3NQZB

Crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
307
Chain Sequence
ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGTSGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQLQMRVHYSSNYENAFWDGSAMTFGDGQNTFYPLVSLDVSAHEVSHGFTEQNSGLIYNGKPGGLNAAFSDMAGEAAEFYMKGSNDWLVGKDIFKGNGALRYMNNPTQDGRSIDNQSNYYSGMDVHYSSGVYNKAFYNLATTPGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACDLNYDPNDVKAALAAVGVNSNLSSGSDCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
molecule keywords Secreted metalloprotease Mcp02
total genus 109
structure length 307
sequence length 307
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
B PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3nqzB02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3nqzB01
3EBHA 1THLA 3FUMA 1LNDE 4ZW6A 3FVPA 1HYTA 1KTOA 1FJUA 3DO1A 1FJTA 1QF0A 3CHSA 1FJ3A 3TLIA 1U4GA 4ZX3A 3NQXA 3T8HA 2VQXA 5A3YA 4PVBA 4XN2A 1Y3GE 4R5TA 3FLFA 1KEIA 4K89A 6TMNE 2XPYA 4B52A 1KJPA 1Z9GE 3FUFA 3Q44A 4PW4A 3FULA 4PU2A 4MKTA 1FJQA 4H57A 1TMNE 3P7QE 1BQBA 3CIAA 4GAAA 4Q4IA 3T8VA 3KEDA 5JS3E 5JT9E 1GXWA 3SSBA 1KROA 4K5LA 5FWQA 1TLIA 5DLLA 5LWDE 5JVIE 3PUUA 5BPPA 1TLXA 4OI5E 5L41E 4XMVA 4R5VA 1KKKA 1ZDPE 3B7UX 3DNZA 3MSAA 3NQZB 3P7VE 5DPFE 5AENA 4XN8A 2HPOA 4ZW8A 2R59A 1TRLA 2DQ6A 3FXPA 4XNBA 3FUDA 2HPTA 3QH5A 3FCQA 3DBKA 3FTXA 1PE5A 4MS6A 4QIRA 4R5XA 1QF1A 4QHPA 4K90A 4X2UA 3FTWA 3FUEA 4M65A 5HQDA 4XO3A 4MZNE 3T8CA 8TLNE 1KR6A 3FTYA 4RSYA 3MSNA 3P7RE 2DQMA 3B34A 3FBOA 3T87A 3Q43A 4ZX6A 4XN4A 3FU0A 5FXNA 3FXSA 8TLIA 1ESPA 7TLIA 3T8FA 2G4ZA 4J3BA 3B2XA 5L8PE 4ZW7A 4K5NA 1KS7A 5DYFA 3T2IE 3TMNE 3DO2A 1LNBE 3FH8A 3P7PE 4XN1A 3FU6A 1LNEE 2ZXGA 1L3FE 4N5PE 4XMWA 3CHRA 1LNFE 4GERA 4ZX4A 4D9WA 4XN9A 3B7TA 3NN7A 4TLIA 5JXNE 3B3BA 4K5PA 3N21A 1NPCA 3QJXA 4K5MA 4N4EE 4XO4A 3CHOA 3FTVA 4XMUA 4QUOA 3B7SA 3EBGA 3FTZA 4K5OA 5DPEE 3B2PA 5TLNA 1QF2A 3FB0A 4TMNE 4QMEA 3P7WE 5FSPA 3EBIA 3MSFA 7TLNA 4TLNA 3T73A 3T2JE 3P7TE 4XMTA 3EIMA 5JSSE 2A7GE 3FH7A 1PE8A 3FTUA 1GW6A 4DPRA 4MTWE 1KJOA 1H19A 3FHEA 3ZI6A 2XQ0A 1HS6A 1PE7A 4RVBA 4ZQTA 4ZW3A 3FH5A 3QH1A 4N66E 2XPZA 3F28A 4XMZA 2VJ8A 4TNLA 4MWPE 1EZMA 4L2LA 3FGDA 3T2HE 1LNCE 1OS0A 3FUJA 3QGOA 4OW3A 3FUKA 4XN7A 4R7LA 2GTQA 3CHPA 3F2PA 3FTSA 3P7UE 5LIFE 3B7RL 4QPEA 1FJOA 3B37A 3FUIA 4XNAA 4ZX5A 1FJVA 2TLIA 4XO5A 3U9WA 3CHQA 5DLHA 5L3UE 3FV4A 3T74A 3P7SE 5TMNE 3DO0A 4XMXA 5TLIA 3T8GA 3FU5A 3NQYB 5FSSA 3FUNA 3FUHA 4D91A 4XN5A 4XNDA 1KL6A 2WHZA 3LS7A 4Q4EA 2TMNE 5FSJA 1FJWA 4ZW5A 1SQMA 1LNAE 3FU3A 2WI0A 5K7TA 3T8DA 3MS3A 6TLIA 3FORA 1TLPE 2TLXA 4MXJE
chains in the Genus database with same CATH superfamily
3EBHA 1THLA 3FUMA 1LNDE 4FCAA 4ZW6A 3FVPA 5C97A 1HYTA 1KTOA 5AB0A 4FKKA 1FJUA 3DO1A 1FJTA 1QF0A 3CHSA 1FJ3A 3TLIA 1U4GA 1Z1WA 4ZX3A 3NQXA 4KX7A 3T8HA 2VQXA 5A3YA 4PVBA 4IHQA 4F5CA 4XN2A 1Y3GE 4R5TA 3FLFA 1KEIA 4K89A 6TMNE 2XPYA 4B52A 1KJPA 1Z9GE 3FUFA 3Q44A 4PW4A 3FULA 4PU2A 4MKTA 1FJQA 4H57A 1TMNE 3P7QE 1BQBA 3CIAA 4GAAA 4NZ8A 4Q4IA 3T8VA 4II7A 4FYRA 3KEDA 5JS3E 5JT9E 1GXWA 3SSBA 4FKEA 1KROA 4K5LA 5FWQA 1TLIA 5DLLA 5LWDE 5JVIE 3QNFA 4NAQA 3PUUA 1LMLA 5BPPA 1TLXA 1Z5HA 4OI5E 5AB2A 5L41E 4XMVA 4R5VA 1KKKA 1ZDPE 3B7UX 3DNZA 3MSAA 3NQZB 3P7VE 5DPFE 5AENA 3Q7JA 4XN8A 2HPOA 4ZW8A 2R59A 1TRLA 2DQ6A 3FXPA 4KX9A 3FUDA 4XNBA 2HPTA 3QH5A 4AR9A 3FCQA 3DBKA 3FTXA 1PE5A 4MS6A 4QIRA 4R5XA 1QF1A 4QHPA 4K90A 4X2UA 3FTWA 3FUEA 4M65A 4KXDA 3SE6A 5HQDA 4XO3A 4MZNE 4P8QA 3T8CA 8TLNE 4AR8A 4ARFA 1KR6A 3FTYA 4RSYA 3MSNA 3P7RE 2DQMA 3B34A 3FBOA 2YD0A 3T87A 3Q43A 4FKHA 4ZX6A 4XN4A 3FU0A 5FXNA 3FXSA 8TLIA 1ESPA 7TLIA 3T8FA 2G4ZA 4J3BA 3B2XA 5L8PE 4ZW7A 4K5NA 1KS7A 5DYFA 3T2IE 3TMNE 3DO2A 1LNBE 3FH8A 3P7PE 4XN1A 3FU6A 1LNEE 4KX8A 2ZXGA 1L3FE 4N5PE 4XMWA 3CHRA 1LNFE 4GERA 4ZX4A 4D9WA 4XN9A 3B7TA 3NN7A 4TLIA 5JXNE 3B3BA 4K5PA 3N21A 1NPCA 3QJXA 4K5MA 4N4EE 4XO4A 3CHOA 3FTVA 4XMUA 5LG6A 4QUOA 3B7SA 3EBGA 3FTZA 4K5OA 4KXCA 5DPEE 3B2PA 5TLNA 1QF2A 3FB0A 4TMNE 4QMEA 3P7WE 5FSPA 3EBIA 3MSFA 7TLNA 4TLNA 3T73A 3T2JE 3P7TE 4XMTA 5J6SA 4E36A 3EIMA 4FYTA 4FYQA 2A7GE 3FH7A 5JSSE 1PE8A 4WZ9A 3FTUA 1GW6A 4DPRA 4MTWE 1KJOA 1H19A 5K1VA 3FHEA 5LDSA 3ZI6A 2XQ0A 1HS6A 1PE7A 3MDJA 4RVBA 4ZQTA 4ZW3A 3FH5A 3QH1A 4N66E 2XPZA 3F28A 4XMZA 2VJ8A 4TNLA 4MWPE 1EZMA 4L2LA 3FGDA 3T2HE 1LNCE 1OS0A 3FUJA 3QGOA 4OW3A 3FUKA 4XN7A 4R7LA 5CU5A 2GTQA 3CHPA 3F2PA 3FTSA 3P7UE 5EV7A 5LIFE 3B7RL 4JBSA 4QPEA 1FJOA 4HOMA 3B37A 3FUIA 4XNAA 4ZX5A 1FJVA 2TLIA 4FGMA 4XO5A 3U9WA 3CHQA 5DLHA 5L3UE 3FV4A 3T74A 3P7SE 4FYSA 3DO0A 4KXAA 4XMXA 5TMNE 5TLIA 3FU5A 3T8GA 3NQYB 5FSSA 3FUNA 4OU3A 3FUHA 4D91A 4XN5A 4XNDA 4Z7IA 1KL6A 2WHZA 3LS7A 4PJ6A 4Q4EA 2TMNE 5FSJA 1FJWA 4ZW5A 1SQMA 1LNAE 3FU3A 2WI0A 5K7TA 3T8DA 3MS3A 6TLIA 5LHDA 4KXBA 4AR1A 3FORA 1TLPE 2TLXA 4MXJE
chains in the Genus database with same CATH topology
3EBHA 1THLA 3FUMA 1LNDE 4ZW6A 3FVPA 1HYTA 1KTOA 1FJUA 3DO1A 1FJTA 1QF0A 3CHSA 1FJ3A 3TLIA 1U4GA 4ZX3A 3NQXA 3T8HA 2VQXA 5A3YA 4PVBA 4XN2A 1Y3GE 4R5TA 3FLFA 1KEIA 4K89A 6TMNE 2XPYA 4B52A 1KJPA 1Z9GE 3FUFA 3Q44A 4PW4A 3FULA 4PU2A 4MKTA 1FJQA 4H57A 1TMNE 3P7QE 1BQBA 3CIAA 4GAAA 4Q4IA 3T8VA 3KEDA 5JS3E 5JT9E 1GXWA 3SSBA 1KROA 4K5LA 5FWQA 1TLIA 5DLLA 5LWDE 5JVIE 3PUUA 1LMLA 5BPPA 1TLXA 4OI5E 5L41E 4XMVA 4R5VA 1KKKA 1ZDPE 3B7UX 3DNZA 3MSAA 3NQZB 3P7VE 5DPFE 5AENA 4XN8A 2HPOA 4ZW8A 2R59A 1TRLA 2DQ6A 3FXPA 4XNBA 3FUDA 2HPTA 3QH5A 3FCQA 3DBKA 3FTXA 1PE5A 4MS6A 4QIRA 4R5XA 1QF1A 4QHPA 4K90A 4X2UA 3FTWA 3FUEA 4M65A 5HQDA 4XO3A 4MZNE 3T8CA 8TLNE 1KR6A 3FTYA 4RSYA 3MSNA 3P7RE 2DQMA 3B34A 3FBOA 3T87A 3Q43A 4ZX6A 4XN4A 3FU0A 5FXNA 3FXSA 8TLIA 1ESPA 7TLIA 3T8FA 2G4ZA 4J3BA 3B2XA 5L8PE 4ZW7A 4K5NA 1KS7A 5DYFA 3T2IE 3TMNE 3DO2A 1LNBE 3FH8A 3P7PE 4XN1A 3FU6A 1LNEE 2ZXGA 1L3FE 4N5PE 4XMWA 3CHRA 1LNFE 4GERA 4ZX4A 4D9WA 4XN9A 3B7TA 3NN7A 4TLIA 5JXNE 3B3BA 4K5PA 3N21A 1NPCA 3QJXA 4K5MA 4N4EE 4XO4A 3CHOA 3FTVA 4XMUA 4QUOA 3B7SA 3EBGA 3FTZA 4K5OA 5DPEE 3B2PA 5TLNA 1QF2A 3FB0A 4TMNE 4QMEA 3P7WE 5FSPA 3EBIA 3MSFA 7TLNA 4TLNA 3T73A 3T2JE 3P7TE 4XMTA 3EIMA 5JSSE 2A7GE 3FH7A 1PE8A 3FTUA 1GW6A 4DPRA 4MTWE 1KJOA 1H19A 3FHEA 3ZI6A 2XQ0A 1HS6A 1PE7A 4RVBA 4ZQTA 4ZW3A 3FH5A 3QH1A 4N66E 2XPZA 3F28A 4XMZA 2VJ8A 4TNLA 4MWPE 1EZMA 4L2LA 3FGDA 3T2HE 1LNCE 1OS0A 3FUJA 3QGOA 4OW3A 3FUKA 4XN7A 4R7LA 2GTQA 3CHPA 3F2PA 3FTSA 3P7UE 5LIFE 3B7RL 4QPEA 1FJOA 3B37A 3FUIA 4XNAA 4ZX5A 1FJVA 2TLIA 4XO5A 3U9WA 3CHQA 5DLHA 5L3UE 3FV4A 3T74A 3P7SE 5TMNE 3DO0A 4XMXA 5TLIA 3T8GA 3FU5A 3NQYB 5FSSA 3FUNA 3FUHA 4D91A 4XN5A 4XNDA 1KL6A 2WHZA 3LS7A 4Q4EA 2TMNE 5FSJA 1FJWA 4ZW5A 1SQMA 1LNAE 3FU3A 2WI0A 5K7TA 3T8DA 3MS3A 6TLIA 3FORA 1TLPE 2TLXA 4MXJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBH A;  1THL A;  3FUM A;  1LND E;  4ZW6 A;  3FVP A;  1HYT A;  1KTO A;  1FJU A;  3DO1 A;  1FJT A;  1QF0 A;  3CHS A;  1FJ3 A;  3TLI A;  1U4G A;  4ZX3 A;  3NQX A;  3T8H A;  2VQX A;  5A3Y A;  4PVB A;  4XN2 A;  1Y3G E;  4R5T A;  3FLF A;  1KEI A;  4K89 A;  6TMN E;  2XPY A;  4B52 A;  1KJP A;  1Z9G E;  3FUF A;  3Q44 A;  4PW4 A;  3FUL A;  4PU2 A;  4MKT A;  1FJQ A;  4H57 A;  1TMN E;  3P7Q E;  1BQB A;  3CIA A;  4GAA A;  4Q4I A;  3T8V A;  3KED A;  5JS3 E;  5JT9 E;  1GXW A;  3SSB A;  1KRO A;  4K5L A;  5FWQ A;  1TLI A;  5DLL A;  5LWD E;  5JVI E;  3PUU A;  5BPP A;  1TLX A;  4OI5 E;  5L41 E;  4XMV A;  4R5V A;  1KKK A;  1ZDP E;  3B7U X;  3DNZ A;  3MSA A;  3NQZ B;  3P7V E;  5DPF E;  5AEN A;  4XN8 A;  2HPO A;  4ZW8 A;  2R59 A;  1TRL A;  2DQ6 A;  3FXP A;  4XNB A;  3FUD A;  2HPT A;  3QH5 A;  3FCQ A;  3DBK A;  3FTX A;  1PE5 A;  4MS6 A;  4QIR A;  4R5X A;  1QF1 A;  4QHP A;  4K90 A;  4X2U A;  3FTW A;  3FUE A;  4M65 A;  5HQD A;  4XO3 A;  4MZN E;  3T8C A;  8TLN E;  1KR6 A;  3FTY A;  4RSY A;  3MSN A;  3P7R E;  2DQM A;  3B34 A;  3FBO A;  3T87 A;  3Q43 A;  4ZX6 A;  4XN4 A;  3FU0 A;  5FXN A;  3FXS A;  8TLI A;  1ESP A;  7TLI A;  3T8F A;  2G4Z A;  4J3B A;  3B2X A;  5L8P E;  4ZW7 A;  4K5N A;  1KS7 A;  5DYF A;  3T2I E;  3TMN E;  3DO2 A;  1LNB E;  3FH8 A;  3P7P E;  4XN1 A;  3FU6 A;  1LNE E;  2ZXG A;  1L3F E;  4N5P E;  4XMW A;  3CHR A;  1LNF E;  4GER A;  4ZX4 A;  4D9W A;  4XN9 A;  3B7T A;  3NN7 A;  4TLI A;  5JXN E;  3B3B A;  4K5P A;  3N21 A;  1NPC A;  3QJX A;  4K5M A;  4N4E E;  4XO4 A;  3CHO A;  3FTV A;  4XMU A;  4QUO A;  3B7S A;  3EBG A;  3FTZ A;  4K5O A;  5DPE E;  3B2P A;  5TLN A;  1QF2 A;  3FB0 A;  4TMN E;  4QME A;  3P7W E;  5FSP A;  3EBI A;  3MSF A;  7TLN A;  4TLN A;  3T73 A;  3T2J E;  3P7T E;  4XMT A;  3EIM A;  5JSS E;  2A7G E;  3FH7 A;  1PE8 A;  3FTU A;  1GW6 A;  4DPR A;  4MTW E;  1KJO A;  1H19 A;  3FHE A;  3ZI6 A;  2XQ0 A;  1HS6 A;  1PE7 A;  4RVB A;  4ZQT A;  4ZW3 A;  3FH5 A;  3QH1 A;  4N66 E;  2XPZ A;  3F28 A;  4XMZ A;  2VJ8 A;  4TNL A;  4MWP E;  1EZM A;  4L2L A;  3FGD A;  3T2H E;  1LNC E;  1OS0 A;  3FUJ A;  3QGO A;  4OW3 A;  3FUK A;  4XN7 A;  4R7L A;  2GTQ A;  3CHP A;  3F2P A;  3FTS A;  3P7U E;  5LIF E;  3B7R L;  4QPE A;  1FJO A;  3B37 A;  3FUI A;  4XNA A;  4ZX5 A;  1FJV A;  2TLI A;  4XO5 A;  3U9W A;  3CHQ A;  5DLH A;  5L3U E;  3FV4 A;  3T74 A;  3P7S E;  5TMN E;  3DO0 A;  4XMX A;  5TLI A;  3T8G A;  3FU5 A;  3NQY B;  5FSS A;  3FUN A;  3FUH A;  4D91 A;  4XN5 A;  4XND A;  1KL6 A;  2WHZ A;  3LS7 A;  4Q4E A;  2TMN E;  5FSJ A;  1FJW A;  4ZW5 A;  1SQM A;  1LNA E;  3FU3 A;  2WI0 A;  5K7T A;  3T8D A;  3MS3 A;  6TLI A;  3FOR A;  1TLP E;  2TLX A;  4MXJ E; 
#chains in the Genus database with same CATH topology
 3EBH A;  1THL A;  3FUM A;  1LND E;  4FCA A;  4ZW6 A;  3FVP A;  5C97 A;  1HYT A;  1KTO A;  5AB0 A;  4FKK A;  1FJU A;  3DO1 A;  1FJT A;  1QF0 A;  3CHS A;  1FJ3 A;  3TLI A;  1U4G A;  1Z1W A;  4ZX3 A;  3NQX A;  4KX7 A;  3T8H A;  2VQX A;  5A3Y A;  4PVB A;  4IHQ A;  4F5C A;  4XN2 A;  1Y3G E;  4R5T A;  3FLF A;  1KEI A;  4K89 A;  6TMN E;  2XPY A;  4B52 A;  1KJP A;  1Z9G E;  3FUF A;  3Q44 A;  4PW4 A;  3FUL A;  4PU2 A;  4MKT A;  1FJQ A;  4H57 A;  1TMN E;  3P7Q E;  1BQB A;  3CIA A;  4GAA A;  4NZ8 A;  4Q4I A;  3T8V A;  4II7 A;  4FYR A;  3KED A;  5JS3 E;  5JT9 E;  1GXW A;  3SSB A;  4FKE A;  1KRO A;  4K5L A;  5FWQ A;  1TLI A;  5DLL A;  5LWD E;  5JVI E;  3QNF A;  4NAQ A;  3PUU A;  1LML A;  5BPP A;  1TLX A;  1Z5H A;  4OI5 E;  5AB2 A;  5L41 E;  4XMV A;  4R5V A;  1KKK A;  1ZDP E;  3B7U X;  3DNZ A;  3MSA A;  3NQZ B;  3P7V E;  5DPF E;  5AEN A;  3Q7J A;  4XN8 A;  2HPO A;  4ZW8 A;  2R59 A;  1TRL A;  2DQ6 A;  3FXP A;  4KX9 A;  3FUD A;  4XNB A;  2HPT A;  3QH5 A;  4AR9 A;  3FCQ A;  3DBK A;  3FTX A;  1PE5 A;  4MS6 A;  4QIR A;  4R5X A;  1QF1 A;  4QHP A;  4K90 A;  4X2U A;  3FTW A;  3FUE A;  4M65 A;  4KXD A;  3SE6 A;  5HQD A;  4XO3 A;  4MZN E;  4P8Q A;  3T8C A;  8TLN E;  4AR8 A;  4ARF A;  1KR6 A;  3FTY A;  4RSY A;  3MSN A;  3P7R E;  2DQM A;  3B34 A;  3FBO A;  2YD0 A;  3T87 A;  3Q43 A;  4FKH A;  4ZX6 A;  4XN4 A;  3FU0 A;  5FXN A;  3FXS A;  8TLI A;  1ESP A;  7TLI A;  3T8F A;  2G4Z A;  4J3B A;  3B2X A;  5L8P E;  4ZW7 A;  4K5N A;  1KS7 A;  5DYF A;  3T2I E;  3TMN E;  3DO2 A;  1LNB E;  3FH8 A;  3P7P E;  4XN1 A;  3FU6 A;  1LNE E;  4KX8 A;  2ZXG A;  1L3F E;  4N5P E;  4XMW A;  3CHR A;  1LNF E;  4GER A;  4ZX4 A;  4D9W A;  4XN9 A;  3B7T A;  3NN7 A;  4TLI A;  5JXN E;  3B3B A;  4K5P A;  3N21 A;  1NPC A;  3QJX A;  4K5M A;  4N4E E;  4XO4 A;  3CHO A;  3FTV A;  4XMU A;  5LG6 A;  4QUO A;  3B7S A;  3EBG A;  3FTZ A;  4K5O A;  4KXC A;  5DPE E;  3B2P A;  5TLN A;  1QF2 A;  3FB0 A;  4TMN E;  4QME A;  3P7W E;  5FSP A;  3EBI A;  3MSF A;  7TLN A;  4TLN A;  3T73 A;  3T2J E;  3P7T E;  4XMT A;  5J6S A;  4E36 A;  3EIM A;  4FYT A;  4FYQ A;  2A7G E;  3FH7 A;  5JSS E;  1PE8 A;  4WZ9 A;  3FTU A;  1GW6 A;  4DPR A;  4MTW E;  1KJO A;  1H19 A;  5K1V A;  3FHE A;  5LDS A;  3ZI6 A;  2XQ0 A;  1HS6 A;  1PE7 A;  3MDJ A;  4RVB A;  4ZQT A;  4ZW3 A;  3FH5 A;  3QH1 A;  4N66 E;  2XPZ A;  3F28 A;  4XMZ A;  2VJ8 A;  4TNL A;  4MWP E;  1EZM A;  4L2L A;  3FGD A;  3T2H E;  1LNC E;  1OS0 A;  3FUJ A;  3QGO A;  4OW3 A;  3FUK A;  4XN7 A;  4R7L A;  5CU5 A;  2GTQ A;  3CHP A;  3F2P A;  3FTS A;  3P7U E;  5EV7 A;  5LIF E;  3B7R L;  4JBS A;  4QPE A;  1FJO A;  4HOM A;  3B37 A;  3FUI A;  4XNA A;  4ZX5 A;  1FJV A;  2TLI A;  4FGM A;  4XO5 A;  3U9W A;  3CHQ A;  5DLH A;  5L3U E;  3FV4 A;  3T74 A;  3P7S E;  4FYS A;  3DO0 A;  4KXA A;  4XMX A;  5TMN E;  5TLI A;  3FU5 A;  3T8G A;  3NQY B;  5FSS A;  3FUN A;  4OU3 A;  3FUH A;  4D91 A;  4XN5 A;  4XND A;  4Z7I A;  1KL6 A;  2WHZ A;  3LS7 A;  4PJ6 A;  4Q4E A;  2TMN E;  5FSJ A;  1FJW A;  4ZW5 A;  1SQM A;  1LNA E;  3FU3 A;  2WI0 A;  5K7T A;  3T8D A;  3MS3 A;  6TLI A;  5LHD A;  4KXB A;  4AR1 A;  3FOR A;  1TLP E;  2TLX A;  4MXJ E; 
#chains in the Genus database with same CATH homology
 3EBH A;  1THL A;  3FUM A;  1LND E;  4ZW6 A;  3FVP A;  1HYT A;  1KTO A;  1FJU A;  3DO1 A;  1FJT A;  1QF0 A;  3CHS A;  1FJ3 A;  3TLI A;  1U4G A;  4ZX3 A;  3NQX A;  3T8H A;  2VQX A;  5A3Y A;  4PVB A;  4XN2 A;  1Y3G E;  4R5T A;  3FLF A;  1KEI A;  4K89 A;  6TMN E;  2XPY A;  4B52 A;  1KJP A;  1Z9G E;  3FUF A;  3Q44 A;  4PW4 A;  3FUL A;  4PU2 A;  4MKT A;  1FJQ A;  4H57 A;  1TMN E;  3P7Q E;  1BQB A;  3CIA A;  4GAA A;  4Q4I A;  3T8V A;  3KED A;  5JS3 E;  5JT9 E;  1GXW A;  3SSB A;  1KRO A;  4K5L A;  5FWQ A;  1TLI A;  5DLL A;  5LWD E;  5JVI E;  3PUU A;  1LML A;  5BPP A;  1TLX A;  4OI5 E;  5L41 E;  4XMV A;  4R5V A;  1KKK A;  1ZDP E;  3B7U X;  3DNZ A;  3MSA A;  3NQZ B;  3P7V E;  5DPF E;  5AEN A;  4XN8 A;  2HPO A;  4ZW8 A;  2R59 A;  1TRL A;  2DQ6 A;  3FXP A;  4XNB A;  3FUD A;  2HPT A;  3QH5 A;  3FCQ A;  3DBK A;  3FTX A;  1PE5 A;  4MS6 A;  4QIR A;  4R5X A;  1QF1 A;  4QHP A;  4K90 A;  4X2U A;  3FTW A;  3FUE A;  4M65 A;  5HQD A;  4XO3 A;  4MZN E;  3T8C A;  8TLN E;  1KR6 A;  3FTY A;  4RSY A;  3MSN A;  3P7R E;  2DQM A;  3B34 A;  3FBO A;  3T87 A;  3Q43 A;  4ZX6 A;  4XN4 A;  3FU0 A;  5FXN A;  3FXS A;  8TLI A;  1ESP A;  7TLI A;  3T8F A;  2G4Z A;  4J3B A;  3B2X A;  5L8P E;  4ZW7 A;  4K5N A;  1KS7 A;  5DYF A;  3T2I E;  3TMN E;  3DO2 A;  1LNB E;  3FH8 A;  3P7P E;  4XN1 A;  3FU6 A;  1LNE E;  2ZXG A;  1L3F E;  4N5P E;  4XMW A;  3CHR A;  1LNF E;  4GER A;  4ZX4 A;  4D9W A;  4XN9 A;  3B7T A;  3NN7 A;  4TLI A;  5JXN E;  3B3B A;  4K5P A;  3N21 A;  1NPC A;  3QJX A;  4K5M A;  4N4E E;  4XO4 A;  3CHO A;  3FTV A;  4XMU A;  4QUO A;  3B7S A;  3EBG A;  3FTZ A;  4K5O A;  5DPE E;  3B2P A;  5TLN A;  1QF2 A;  3FB0 A;  4TMN E;  4QME A;  3P7W E;  5FSP A;  3EBI A;  3MSF A;  7TLN A;  4TLN A;  3T73 A;  3T2J E;  3P7T E;  4XMT A;  3EIM A;  5JSS E;  2A7G E;  3FH7 A;  1PE8 A;  3FTU A;  1GW6 A;  4DPR A;  4MTW E;  1KJO A;  1H19 A;  3FHE A;  3ZI6 A;  2XQ0 A;  1HS6 A;  1PE7 A;  4RVB A;  4ZQT A;  4ZW3 A;  3FH5 A;  3QH1 A;  4N66 E;  2XPZ A;  3F28 A;  4XMZ A;  2VJ8 A;  4TNL A;  4MWP E;  1EZM A;  4L2L A;  3FGD A;  3T2H E;  1LNC E;  1OS0 A;  3FUJ A;  3QGO A;  4OW3 A;  3FUK A;  4XN7 A;  4R7L A;  2GTQ A;  3CHP A;  3F2P A;  3FTS A;  3P7U E;  5LIF E;  3B7R L;  4QPE A;  1FJO A;  3B37 A;  3FUI A;  4XNA A;  4ZX5 A;  1FJV A;  2TLI A;  4XO5 A;  3U9W A;  3CHQ A;  5DLH A;  5L3U E;  3FV4 A;  3T74 A;  3P7S E;  5TMN E;  3DO0 A;  4XMX A;  5TLI A;  3T8G A;  3FU5 A;  3NQY B;  5FSS A;  3FUN A;  3FUH A;  4D91 A;  4XN5 A;  4XND A;  1KL6 A;  2WHZ A;  3LS7 A;  4Q4E A;  2TMN E;  5FSJ A;  1FJW A;  4ZW5 A;  1SQM A;  1LNA E;  3FU3 A;  2WI0 A;  5K7T A;  3T8D A;  3MS3 A;  6TLI A;  3FOR A;  1TLP E;  2TLX A;  4MXJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...