3NQZB

Crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
307
Chain Sequence
b'ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGTSGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQLQMRVHYSSNYENAFWDGSAMTFGDGQNTFYPLVSLDVSAHEVSHGFTEQNSGLIYNGKPGGLNAAFSDMAGEAAEFYMKGSNDWLVGKDIFKGNGALRYMNNPTQDGRSIDNQSNYYSGMDVHYSSGVYNKAFYNLATTPGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACDLNYDPNDVKAALAAVGVNSNLSSGSDCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted metalloprotease Mcp02
molecule tags Hydrolase
source organism Pseudoalteromonas sp.
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
total genus 109
structure length 307
sequence length 307
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
B PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3nqzB02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3nqzB01
1Y3GE 3FTSA 3FV4A 3NN7A 5JXNE 4XO3A 3ZI6A 1TRLA 1HS6A 1TLXA 5DLHA 3FULA 4XMXA 3FH8A 3F28A 4K90A 3FU0A 5LWDE 1FJUA 3EBHA 3P7PE 4Q4EA 4K5NA 4XMWA 1TLIA 4XNDA 3B7UX 4XNAA 4ZW7A 5JT9E 4QHPA 1QF2A 3P7SE 1LNDE 2VQXA 3DO1A 4QIRA 1FJTA 3P7WE 4XN9A 1FJQA 1PE5A 3CHQA 4TLIA 3EBIA 4K89A 3N21A 5DLLA 4ZQTA 1GW6A 3FXPA 4XMVA 1KEIA 1TLPE 2HPOA 1FJVA 1TMNE 5L41E 4B52A 3T73A 3T8VA 1HYTA 1EZMA 3B7RL 2WI0A 3FTVA 3P7UE 5DYFA 3FUHA 4R5XA 4DPRA 3Q44A 3T87A 5DPFE 1L3FE 6TMNE 5L3UE 4X2UA 1KR6A 3B34A 3B37A 3FH5A 3MSAA 2XQ0A 3FTUA 4ZX5A 3FTXA 4K5LA 3T8GA 3FUEA 3B7SA 3FBOA 4K5MA 4XMTA 4D9WA 2DQMA 4MXJE 4XO5A 1KL6A 4QUOA 4XMUA 4L2LA 4N5PE 5TLNA 4J3BA 4ZW3A 2WHZA 3P7RE 3NQZB 3MS3A 4N4EE 1PE8A 2TLXA 3FUKA 4GERA 1KJPA 4RSYA 3FH7A 1LNCE 1LNBE 3KEDA 4PU2A 4XN7A 3PUUA 4R5TA 5LIFE 3B7TA 4N66E 3NQXA 5L8PE 4XO4A 4MTWE 3FTYA 1THLA 3EIMA 4TMNE 3CHRA 1ZDPE 5BPPA 4TNLA 1QF0A 3FTWA 2TLIA 3FU6A 1FJOA 4D91A 4XN4A 1GXWA 1Z9GE 1LNEE 3QH1A 3QGOA 5TLIA 1LNAE 4MKTA 5JS3E 5FSPA 4ZW6A 4ZX4A 3QJXA 5A3YA 5JSSE 3DO0A 1ESPA 1KJOA 3FUMA 3F2PA 5DPEE 3SSBA 4XN2A 5AENA 2A7GE 4XNBA 7TLIA 8TLIA 3CHPA 1QF1A 1KROA 3DO2A 4OI5E 4ZW8A 4K5PA 3T8HA 3FB0A 3MSFA 2ZXGA 3B2PA 2HPTA 1FJ3A 3FVPA 2R59A 1KTOA 3LS7A 3T8DA 3T8CA 4TLNA 5HQDA 1H19A 3B3BA 1PE7A 3FLFA 4PW4A 3T2HE 3FUFA 3P7TE 3Q43A 4XN8A 1LNFE 4MS6A 5FSJA 4RVBA 3FUJA 5FXNA 1KS7A 3FXSA 1NPCA 4PVBA 4H57A 2XPZA 3CIAA 4ZW5A 3NQYB 4QPEA 3TLIA 3QH5A 5FSSA 3CHOA 3MSNA 3FHEA 4OW3A 4XMZA 3FTZA 7TLNA 4M65A 3T8FA 1U4GA 3T74A 3EBGA 4QMEA 4MZNE 1KKKA 2DQ6A 4ZX3A 4XN5A 3FU5A 3B2XA 1OS0A 1FJWA 3P7VE 4ZX6A 2VJ8A 4R7LA 3FUIA 3T2JE 8TLNE 4XN1A 3FGDA 2G4ZA 3DNZA 3FUNA 4Q4IA 1BQBA 3FORA 4R5VA 2XPYA 2GTQA 6TLIA 5FWQA 3P7QE 5JVIE 4K5OA 3TMNE 5K7TA 3FUDA 3FU3A 2TMNE 1SQMA 3CHSA 5TMNE 3DBKA 3U9WA 4MWPE 4GAAA 3FCQA 3T2IE
chains in the Genus database with same CATH superfamily
1Y3GE 3FTSA 4AR8A 3FV4A 3NN7A 5JXNE 4XO3A 3ZI6A 1TRLA 1HS6A 1TLXA 5DLHA 3FULA 4XMXA 3FH8A 3F28A 4K90A 3FU0A 5LWDE 1FJUA 3EBHA 1Z1WA 3P7PE 4Q4EA 4K5NA 4XMWA 1TLIA 4XNDA 3B7UX 4XNAA 4FKEA 4ZW7A 5JT9E 4QHPA 1Z5HA 1QF2A 3P7SE 4FYTA 1LNDE 2VQXA 3DO1A 4QIRA 1FJTA 3P7WE 4KXBA 4XN9A 1FJQA 1PE5A 3CHQA 4TLIA 3EBIA 4K89A 3N21A 5DLLA 4ZQTA 4NAQA 1GW6A 3FXPA 4XMVA 1KEIA 1TLPE 2HPOA 1FJVA 1TMNE 4KXAA 5L41E 5K1VA 3T73A 3T8VA 1HYTA 4B52A 1EZMA 3B7RL 2WI0A 3FTVA 3P7UE 5DYFA 3FUHA 4R5XA 4DPRA 3Q7JA 3Q44A 3T87A 5DPFE 1L3FE 6TMNE 5L3UE 4X2UA 5AB2A 2YD0A 1KR6A 3B34A 3B37A 3FH5A 3MSAA 2XQ0A 3FTUA 4KXCA 3FTXA 4K5LA 4ZX5A 3FUEA 3B7SA 3FBOA 4KX7A 4K5MA 4D9WA 4XMTA 2DQMA 4MXJE 4XO5A 5CU5A 1KL6A 4QUOA 4XMUA 4L2LA 4N5PE 5TLNA 4J3BA 3QNFA 2WHZA 3P7RE 3NQZB 4ZW3A 5C97A 3MS3A 5LDSA 4N4EE 1PE8A 2TLXA 3FUKA 4GERA 1KJPA 4RSYA 3FH7A 1LNCE 1LNBE 3KEDA 4PU2A 4XN7A 3PUUA 4R5TA 5LIFE 3B7TA 4FYRA 3NQXA 4N66E 5L8PE 4XO4A 4MTWE 4AR9A 3FTYA 1THLA 3EIMA 4TMNE 4F5CA 1LMLA 3CHRA 1ZDPE 5BPPA 4TNLA 1QF0A 3FTWA 2TLIA 3FU6A 1FJOA 3SE6A 4D91A 4IHQA 4XN4A 1GXWA 1Z9GE 1LNEE 3QH1A 3QGOA 5TLIA 1LNAE 4MKTA 5JS3E 5FSPA 4ZW6A 4ZX4A 3QJXA 4FYQA 4FYSA 5A3YA 4PJ6A 5JSSE 3DO0A 1ESPA 1KJOA 5JVIE 3FUMA 3F2PA 5DPEE 3SSBA 4XN2A 5AENA 2A7GE 4XNBA 3T8GA 7TLIA 8TLIA 3CHPA 1QF1A 1KROA 3DO2A 4OI5E 4ZW8A 4K5PA 3T8HA 3FB0A 4KX8A 3MSFA 2ZXGA 3B2PA 2HPTA 1FJ3A 3FVPA 2R59A 1KTOA 3LS7A 3T8DA 3T8CA 4TLNA 5HQDA 1H19A 3B3BA 1PE7A 3FLFA 3MDJA 4PW4A 3T2HE 3FUFA 3P7TE 3Q43A 4XN8A 4JBSA 4FKKA 1LNFE 4P8QA 4Z7IA 4MS6A 5FSJA 4RVBA 3FUJA 5FXNA 1KS7A 3FXSA 1NPCA 4PVBA 4H57A 2XPZA 3CIAA 4ZW5A 3NQYB 5LG6A 4QPEA 5EV7A 3QH5A 3TLIA 5AB0A 5FSSA 3CHOA 3MSNA 3FHEA 4OW3A 4XMZA 3FTZA 4ARFA 7TLNA 4M65A 3T8FA 1U4GA 3T74A 3EBGA 4QMEA 4MZNE 5J6SA 1KKKA 4FCAA 2DQ6A 4AR1A 4ZX3A 4XN5A 3FU5A 3B2XA 1OS0A 1FJWA 3P7VE 4KX9A 4ZX6A 2VJ8A 4R7LA 3FUIA 5LHDA 3T2JE 8TLNE 4WZ9A 4XN1A 3FGDA 2G4ZA 3DNZA 3FUNA 4FKHA 1BQBA 3FORA 4FGMA 4R5VA 4Q4IA 4KXDA 2XPYA 2GTQA 6TLIA 5FWQA 3P7QE 4II7A 4NZ8A 4K5OA 3TMNE 4E36A 4HOMA 3FUDA 3FU3A 4OU3A 2TMNE 1SQMA 5K7TA 3CHSA 5TMNE 3DBKA 3U9WA 4MWPE 4GAAA 3FCQA 3T2IE
chains in the Genus database with same CATH topology
1Y3GE 3FTSA 3FV4A 3NN7A 5JXNE 4XO3A 3ZI6A 1TRLA 1HS6A 1TLXA 5DLHA 3FULA 4XMXA 3FH8A 3F28A 4K90A 3FU0A 5LWDE 1FJUA 3EBHA 3P7PE 4Q4EA 4K5NA 4XMWA 1TLIA 4XNDA 3B7UX 4XNAA 4ZW7A 5JT9E 4QHPA 1QF2A 3P7SE 1LNDE 2VQXA 3DO1A 4QIRA 1FJTA 3P7WE 4XN9A 1FJQA 1PE5A 3CHQA 4TLIA 3EBIA 4K89A 3N21A 5DLLA 4ZQTA 1GW6A 3FXPA 4XMVA 1KEIA 1TLPE 2HPOA 1FJVA 1TMNE 5L41E 4B52A 3T73A 3T8VA 1HYTA 1EZMA 3B7RL 2WI0A 3FTVA 3P7UE 5DYFA 3FUHA 4R5XA 4DPRA 3Q44A 3T87A 5DPFE 1L3FE 6TMNE 5L3UE 4X2UA 1KR6A 3B34A 3B37A 3FH5A 3MSAA 2XQ0A 3FTUA 4ZX5A 3FTXA 4K5LA 3T8GA 3FUEA 3B7SA 3FBOA 4K5MA 4XMTA 4D9WA 2DQMA 4MXJE 4XO5A 1KL6A 4QUOA 4XMUA 4L2LA 4N5PE 5TLNA 4J3BA 4ZW3A 2WHZA 3P7RE 3NQZB 3MS3A 4N4EE 1PE8A 2TLXA 3FUKA 4GERA 1KJPA 4RSYA 3FH7A 1LNCE 1LNBE 3KEDA 4PU2A 4XN7A 3PUUA 4R5TA 5LIFE 3B7TA 4N66E 3NQXA 5L8PE 4XO4A 4MTWE 3FTYA 1THLA 3EIMA 4TMNE 1LMLA 3CHRA 1ZDPE 5BPPA 4TNLA 1QF0A 3FTWA 2TLIA 3FU6A 1FJOA 4D91A 4XN4A 1GXWA 1Z9GE 1LNEE 3QH1A 3QGOA 5TLIA 1LNAE 4MKTA 5JS3E 5FSPA 4ZW6A 4ZX4A 3QJXA 5A3YA 5JSSE 3DO0A 1ESPA 1KJOA 3FUMA 3F2PA 5DPEE 3SSBA 4XN2A 5AENA 2A7GE 4XNBA 7TLIA 8TLIA 3CHPA 1QF1A 1KROA 3DO2A 4OI5E 4ZW8A 4K5PA 3T8HA 3FB0A 3MSFA 2ZXGA 3B2PA 2HPTA 1FJ3A 3FVPA 2R59A 1KTOA 3LS7A 3T8DA 3T8CA 4TLNA 5HQDA 1H19A 3B3BA 1PE7A 3FLFA 4PW4A 3T2HE 3FUFA 3P7TE 3Q43A 4XN8A 1LNFE 4MS6A 5FSJA 4RVBA 3FUJA 5FXNA 1KS7A 3FXSA 1NPCA 4PVBA 4H57A 2XPZA 3CIAA 4ZW5A 3NQYB 4QPEA 3TLIA 3QH5A 5FSSA 3CHOA 3MSNA 3FHEA 4OW3A 4XMZA 3FTZA 7TLNA 4M65A 3T8FA 1U4GA 3T74A 3EBGA 4QMEA 4MZNE 1KKKA 2DQ6A 4ZX3A 4XN5A 3FU5A 3B2XA 1OS0A 1FJWA 3P7VE 4ZX6A 2VJ8A 4R7LA 3FUIA 3T2JE 8TLNE 4XN1A 3FGDA 2G4ZA 3DNZA 3FUNA 4Q4IA 1BQBA 3FORA 4R5VA 2XPYA 2GTQA 6TLIA 5FWQA 3P7QE 5JVIE 4K5OA 3TMNE 5K7TA 3FUDA 3FU3A 2TMNE 1SQMA 3CHSA 5TMNE 3DBKA 3U9WA 4MWPE 4GAAA 3FCQA 3T2IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y3G E;  3FTS A;  3FV4 A;  3NN7 A;  5JXN E;  4XO3 A;  3ZI6 A;  1TRL A;  1HS6 A;  1TLX A;  5DLH A;  3FUL A;  4XMX A;  3FH8 A;  3F28 A;  4K90 A;  3FU0 A;  5LWD E;  1FJU A;  3EBH A;  3P7P E;  4Q4E A;  4K5N A;  4XMW A;  1TLI A;  4XND A;  3B7U X;  4XNA A;  4ZW7 A;  5JT9 E;  4QHP A;  1QF2 A;  3P7S E;  1LND E;  2VQX A;  3DO1 A;  4QIR A;  1FJT A;  3P7W E;  4XN9 A;  1FJQ A;  1PE5 A;  3CHQ A;  4TLI A;  3EBI A;  4K89 A;  3N21 A;  5DLL A;  4ZQT A;  1GW6 A;  3FXP A;  4XMV A;  1KEI A;  1TLP E;  2HPO A;  1FJV A;  1TMN E;  5L41 E;  4B52 A;  3T73 A;  3T8V A;  1HYT A;  1EZM A;  3B7R L;  2WI0 A;  3FTV A;  3P7U E;  5DYF A;  3FUH A;  4R5X A;  4DPR A;  3Q44 A;  3T87 A;  5DPF E;  1L3F E;  6TMN E;  5L3U E;  4X2U A;  1KR6 A;  3B34 A;  3B37 A;  3FH5 A;  3MSA A;  2XQ0 A;  3FTU A;  4ZX5 A;  3FTX A;  4K5L A;  3T8G A;  3FUE A;  3B7S A;  3FBO A;  4K5M A;  4XMT A;  4D9W A;  2DQM A;  4MXJ E;  4XO5 A;  1KL6 A;  4QUO A;  4XMU A;  4L2L A;  4N5P E;  5TLN A;  4J3B A;  4ZW3 A;  2WHZ A;  3P7R E;  3NQZ B;  3MS3 A;  4N4E E;  1PE8 A;  2TLX A;  3FUK A;  4GER A;  1KJP A;  4RSY A;  3FH7 A;  1LNC E;  1LNB E;  3KED A;  4PU2 A;  4XN7 A;  3PUU A;  4R5T A;  5LIF E;  3B7T A;  4N66 E;  3NQX A;  5L8P E;  4XO4 A;  4MTW E;  3FTY A;  1THL A;  3EIM A;  4TMN E;  3CHR A;  1ZDP E;  5BPP A;  4TNL A;  1QF0 A;  3FTW A;  2TLI A;  3FU6 A;  1FJO A;  4D91 A;  4XN4 A;  1GXW A;  1Z9G E;  1LNE E;  3QH1 A;  3QGO A;  5TLI A;  1LNA E;  4MKT A;  5JS3 E;  5FSP A;  4ZW6 A;  4ZX4 A;  3QJX A;  5A3Y A;  5JSS E;  3DO0 A;  1ESP A;  1KJO A;  3FUM A;  3F2P A;  5DPE E;  3SSB A;  4XN2 A;  5AEN A;  2A7G E;  4XNB A;  7TLI A;  8TLI A;  3CHP A;  1QF1 A;  1KRO A;  3DO2 A;  4OI5 E;  4ZW8 A;  4K5P A;  3T8H A;  3FB0 A;  3MSF A;  2ZXG A;  3B2P A;  2HPT A;  1FJ3 A;  3FVP A;  2R59 A;  1KTO A;  3LS7 A;  3T8D A;  3T8C A;  4TLN A;  5HQD A;  1H19 A;  3B3B A;  1PE7 A;  3FLF A;  4PW4 A;  3T2H E;  3FUF A;  3P7T E;  3Q43 A;  4XN8 A;  1LNF E;  4MS6 A;  5FSJ A;  4RVB A;  3FUJ A;  5FXN A;  1KS7 A;  3FXS A;  1NPC A;  4PVB A;  4H57 A;  2XPZ A;  3CIA A;  4ZW5 A;  3NQY B;  4QPE A;  3TLI A;  3QH5 A;  5FSS A;  3CHO A;  3MSN A;  3FHE A;  4OW3 A;  4XMZ A;  3FTZ A;  7TLN A;  4M65 A;  3T8F A;  1U4G A;  3T74 A;  3EBG A;  4QME A;  4MZN E;  1KKK A;  2DQ6 A;  4ZX3 A;  4XN5 A;  3FU5 A;  3B2X A;  1OS0 A;  1FJW A;  3P7V E;  4ZX6 A;  2VJ8 A;  4R7L A;  3FUI A;  3T2J E;  8TLN E;  4XN1 A;  3FGD A;  2G4Z A;  3DNZ A;  3FUN A;  4Q4I A;  1BQB A;  3FOR A;  4R5V A;  2XPY A;  2GTQ A;  6TLI A;  5FWQ A;  3P7Q E;  5JVI E;  4K5O A;  3TMN E;  5K7T A;  3FUD A;  3FU3 A;  2TMN E;  1SQM A;  3CHS A;  5TMN E;  3DBK A;  3U9W A;  4MWP E;  4GAA A;  3FCQ A;  3T2I E; 
#chains in the Genus database with same CATH topology
 1Y3G E;  3FTS A;  4AR8 A;  3FV4 A;  3NN7 A;  5JXN E;  4XO3 A;  3ZI6 A;  1TRL A;  1HS6 A;  1TLX A;  5DLH A;  3FUL A;  4XMX A;  3FH8 A;  3F28 A;  4K90 A;  3FU0 A;  5LWD E;  1FJU A;  3EBH A;  1Z1W A;  3P7P E;  4Q4E A;  4K5N A;  4XMW A;  1TLI A;  4XND A;  3B7U X;  4XNA A;  4FKE A;  4ZW7 A;  5JT9 E;  4QHP A;  1Z5H A;  1QF2 A;  3P7S E;  4FYT A;  1LND E;  2VQX A;  3DO1 A;  4QIR A;  1FJT A;  3P7W E;  4KXB A;  4XN9 A;  1FJQ A;  1PE5 A;  3CHQ A;  4TLI A;  3EBI A;  4K89 A;  3N21 A;  5DLL A;  4ZQT A;  4NAQ A;  1GW6 A;  3FXP A;  4XMV A;  1KEI A;  1TLP E;  2HPO A;  1FJV A;  1TMN E;  4KXA A;  5L41 E;  5K1V A;  3T73 A;  3T8V A;  1HYT A;  4B52 A;  1EZM A;  3B7R L;  2WI0 A;  3FTV A;  3P7U E;  5DYF A;  3FUH A;  4R5X A;  4DPR A;  3Q7J A;  3Q44 A;  3T87 A;  5DPF E;  1L3F E;  6TMN E;  5L3U E;  4X2U A;  5AB2 A;  2YD0 A;  1KR6 A;  3B34 A;  3B37 A;  3FH5 A;  3MSA A;  2XQ0 A;  3FTU A;  4KXC A;  3FTX A;  4K5L A;  4ZX5 A;  3FUE A;  3B7S A;  3FBO A;  4KX7 A;  4K5M A;  4D9W A;  4XMT A;  2DQM A;  4MXJ E;  4XO5 A;  5CU5 A;  1KL6 A;  4QUO A;  4XMU A;  4L2L A;  4N5P E;  5TLN A;  4J3B A;  3QNF A;  2WHZ A;  3P7R E;  3NQZ B;  4ZW3 A;  5C97 A;  3MS3 A;  5LDS A;  4N4E E;  1PE8 A;  2TLX A;  3FUK A;  4GER A;  1KJP A;  4RSY A;  3FH7 A;  1LNC E;  1LNB E;  3KED A;  4PU2 A;  4XN7 A;  3PUU A;  4R5T A;  5LIF E;  3B7T A;  4FYR A;  3NQX A;  4N66 E;  5L8P E;  4XO4 A;  4MTW E;  4AR9 A;  3FTY A;  1THL A;  3EIM A;  4TMN E;  4F5C A;  1LML A;  3CHR A;  1ZDP E;  5BPP A;  4TNL A;  1QF0 A;  3FTW A;  2TLI A;  3FU6 A;  1FJO A;  3SE6 A;  4D91 A;  4IHQ A;  4XN4 A;  1GXW A;  1Z9G E;  1LNE E;  3QH1 A;  3QGO A;  5TLI A;  1LNA E;  4MKT A;  5JS3 E;  5FSP A;  4ZW6 A;  4ZX4 A;  3QJX A;  4FYQ A;  4FYS A;  5A3Y A;  4PJ6 A;  5JSS E;  3DO0 A;  1ESP A;  1KJO A;  5JVI E;  3FUM A;  3F2P A;  5DPE E;  3SSB A;  4XN2 A;  5AEN A;  2A7G E;  4XNB A;  3T8G A;  7TLI A;  8TLI A;  3CHP A;  1QF1 A;  1KRO A;  3DO2 A;  4OI5 E;  4ZW8 A;  4K5P A;  3T8H A;  3FB0 A;  4KX8 A;  3MSF A;  2ZXG A;  3B2P A;  2HPT A;  1FJ3 A;  3FVP A;  2R59 A;  1KTO A;  3LS7 A;  3T8D A;  3T8C A;  4TLN A;  5HQD A;  1H19 A;  3B3B A;  1PE7 A;  3FLF A;  3MDJ A;  4PW4 A;  3T2H E;  3FUF A;  3P7T E;  3Q43 A;  4XN8 A;  4JBS A;  4FKK A;  1LNF E;  4P8Q A;  4Z7I A;  4MS6 A;  5FSJ A;  4RVB A;  3FUJ A;  5FXN A;  1KS7 A;  3FXS A;  1NPC A;  4PVB A;  4H57 A;  2XPZ A;  3CIA A;  4ZW5 A;  3NQY B;  5LG6 A;  4QPE A;  5EV7 A;  3QH5 A;  3TLI A;  5AB0 A;  5FSS A;  3CHO A;  3MSN A;  3FHE A;  4OW3 A;  4XMZ A;  3FTZ A;  4ARF A;  7TLN A;  4M65 A;  3T8F A;  1U4G A;  3T74 A;  3EBG A;  4QME A;  4MZN E;  5J6S A;  1KKK A;  4FCA A;  2DQ6 A;  4AR1 A;  4ZX3 A;  4XN5 A;  3FU5 A;  3B2X A;  1OS0 A;  1FJW A;  3P7V E;  4KX9 A;  4ZX6 A;  2VJ8 A;  4R7L A;  3FUI A;  5LHD A;  3T2J E;  8TLN E;  4WZ9 A;  4XN1 A;  3FGD A;  2G4Z A;  3DNZ A;  3FUN A;  4FKH A;  1BQB A;  3FOR A;  4FGM A;  4R5V A;  4Q4I A;  4KXD A;  2XPY A;  2GTQ A;  6TLI A;  5FWQ A;  3P7Q E;  4II7 A;  4NZ8 A;  4K5O A;  3TMN E;  4E36 A;  4HOM A;  3FUD A;  3FU3 A;  4OU3 A;  2TMN E;  1SQM A;  5K7T A;  3CHS A;  5TMN E;  3DBK A;  3U9W A;  4MWP E;  4GAA A;  3FCQ A;  3T2I E; 
#chains in the Genus database with same CATH homology
 1Y3G E;  3FTS A;  3FV4 A;  3NN7 A;  5JXN E;  4XO3 A;  3ZI6 A;  1TRL A;  1HS6 A;  1TLX A;  5DLH A;  3FUL A;  4XMX A;  3FH8 A;  3F28 A;  4K90 A;  3FU0 A;  5LWD E;  1FJU A;  3EBH A;  3P7P E;  4Q4E A;  4K5N A;  4XMW A;  1TLI A;  4XND A;  3B7U X;  4XNA A;  4ZW7 A;  5JT9 E;  4QHP A;  1QF2 A;  3P7S E;  1LND E;  2VQX A;  3DO1 A;  4QIR A;  1FJT A;  3P7W E;  4XN9 A;  1FJQ A;  1PE5 A;  3CHQ A;  4TLI A;  3EBI A;  4K89 A;  3N21 A;  5DLL A;  4ZQT A;  1GW6 A;  3FXP A;  4XMV A;  1KEI A;  1TLP E;  2HPO A;  1FJV A;  1TMN E;  5L41 E;  4B52 A;  3T73 A;  3T8V A;  1HYT A;  1EZM A;  3B7R L;  2WI0 A;  3FTV A;  3P7U E;  5DYF A;  3FUH A;  4R5X A;  4DPR A;  3Q44 A;  3T87 A;  5DPF E;  1L3F E;  6TMN E;  5L3U E;  4X2U A;  1KR6 A;  3B34 A;  3B37 A;  3FH5 A;  3MSA A;  2XQ0 A;  3FTU A;  4ZX5 A;  3FTX A;  4K5L A;  3T8G A;  3FUE A;  3B7S A;  3FBO A;  4K5M A;  4XMT A;  4D9W A;  2DQM A;  4MXJ E;  4XO5 A;  1KL6 A;  4QUO A;  4XMU A;  4L2L A;  4N5P E;  5TLN A;  4J3B A;  4ZW3 A;  2WHZ A;  3P7R E;  3NQZ B;  3MS3 A;  4N4E E;  1PE8 A;  2TLX A;  3FUK A;  4GER A;  1KJP A;  4RSY A;  3FH7 A;  1LNC E;  1LNB E;  3KED A;  4PU2 A;  4XN7 A;  3PUU A;  4R5T A;  5LIF E;  3B7T A;  4N66 E;  3NQX A;  5L8P E;  4XO4 A;  4MTW E;  3FTY A;  1THL A;  3EIM A;  4TMN E;  1LML A;  3CHR A;  1ZDP E;  5BPP A;  4TNL A;  1QF0 A;  3FTW A;  2TLI A;  3FU6 A;  1FJO A;  4D91 A;  4XN4 A;  1GXW A;  1Z9G E;  1LNE E;  3QH1 A;  3QGO A;  5TLI A;  1LNA E;  4MKT A;  5JS3 E;  5FSP A;  4ZW6 A;  4ZX4 A;  3QJX A;  5A3Y A;  5JSS E;  3DO0 A;  1ESP A;  1KJO A;  3FUM A;  3F2P A;  5DPE E;  3SSB A;  4XN2 A;  5AEN A;  2A7G E;  4XNB A;  7TLI A;  8TLI A;  3CHP A;  1QF1 A;  1KRO A;  3DO2 A;  4OI5 E;  4ZW8 A;  4K5P A;  3T8H A;  3FB0 A;  3MSF A;  2ZXG A;  3B2P A;  2HPT A;  1FJ3 A;  3FVP A;  2R59 A;  1KTO A;  3LS7 A;  3T8D A;  3T8C A;  4TLN A;  5HQD A;  1H19 A;  3B3B A;  1PE7 A;  3FLF A;  4PW4 A;  3T2H E;  3FUF A;  3P7T E;  3Q43 A;  4XN8 A;  1LNF E;  4MS6 A;  5FSJ A;  4RVB A;  3FUJ A;  5FXN A;  1KS7 A;  3FXS A;  1NPC A;  4PVB A;  4H57 A;  2XPZ A;  3CIA A;  4ZW5 A;  3NQY B;  4QPE A;  3TLI A;  3QH5 A;  5FSS A;  3CHO A;  3MSN A;  3FHE A;  4OW3 A;  4XMZ A;  3FTZ A;  7TLN A;  4M65 A;  3T8F A;  1U4G A;  3T74 A;  3EBG A;  4QME A;  4MZN E;  1KKK A;  2DQ6 A;  4ZX3 A;  4XN5 A;  3FU5 A;  3B2X A;  1OS0 A;  1FJW A;  3P7V E;  4ZX6 A;  2VJ8 A;  4R7L A;  3FUI A;  3T2J E;  8TLN E;  4XN1 A;  3FGD A;  2G4Z A;  3DNZ A;  3FUN A;  4Q4I A;  1BQB A;  3FOR A;  4R5V A;  2XPY A;  2GTQ A;  6TLI A;  5FWQ A;  3P7Q E;  5JVI E;  4K5O A;  3TMN E;  5K7T A;  3FUD A;  3FU3 A;  2TMN E;  1SQM A;  3CHS A;  5TMN E;  3DBK A;  3U9W A;  4MWP E;  4GAA A;  3FCQ A;  3T2I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...