3P7W E;  3T8D A;  5JT9 E;  4ZW7 A;  1KKK A;  3P7Q E;  1SQM A;  4N5P E;  2ZXG A;  1PE7 A;  4TNL A;  1KJP A;  4GER A;  4E36 A;  4D91 A;  4TLN A;  3FH5 A;  4FGM A;  2VQX A;  3FGD A;  4AR9 A;  3TMN E;  4XMZ A;  4ZW6 A;  4QIR A;  4D9W A;  3T2H E;  3FOR A;  7TLI A;  4N66 E;  5DLL A;  5A3Y A;  3PUU A;  3FUN A;  4KXA A;  4XO4 A;  3DBK A;  1KJO A;  2TMN E;  5TLI A;  5L8P E;  3MDJ A; 
#chains in the Genus database with same CATH homology
 4Q4I A;  4XMU A;  2HPO A;  1FJ3 A;  3FUH A;  3KED A;  3FUI A;  3T2J E;  3T87 A;  4ZX6 A;  3FH8 A;  3FTY A;  4J3B A;  2R59 A;  4XN7 A;  5FSJ A;  1TRL A;  3B37 A;  2XQ0 A;  3FVP A;  4OW3 A;  1FJV A;  1L3F E;  3FUE A;  3FU3 A;  4R7L A;  4XN4 A;  4QPE A;  4R5X A;  5FWQ A;  1FJQ A;  1FJW A;  1LND E;  3EBH A;  3QH5 A;  3T8C A;  3T8H A;  3U9W A;  1TMN E;  5JSS E;  1LNF E;  3P7T E;  3CHQ A;  3MSF A;  4K90 A;  4M65 A;  1FJT A;  4K5O A;  4MTW E;  4XNB A;  3B34 A;  3FHE A;  4XNA A;  5JS3 E;  3B7T A;  3B7U X;  4PU2 A;  4K5L A;  4ZW5 A;  4L2L A;  1KRO A;  2TLX A;  3F2P A;  4TMN E;  1TLP E;  4DPR A;  3FTW A;  1QF0 A;  3NQZ B;  5FSS A;  3FUJ A;  4XND A;  1EZM A;  7TLN A;  4XN5 A;  2XPZ A;  3B7R L;  4Q4E A;  3FTX A;  4K5N A;  4XMW A;  3QH1 A;  3DO0 A;  5AEN A;  3T74 A;  3CHO A;  6TMN E;  1HYT A;  1GW6 A;  1H19 A;  3FU6 A;  1GXW A;  4RVB A;  3FXP A;  1LNB E;  5L3U E;  3CIA A;  3FTZ A;  4XN2 A;  3FXS A;  5DYF A;  6TLI A;  1Y3G E;  3P7P E;  3T8V A;  1LNA E;  1PE8 A;  3FLF A;  5HQD A;  5L41 E;  3Q43 A;  3CHR A;  4QHP A;  4X2U A;  3P7S E;  4ZW8 A;  4K89 A;  2VJ8 A;  1KEI A;  3FB0 A;  3MSA A;  4R5T A;  4XN8 A;  2GTQ A;  2WHZ A;  1FJO A;  4XN1 A;  1KL6 A;  3QGO A;  2G4Z A;  2HPT A;  3T8G A;  3QJX A;  4R5V A;  2XPY A;  1U4G A;  4K5M A;  2WI0 A;  1THL A;  1KR6 A;  3N21 A;  3FUK A;  5LWD E;  5TMN E;  4ZQT A;  1TLI A;  4MKT A;  5TLN A;  4MXJ E;  3LS7 A;  1LNE E;  5K7T A;  3CHP A;  3B7S A;  3SSB A;  4ZX3 A;  1QF2 A;  1ESP A;  3CHS A;  4GAA A;  4K5P A;  4MZN E;  3FU5 A;  3P7W E;  3T8D A;  5JT9 E;  4XMX A;  3B2X A;  4ZW7 A;  2A7G E;  4MS6 A;  3EBI A;  2TLI A;  3FUD A;  3FBO A;  1QF1 A;  1KKK A;  2DQM A;  4PVB A;  3P7Q E;  3B2P A;  1SQM A;  1TLX A;  3FU0 A;  2ZXG A;  4N5P E;  3TLI A;  3ZI6 A;  4ZX4 A;  3F28 A;  3T8F A;  3MS3 A;  1PE7 A;  4QUO A;  4ZW3 A;  4TNL A;  3P7R E;  4PW4 A;  1KJP A;  4GER A;  3FUF A;  5FXN A;  4D91 A;  1LML A;  3FTV A;  4H57 A;  4TLN A;  4XMT A;  4TLI A;  3DO1 A;  3DO2 A;  3FH5 A;  4B52 A;  5DPE E;  2VQX A;  3FGD A;  1OS0 A;  3T73 A;  3FCQ A;  3T2I E;  3TMN E;  3P7V E;  4XMZ A;  4XN9 A;  3NN7 A;  4N4E E;  5JVI E;  3FTU A;  5DLH A;  4ZW6 A;  3FUL A;  4XMV A;  1PE5 A;  4QIR A;  5FSP A;  3P7U E;  4D9W A;  3FH7 A;  4QME A;  8TLI A;  3T2H E;  3B3B A;  1KTO A;  3FOR A;  3FUM A;  4RSY A;  1BQB A;  4N66 E;  5DPF E;  3Q44 A;  5BPP A;  7TLI A;  5DLL A;  1Z9G E;  4OI5 E;  5LIF E;  4ZX5 A;  4XO3 A;  5JXN E;  3FV4 A;  8TLN E;  3DNZ A;  5A3Y A;  3PUU A;  3FUN A;  1FJU A;  1NPC A;  3EBG A;  3DBK A;  4XO4 A;  1LNC E;  3EIM A;  1HS6 A;  3FTS A;  3NQY B;  3NQX A;  1ZDP E;  4MWP E;  1KJO A;  2TMN E;  5TLI A;  2DQ6 A;  3MSN A;  1KS7 A;  4XO5 A;  5L8P E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...