4P8QA

Crystal structure of human insulin regulated aminopeptidase with alanine in active site
Total Genus 289
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
289
sequence length
867
structure length
860
Chain Sequence
KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-cystinyl aminopeptidase
publication title Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 289
structure length 860
sequence length 867
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4p8qA02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 4p8qA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 4p8qA01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4p8qA03
3FUJA 3FUKA 4XMUA 2VJ8A 4ZX4A 4MS6A 4XNAA 3U9WA 5K1VA 3FH7A 3QJXA 4K5PA 4ZW6A 5AB2A 4ZW5A 4XMZA 2HPOA 3FTXA 4PW4A 4XN9A 3FUNA 3B7RL 4OU3A 4FGMA 3FTSA 3CHRA 2DQMA 4Q4IA 4XMVA 4XNBA 4Q4EA 3FUIA 4K5NA 4JBSA 4Z7IA 4RVBA 3B37A 5C97A 4ZQTA 4P8QA 5J5EA 4QMEA 4KXCA 4R5VA 4QUOA 3EBHA 4FYTA 3QNFA 4WZ9A 2GTQA 3EBIA 3FTYA 5LHDA 4K5MA 4RSYA 4K5OA 4XN4A 4NAQA 4PVBA 2HPTA 4XMTA 4L2LA 2DQ6A 1H19A 3B3BA 3FTUA 3FH8A 4FKEA 3B2XA 3FTVA 1Z1WA 2XPZA 4ZX3A 3FUEA 4PU2A 4QIRA 3Q7JA 5LG6A 4K5LA 4XN7A 4ZW8A 2XQ0A 4XN1A 4XO3A 4XO5A 4ZX6A 1GW6A 4FYQA 3MDJA 3CHPA 3PUUA 4XMXA 5DLLA 1SQMA 3B7UX 4XNDA 3FUFA 2ZXGA 3B2PA 4ZW7A 3FTWA 2YD0A 5CU5A 4X2UA 4KXAA 5AENA 4KXBA 4HOMA 4KX9A 4FKHA 4FYRA 5FWQA 4DPRA 3FH5A 3FU5A 3Q43A 3CHOA 5J6SA 4MKTA 4ZW3A 1Z5HA 3FU0A 3EBGA 3FUMA 2R59A 2XPYA 4XN2A 4XMWA 4ZX5A 4R5XA 3FUHA 5BPPA 4KX7A 4QPEA 4KX8A 3FHEA 3RJOA 1HS6A 4KXDA 3CHQA 3CIAA 4R5TA 3KEDA 4PJ6A 4J3BA 3FU6A 3CHSA 5DYFA 3FTZA 4FKKA 4FYSA 3B34A 4E36A 4F5CA 4GAAA 3Q44A 3FU3A 4R7LA 3SE6A 4XO4A 4NZ8A 5AB0A 4XN8A 3T8VA 3FULA 5LDSA 4QHPA 3B7TA 4XN5A 3FUDA 3B7SA
chains in the Genus database with same CATH superfamily
4AI7A 2E9WA 3O6FB 4F3FA 5IREA 3HAEB 1KMGA 3G5WA 1YAIA 2BJMH 1ML0A 5HI3C 1HI6B 1RJZA 2OBGA 1IC5L 4GG6B 3P77A 1AACA 4J1UA 4GAYA 1NIDA 4CNIA 3LH2L 2X4PB 4NSKA 4UQ2A 5GSVA 4PGCA 4JFXB 2HVKA 4WI4A 1D7DA 4OLYL 4X5RA 3VXNA 4MNQB 3H53A 3QT2A 4TNWF 5C09D 1OE1A 4Q4IA 1ZLDA 3L8QA 3NEXA 1KJMA 2DQIL 2AEIT 1JPEA 4TMPA 5EUOA 3FV4A 4G9FB 4YC2B 2O5ZL 1S7VB 1KJ2A 1EIBA 2F61A 3PXJA 5JQHC 4JFSA 3I2CH 5DJXB 4Y5YC 1PSKH 4I4WB 4NLAA 3RVUC 2H47C 35C8L 4F80A 1TJIL 2O5NA 1PGRB 4ZDHA 1GJUA 4WI6A 2UWEA 3QDGA 4JM4L 3O6FA 4PQXA 3FKUS 2BWQA 4MD0B 4YFEA 4XMTA 4NC1E 3GBMH 3MACH 3ARBB 1TO4A 4NNPL 4NUPA 5MEQA 5IW1B 2ZOWA 4Y1AB 2EKJA 2PO6D 5DD6A 1A65A 1WGVA 1FJVA 3L3IB 1LO2H 1LNUB 2K6YA 3FTVA 3T2JE 1NMAH 5AOMA 5DRNB 5GGVH 4AENB 1I7RB 2PUQT 1FPTH 1UOKA 3DX9B 1RIHL 4DW2L 5CZXD 3CN2A 1GW6A 1UCBH 1MHCB 2R8SL 1P7QD 3VXMD 1EGJL 1S5HA 1IEBB 3ARGA 25C8L 2YWZA 5IJVA 5F1NA 1MCPL 2P5ED 4EI6A 3FQWB 3UAAA 2NUPB 4ERSL 1MWAL 1G4MA 1E9QB 3OAYH 4BA0A 1XBRA 5IOPB 3OL2A 4KNUA 2DKSA 4QF1B 2MJWA 4QY8B 5J6SA 5HDRA 3H9YA 3F04A 2X9ZA 4RMRA 3QUHA 4B41A 5D7EA 3BVXA 3KW8A 4QXWA 1DQML 1INEL 2H9GA 1OP5H 3SGEH 5ENWB 4NKMB 4WJ5B 2F2HA 1AZUA 1ZTXE 4MHHI 4YDJA 4GI9A 5GSRA 1UVQA 4W6WB 2R0KL 5T1KD 4X5WB 3RDTC 3VX1A 3VGEA 1Q0XH 2V17L 1I1AD 3DARA 2BNRA 2ITCB 3ZE2B 3NCBB 4OLUH 1UURA 1LJMA 4QRSB 4J5VA 5JLZB 1MFMA 2R29L 3R0MA 1OSEA 1SGKA 1LMIA 4NO0A 3RWDB 4TPRH 4PSPA 3TEUA 3FQWA 4M1GL 2F08A 1Y1DA 2P26A 3C5JB 4G8GD 3H0TA 4HX1B 3GXDA 4BK5C 1AO7D 3N21A 2HRHA 3LVEA 2OMXB 1QTYT 1Y1UA 1YY8B 2XN9B 2A83B 1I8MA 5TDOB 1J12A 2WXMA 2DM2A 3PGCA 4WV1B 1A3QA 2A5UA 5L4IA 1W91A 1GZHA 1NC4D 2P5WE 7TLNA 5J1SC 4XXDA 3DXAA 4XCNA 3D39D 3HMXH 2OJ1A 5GZNC 5I1JL 1HKLL 5ECGA 5H8DA 1I85C 1QHPA 1MJJB 4FG2A 5I8EB 4Y19B 4X5LA 5LN8A 3HIZA 3W0WA 5CGBA 3ULAB 2QVTA 3HLAA 1JHKL 2JI3A 4FNTA 3CK0L 5FCUL 3RUGF 2F54D 3WMPA 2EYRA 1OCWH 5IVXF 3N0PB 2OQJB 3BESR 4JM0A 2OMXA 1JYNA 3FTGB 2IDQA 3GHPA 5MENE 2XVBA 5I30H 2ZG3A 4Z78A 4WV1A 4NAJA 3ZTEA 2GQHA 5AOLA 5I1IL 1IGJB 1C08B 2FBRA 2YKLH 1PX8A 1NAMB 2EC9U 3U36A 5AWNL 1F6AB 1T3FB 3U2SB 3WG7B 1FNEB 1JJUA 1A0QL 4ZXBB 1A7QH 3WUWA 2CZNA 3L7EA 5DK2B 5KW9H 1AD9B 2G5BB 3KPMA 4HIEB 5IQ7L 1LP9A 2K78A 4H8UA 2ZUTA 2XN0A 3JXAA 1U95A 3ZDXB 3WTUA 1Y18A 5D2LB 2GYSA 5ABZA 3B3IB 4Z3GA 5A3ID 3V6FB 5KVEE 4KZ0A 3NCWA 2DH3A 5IMMB 3OKMB 4YDNA 1OCZB 4HKXB 4Y4FB 3LN4B 1VFBB 3FCSB 1OK0A 4BZ1L 3BSZH 3L4TA 3MV7E 3W9DA 5JIMA 4HUVB 3MBWB 1BREA 2W0LA 1OP3H 4IOFC 5DEFA 1N2RB 4MDJB 5TH2A 5L7XL 4O2FB 4PJXE 2R1WA 3T2OA 1DJGA 4FI7A 5C07D 1XR9A 4AG4L 4N0UA 3NCFB 4QRQA 2L7JA 1BFOB 2C3VB 2NQDA 3NJNA 4FP8L 5TF0A 1NPNA 3JV4A 4OT1L 4LGSB 4XB3A 5K9KB 3TEYA 4K94H 3U6XS 4XCYB 2BNUA 4CSPA 4DPAX 4BKTC 3SE8H 1RZIA 1URLA 2Q0ZX 3CLEL 5GGUB 1A6UH 3QEQE 3GLEA 3NZHH 3P2BA 2YO3A 2ADIA 1DBKH 3QA3B 1T0MA 4GQ9H 1PIGA 2DZEA 1G4RA 3LN4A 2J25A 2Z0BA 4PS8A 1PE5A 1BZ7B 2OS7A 4H20H 5CEYB 5GS0C 1JAEA 1PD6A 1NCBL 1IAMA 3QZWA 2PF6A 1CGWA 5HDWA 2E47A 3I50L 2MOVA 5D7LB 5E6IA 4HAKA 1A14H 4WU5B 4LB8A 1F6FB 2CO1A 5BOPA 2OW6A 4TUJA 1NCWL 2EDTA 2MH4A 2A74B 2Y1AA 3FO0H 2Y1ZA 4UT7H 4WFGE 1WT5C 5LAXA 3UTSD 4XBPB 4C56E 5CJOL 5B8CB 3T1FB 2PWDA 2VH5L 1XMEB 4HHAA 1RIUH 3I3BA 3F58H 3UZVA 3FFCD 1L0XA 2MMXA 5CIPA 4PGDA 3LS7A 3ABMB 3VVWA 1FZMA 2X5PA 2ZOLB 2BP5M 3B7YA 2DLGA 4XP1L 3V7AE 1KZYA 4KV5E 1ZT1B 4QDGA 5CP3H 5I8KH 3ARQA 1TF4A 1KPUB 1AFVL 3N0AA 4H5SB 4L8SA 4BFOA 1C5BH 1RK0A 3QW9A 1H19A 1Q9OB 4W9EC 5C0AA 1VFOA 2O5XH 4YDMA 3OKLB 5BJTB 1P4BL 3KLHD 3M17A 2VR5A 3CFBA 4PLJD 4Z7QB 2WBJD 2YD1A 3T65A 3WGVB 4U7MA 2V5YA 3DJRA 5AB1A 1CI5A 4IK6A 2Y25A 2I5YH 5CJXC 3PPSA 3NA9H 5ID0B 2BIOA 3IFOA 5I16A 1ZT7A 3VU1A 4GKLA 1L4IA 4KQ4L 3G9VA 3VWJD 5B1JA 1SLVA 2NX5E 2SODB 4OF3A 4JHWL 1EHLL 2WUBH 2VQ1B 1SXCA 5B1CA 3K3QA 4ATWA 2WP3T 1IBZA 4X7EC 3SDAD 2CR0A 3ZKXC 3U82B 1OVZA 2EEFA 4JQIA 5C3IA 3AG2B 2XG5B 1IGFH 2FJGB 3APCA 1BBDL 3DX4A 3NABL 5GGQL 5EEXA 5FCSH 1E42A 2XXFA 3U6XA 4YEEA 2W91A 2QGCA 3MKKA 5EWIL 5BPPA 3N9GH 3QP3A 1MW1A 2B77A 4NN6C 3CX5K 3IDGA 5EBMB 3AAZB 3K6SA 4IKLA 1OGAD 2Z8SA 1E6JL 4U7KA 3RIFF 1VFMA 2GEEA 2A6JA 4IDJL 5HP5A 5IMLA 3RL2A 2XT1B 3CMGA 3C8KA 5E5RB 1QHQA 4MMZB 3MBEA 3LKOA 1JNJA 1XZ0B 2V4LA 4TUKH 3D9AH 4QD2E 2ICES 1U8CA 4Y9EA 2EO1A 3T71A 4F2EA 3ZKMC 3PABA 1JDCA 3FUJA 2G4GA 3CZSA 4F58H 1JTPA 1SMDA 4I87A 4EJ1C 2P8LB 3SDDB 2J7LA 3FCUB 1F3JA 3BP4B 3MLVL 43CAB 5CEZL 3OTTA 4BHUI 3DUUB 2ZXDA 1YEKH 2AQ2A 2YAOA 3NCYS 1Y0LB 4ELME 1RY7B 3H2QA 4U1IA 1E4XI 1XGTB 3O9WC 3U46A 3MOQA 4X7FC 3WTWA 3EAKA 2OL3H 2NOYA 4GOSA 4MRCA 4CADA 4E9LA 2WLJA 3DV6B 4S1DD 4GPVA 2OXHA 4WUKL 1BIIB 1TCRA 5C08E 4K5NA 4AQ1B 5HSFA 3L1OL 4JRXA 2ZX9A 3NCCB 2VDNH 5D72L 5C0JA 3TT1L 1IL1B 1THAA 1NPJA 4A7SA 4CMHC 1YPZF 1U8HB 5I71C 5FUZH 4XE0A 3BPNC 1SVBA 3N6YA 1YN7B 5D96B 3RGHA 5IIEA 2ATKB 2AABL 4KJYB 3SDDA 1TU2B 1KS7A 2YPLA 2CO7A 2J8OA 5AVZB 3EOBA 4K9EH 5JR1H 1XF4A 1QUNB 3BMWA 4Y2OB 1KGXA 3ZDZB 4KTEL 1ODAA 3G7TA 2TRYA 2AJYH 3GIVA 4DP5X 4UTBL 5E8OA 3MJ8A 2QZQA 4ONHB 4EBQH 2ATPA 3HC0A 1DE4B 4LEXL 4MVBC 3KBEA 5ERWA 2FBJL 3F5WB 2E4TA 5CLXA 3VGHA 1JHTB 2Y6TE 1JVOA 5HGGS 4HJSA 3MREA 4J3XA 4AIEA 4AIZB 3ULUD 1U8HA 2Q7NA 4R4NC 1Z9NA 1C9SA 4ZW7A 3A6CL 4I88A 5AUMA 2QLVB 4OGXL 1EXUA 3KXFB 1UB5A 2BNQD 2FYYB 3DMMD 4KFZC 3S0PA 1KYFA 1RV6X 4ADJA 3FU5A 3WFBL 3D06A 1QTPA 5HJBA 3NJIA 2IQ9L 4KK9D 2VB5A 4KUZH 1UD2A 2M1KA 3E8UH 4YBHA 3QQDB 4Y2OA 1ZS2A 2WWMD 3HNVL 1OF2A 3DGGA 2I07B 3W11D 1OAZH 4Q6IB 2FEDC 4KAQH 4XWOD 4HS6A 2H26A 4TM9A 2ICEA 1DE4A 1J0YA 3KLLA 2ZJSH 3ESNA 1RFDL 3W5NA 2NCEA 4PJ6A 1RZJL 3FYEB 5D2LF 3S4SB 3R8BB 4U6VL 1A4KB 2IG2L 3MA7B 5CSGA 5T3ZH 3JVFC 4AMWA 5F9DC 1MCWW 4FNPA 5AB9A 1BLNB 1IVLA 5E9DE 1GXEA 4HIPA 4QTFA 5F93C 4M7JH 3QQ3A 4GUPA 4MJ6B 3MJ6A 1HJBC 3FQ4A 2J57A 4EOWH 1PE7A 1BCIA 1OT2A 5EF3A 4P07A 4FTDA 3JYCA 1XGRB 2YA0A 2YUZA 4OLVL 5MERA 4LVOB 1JWSB 2XTLA 4XMZA 3AXHA 3VE0B 4NYLB 1G9HA 4JFUA 5FXCH 4K7PL 2JXMB 1F86A 2VT0A 4AVHA 2VDKL 4GO9A 5IFAH 2WWKT 4XCCH 1FG2A 4DWHA 4P46A 5EZPA 4M8UA 5KVDL 3MRIB 1NSNL 1U58B 1IAKA 1Q38A 1X9UA 1AR2A 2BJML 4JBSA 2D0GA 2H6UA 2EDJA 2QVKA 3I84A 1UZ8B 3K6DA 4RFNB 3ULUH 1FA4A 3LEYH 2PMZA 1AI1L 1T6VN 1I9JH 4Z5RB 3QAZB 3BWUC 5HHMB 3MRDB 4HFWB 5SV3A 5IQOA 1VFAB 3MRNA 1KEML 1XGRA 2JJSC 1G94A 3FH8A 1VADB 3BKJH 1HAUA 3NJJA 4KQ0A 3FT3A 1JTTA 1JZEA 3KCPB 2ZNWA 4NQDD 4LIQH 3SY0A 4AZ8A 3KHQA 4TLNA 5CUSH 1R4XA 3ISYA 1A25A 1H8SA 2X0WA 4I7ZC 3I2CL 4GRWH 3TXAA 1PSKL 4OCLC 3F7RA 4RRPM 1KIQB 3KL5A 3P3RA 3VGDA 3IGUA 4WHCA 3C09C 5DJ8B 3P9LA 4OZ4B 4XNQA 1KBKA 3NTCH 3K6OA 3BUBA 3GBML 3HE6C 3MACL 3VXTB 3WIFB 4NUQA 4WI7A 1E3FA 5DK3A 3VFPB 2NQCA 2W60A 5SX4I 4HWBA 4PJAB 3CZFA 5TE4H 1LO2L 5GGVL 4HFWA 5H37G 2ZOTA 4JHUA 3X3GH 4G72B 1UWEH 1FPTL 2V7NA 2G30A 1B88A 4PLOB 3OKKB 1D5RA 4BZ2H 5D1ZB 1UCBL 3MCKB 3UYPB 4XVUD 4ZAKC 4KK5D 4RGNC 2Q6WA 3COOA 2C9SA 1MLCA 2JKIS 1E0OB 1KIQA 2XC8A 4PPTA 3R7RA 4OZFB 3P4LA 2CHXA 5I18L 1EBAA 3EJTA 5HVGB 2VABA 4M1DH 3FLFA 3DI2B 4JZNB 5BZWB 5JIHA 3AMLA 5E4AA 4MA1C 3DV4A 1AQMA 2W9DL 2ZXWB 3C9NA 3U0WH 1IX2A 1T0OA 3LKPB 4ESKA 1FSKC 4MNQD 1HXMA 1UD4A 2APFA 3KPQB 5BUPA 4GP8B 4P04A 4AMXA 3HBGA 5F3BB 4G9FD 4UINH 1Y3GE 2JELH 5IV2A 2BFVH 3NUKA 2EVGA 1DVXA 1DQKA 1CXLA 4RMTA 5HVHC 1CMOA 5I9QB 4OLUL 1TPXB 4KROB 1C1EH 2EDFA 4F93B 3C6SA 4LCYB 5JHDD 1Z9LA 2XX0A 1FFOB 2FLBT 2JCCF 3FO2A 2NTFA 4GSRA 4TPRL 5C92A 4Y4KC 3PL6B 2EDYA 3ROOB 3V5KB 2ZNXA 3POCA 1C7SA 4JFDB 4Y1AD 5L2JA 1QFWM 1RZKH 1JV2B 3RWCA 3VFUA 2G9HB 3ZMNA 2VXQA 3HZMB 3X1FA 3GSRB 3UACA 3K71A 4JKPH 4NENB 3BZDA 2UUDK 3NQIA 3ATDA 3RIFK 3TO4B 1FIGH 2YC1A 3VSTA 2L7EA 5FXNA 2XZAL 2BHYA 4LGPB 3QDAA 2MEJB 2AV1A 2YPKB 3LTVA 2CBPA 4P2QA 2X6VA 4JFOB 1CDUA 4E9QA 1N5YL 5FA3B 4J3OF 4HDIB 2ICCA 4PJIA 3KH3A 4U1GC 2ISDA 4E0RB 3PHSA 4HV8B 4PG2A 3ZL4H 1NBVH 3TWCL 4HMDA 2AERT 1HHIA 1GKEA 1K5WA 1OCWL 2VDOH 4CC0A 2NNCA 1JV2A 4HP5A 4I0CC 1T7XA 2QV2A 4M56A 4JZJB 2I9LA 2WB7A 1S8DA 3P0VL 4JFWA 3TWYA 4JG1H 2YKLL 2CM5A 1IUZA 4B5EA 3HR6A 4Z7WB 2XFXA 2DF3A 4G3YH 5DFVD 4HEMA 1ZHBA 1A7QL 4MKTA 4JM2C 4NI6A 3RPKA 3GRBA 2Y7NA 3HS0A 2HX7A 4PP2B 3ZDZF 3BLBA 1NMCB 1J5CA 3F8UB 2WM0A 5DFTA 3NJGA 1FJUA 1A6VH 1XZWA 5EO9A 2XN9D 1EHAA 1O7DE 1PCSA 4MJIE 5A2LH 3U4EA 1N10A 3PNWA 3IN2A 1BWMA 4ZSOA 2GJ6E 3BSZL 5GGSY 3K46A 1KCVH 2HTLD 3QJZA 4QRTB 5I73C 3IMUA 3ZLQC 4FXLA 4JO2H 1RJCA 3T0DA 3CQFA 4XN8A 3UTZB 4J12A 5I0XA 5FSSA 5F7EH 5L4JA 5EU5A 4NBXB 4Y19D 4D8PB 2UXGA 1WEJH 3CDZB 3PREA 4AJ0A 3BN9D 2AC0A 3U48A 1XGQA 2C1PA 5LNEA 4ZW5A 3MNWA 4JFFE 4EN3A 5BV7H 3HE7C 4UQ9A 4ZZKA 3IWVA 1A6UL 4MCZA 2YUXA 1Z6JT 2AFNA 2VMEA 3NZHL 5IB2A 4PTUB 4ZUSA 4GQ9L 1BVKA 4GEIA 4A63A 4AQAB 5DS1A 4H20L 1RLBA 2R4SH 2HH0H 1T2JA 2HYMA 1K6QH 3GXMA 1NQBA 1CDYA 2PPCA 3NOIA 5EOTB 1VKXA 4PJGB 4R5VA 5FO9B 3CFUA 3FF8A 1A14L 3EBIA 2ZOKA 4YEFA 4UT7L 1XWVA 1H6FA 3FO0L 5IEHA 3JT2A 1UACH 1RIUL 1TVDA 2Z35A 4KNTA 3EO1A 4AE0A 3H1ZA 1L6ZA 4HGMA 3OWEA 2GTZB 3MX0A 4RA3A 4BFKA 2BXYA 4Y4FD 3EIFA 4FQIH 1AY1H 4G8EB 2FBOJ 3CX5J 3V0FA 3MV9B 4AQAA 3MMEB 3TBWB 2J8HA 3MDJA 1QSEE 3C08H 3D87B 1AANA 5EBLB 3ARED 3SE9H 4A6YB 3IBEA 4M7LT 4L1TA 2A38A 2N7BA 3LPOA 4FADA 3PWLA 2IXQB 3M86A 4FNLL 3F7KA 3GMMA 3ILPB 3FCTB 3PWNB 1NCOA 1U93A 2AI0H 4QRPD 2I5YL 3EIMA 2UXVA 2WN2A 1U8JA 1HVXA 1RJLB 2Z6FA 1Z5HA 4UOW0 3U0PB 4G7SB 1J8HE 1J18A 4JKLA 2WUBL 4QRRE 1G7PB 2HT2C 2GSMB 3G5YA 1YCSA 1PY9A 3GGWB 3TF7C 1E2ZA 4IJ3C 4G8EA 1J0JA 1NJ9A 4KPHL 3BZEB 2OMNA 1IGFL 5TGBA 5I5JA 3HPLB 1D7FA 5BQ7B 2L3BA 1UUSA 3KLDA 5D7LD 4BFGA 2FUTA 3QNXB 5TDPB 3PWNA 4Z7VE 4JQVA 4XO4A 4NZ8A 1M9SA 1P5UB 3MLXH 3N9GL 1Q1JH 1EFXB 2YJQA 3IFNH 4OF5A 2ETWA 2VLKE 1WG3A 3JWNH 2AMUA 3W38A 1IC7H 4YN3A 1IE4A 1OP9A 2OZ4H 1XIWD 2Z91B 1QEWA 5FYKD 1JPST 4X8XA 2IBGA 5E2JA 3GGWA 1Q0YL 2SEBA 2VLME 2VQUA 3E2HB 4M8QB 2UZXB 3REVA 3L48A 2FR4B 5DO2C 1CD9B 1EQWA 1FQ9C 3ESVF 3VXSB 3UJIH 5LGKA 5BUAA 3QGOA 2AANA 1F4AA 4TUKL 3VYOA 5K39B 3WO4C 1NBQA 3U0TB 5E2TH 4JQXA 1TQBC 4XHQA 3DGDA 4WK2B 4F58L 3QK0A 1TTAA 1TNNA 4B5ZA 3NDYE 5B4MD 3O3AB 5JUEH 1TZGL 2YQBA 3FO1A 3K6NA 4HWZB 5E1AB 2QL1A 1EFXA 2FECL 1YEKL 3MPCA 5KBLA 5BS0E 4BFEA 2I9TB 1NFDB 4FABL 4WO4D 6PAZA 2ITDA 1ET7A 1RUPL 1GL4B 4PWKA 1N6QH 4ZJ9A 2YAHA 4PRPD 5F1OB 4LL9A 2DN7A 2BVTA 1L9OA 1U41A 1JUFB 1U8LB 2VDNL 3MRHB 1IGTA 4WSKA 1LGVA 1RMFL 1MF2L 2YEVB 3VGAB 4XTRD 1NAKH 3DROB 3NCJL 2CPCA 5FUZL 3KDPB 3KS0H 4GY4A 4NQCE 3QEUB 2DL9A 4F1ZA 3IJ7A 3I9GH 5IW3A 2XY2A 2DW5A 1K2DB 5KYUA 2NDFA 4JDTH 2OSLA 3MOBH 4V1DB 1XH3A 3OF6A 1ASOA 5DO8A 1DANU 4K9EL 4MTMA 2H0EA 3WI9A 1WPCA 2GFBB 1QWNA 3T1WA 1RH8A 4XMLH 5AYQA 3NJKA 1T2QH 3NDZE 3QDMB 4M48H 2B4CH 4P5MB 4DGYH 4EBQL 3IDJA 4WFED 4L1LA 5DMIL 3BXNB 3VJ6B 3WYRA 1M6UA 2VDLB 3P4MA 1Z3GH 5J1AA 1TO5A 3QUXA 2HFFB 3LZOA 1SLXA 2BOLA 2YQGA 5FF6B 1BWWA 1TTRA 2BP3A 1FFTB 3AM8C 3I02B 4FFWD 4H1LB 3A24A 3A5VA 3AABA 1MAMH 3BEVA 3GDCA 4PWGA 3BH9A 3LJ3A 2G0KA 2C3GA 3AG3B 3N50A 4Y0GA 2X42A 3HPJA 3QZMA 1KTRL 4J3OD 4U1KB 5L4FA 5L9DH 4KUZL 3QH3B 4KNSA 32C2B 2ED7A 4DVBB 3I74A 4QOKA 2V9UA 3E8UL 3DPBB 4Z7WF 4LHUG 5AB0A 4G7QB 4LMQI 1OAZL 4U0RB 3TVMD 2VLRE 4KAQL 5KYXB 5DMKA 2V2TB 3GLAA 2NYKA 3ULVH 3QIWB 5KG9B 4FHBD 2ZJSL 2GITA 3BXNA 3LMJH 4DKDC 1VA9A 4F2FA 1KTOA 5I28A 4YFDB 5IROC 5FA4B 4OZIA 3LPPA 1U92B 4R8WH 5DD0H 5ITFA 1CK0H 1RZJC 4TTDC 1A5FL 3BH8A 2OYLA 4BK8A 5I6XB 5JDSB 4D9RE 5T3ZL 1LE9B 5KSUB 2APXA 5EU4A 3LHPH 3MRBA 3II2A 3QUKB 3KPRD 1ZLVH 3GJFB 1NCCL 3IFLH 4M7JL 4HCRA 1KIUA 2F74A 3QEHA 2YEZA 5BQDA 1D5BA 4YGAB 1BFTA 4EOWL 2FIKB 3GMLB 4BXVA 3O2DL 1S7TB 4X6CB 4J8RA 5C0IB 1M4KA 1DTUA 4YK4B 1R3LA 3RWHA 4UTCA 3MRFA 1J05A 3WJMB 2DJ4A 1TQSA 4NP9A 2GT9A 2OMYA 3EJUA 1M05A 4P2OA 3RNKB 1QG3A 1UD6A 4MBOA 5FA4A 3PWUB 3RPIA 5J6HA 4MAYC 4WW1B 5JPMB 4N8UA 3CHXA 1JSYA 3VI3B 3THMH 4U0QB 1BM3L 3KXFD 4BQ6A 3VFMB 1LTXA 1BZQK 3ULUL 4ZX3A 3LEYL 3UJJH 3MROA 3RGVD 3T0AA 4HWUA 5AKVA 5KS9A 4OZIB 1I9JL 5I2IB 1HC1A 3WD5H 1YEJH 1IM3D 5JW4N 3X12B 1F6LL 2NY1B 1FN4B 3MUGA 2QV4A 3BN3B 2H32B 5F3FA 4YBLB 2BVQA 4XAKE 2CIKB 3ARDB 1SN2A 1ZE3C 3VXUD 4G6AD 4PRBB 2DJMA 2MCPH 1DVSA 2Y5TB 3P2DA 3E6FB 5TE6L 4XVOA 5CUSL 1EWHA 2AZAA 2ZYSA 4FKHA 1IM9D 1XGUA 3FH5A 4CW1A 3NRPA 2Q5BA 3PWUA 3UAEA 1L9QA 1P2CB 5GZOD 4HUUA 1TVHA 1W72A 5IGXH 3NTCL 2JTDA 1WK0A 4LSSH 4ZO9A 3MOAH 5DCCA 5ANME 4NQEE 3SJVE 3VFMA 1LD9A 3L9RB 2VAAA 2QKIA 4X80H 1MCQA 3WXVL 2X1QA 4OD3H 3FHEA 2KQMA 3HBQA 5B1AB 3K4ZA 4FTVE 3KDMB 5TE4L 3LDBB 1O6SB 2Z93B 3ZQ9A 1FNGB 4ZNEE 3X3GL 2ERJB 5E6YA 1X9QA 2RIKA 4DGVH 4NRXA 3MUUA 1J8SA 2QELA 4RGNE 2IAMB 3ET9F 3B9EA 4PJDA 1LO4H 3I9IA 3JTSA 5F6HI 4FLOA 2OCCB 3GLDA 5BRZD 1UKQA 3B9KC 4IRSA 4L4VE 1TETH 1NGPH 4WWNA 4I77H 4CKVX 2ALAA 2R0LH 4D2NA 4XXWC 5HGDA 1MCLA 4N6RA 4M1DL 1H3PH 3AUVA 1X5YA 4R7XA 3I6SA 5K5YA 2HPOA 1EDHA 3JBG7 5HHMD 5ISZA 3U0WL 1NEZG 2AP2A 2XQBH 5JOEA 3ZO0A 5DEGA 4EKJA 1UJ3B 2ED6A 3D5OF 3UIYA 4IBTA 3DX6A 3GUFA 1CE6A 4X9BA 4FFZH 1MI5A 3GSVA 2AK4A 4WKZB 2MRYA 4MZNE 2BFVL 5FYJD 2DDQH 1IEAB 1FI8C 4X9FA 1A66A 2XFGB 5ESQB 2QQKH 1WIOA 4G8IB 1OTUD 2NCMA 2GAZA 1AGEA 5DJ0B 4RRPA 4K5MA 3VI4A 1A1MB 4GSDH 1OWRM 2BP0B 1ZTMA 3BIBX 2NY2B 1W0VA 3BIAX 2FWLB 3PXHA 3NH7H 2F68X 4LDOB 1H9VA 1SN5A 2KQNA 3UPRA 5KBKA 2VDRH 2I27N 1T1XA 2FNWA 3DPDA 1I1YA 3IDIB 4JKPL 5H37A 5KYWA 4M6NH 2PO6C 3CZLA 4PTTA 1FIGL 3M45A 1GZQA 2WVVA 3UYOD 2HG5B 2ENJA 3SGKC 1VERA 2N1KA 1EUUA 4HETA 4M5TA 3JV0A 4NNYB 3AY4C 2E7BA 2O4EA 1QMUA 3OZ9H 2X4NB 3FSVA 4FRWA 1SOSA 1E4WH 2V2XB 4Z7UA 1N4XH 1Q9LA 2JKXA 3WIAA 3NJMA 2Z31A 3ZL4L 4GUCA 1NBVL 4W9KC 4PJFE 3LKRB 4M1CD 1A1MA 1NFDF 3O6LH 2AXFA 4E41A 3BMVA 4G8FB 3Q43A 4NB7A 3K81A 2VDOL 3VRJB 1PMYA 3ETTA 5HHNA 5GRVK 2UX6A 1UADC 1TFHA 1NIFA 2HN7B 5HYFA 5CHNB 1IGCH 4ODSH 5I0YA 5FC9A 2JE8A 2P5WB 3S35X 3O8XD 1VESA 3TT3H 3ABLB 4MNGE 3MRGB 4JG1L 2YAEA 5LGHH 5E2VL 4ES9A 4Y2DD 1QO3A 5AD0B 4JPQA 4FERA 3FZUC 2IOOA 4KROD 1MUJA 4G3YL 2K6ZA 4H0GA 5FYJH 1I1AC 3RX8A 1OAKL 3Q2CA 5E5MB 2KZ1B 1TXKA 3ARSA 1KGYE 3EGXA 3PL6D 4AGMA 2A7BA 3TA3B 3KH4A 4U6YB 4QO1A 5HGAB 4A04A 3U25A 4UILL 1HOEA 2W07B 3T8HA 1A6VL 2W0FB 3PCYA 4LOFA 1BOGA 5MENB 3DETD 1JZ5A 3ZYOA 1DO5A 1G7QA 3I75A 3TIDB 4R0LC 1NCTA 5ANHA 5E51A 3SY6A 5E7BA 1Z3RA 3C60D 4WWPA 4ZW6A 1H0DA 2Y2WA 3MLRL 3A22A 3CAFA 5LXGH 1KCVL 2YMOA 1Z9GE 2OMWB 1QLEB 4DO4A 1A9BB 1PDKB 5M95B 4ODTH 5F7EL 3VSVA 4H8VA 2YQ3A 2IFFH 2IPKA 4R96A 1WEJL 2ICWI 1KYAA 2NZIA 4JGJA 5KZCB 3RP1A 3NSJA 2B0SH 1HE7A 4P2RA 2G75A 1MW3A 5BV7L 3RQ3A 4WWKD 1G1OA 3LIZH 3QNFA 1KIRB 3ETSA 4K15A 4K7FB 8TLIA 3LOWA 1PY0A 1XX9C 2I26N 3KBPA 3UBHA 3FPXA 1E50A 3OXSA 1Z9PA 1ETJA 3QFJA 4JPIB 3O3BB 2MFNA 3MV7B 2EH8H 3CVHB 5BRQA 4KJPC 5GGTL 2F5BH 4ZMOA 1KBPA 3I6KB 4W9FC 5J4MA 2R4SL 1RZGA 3O4OB 4PHXA 2HH0L 3LXUX 1K6QL 4YHLL 2R0ZH 4PJXB 4ICXA 1G1YA 2LW3A 1PDKA 5IF0B 4N2KA 1KT2A 1KELH 4GBXC 4HEPG 1UZ6E 2J5LC 2M83A 3FQ2A 4FYQA 4X6CF 3CHPA 3WS6C 3OAZH 4IS6B 3ENEA 2YBRA 3UBXI 4S11A 3K5SA 1UACL 3FU7A 2R2HA 2AEQL 4Y5XC 4ZFOL 2E46A 1ZLWH 3P7WE 3FSZA 3QEQB 5C0GB 5J06A 3IDXH 4WFFE 1M7DB 2CNZA 4QHUA 5A3IC 3UYRH 4FQIL 1AY1L 4OLXH 4HWNA 1Q9KA 1UFGA 4AVKA 3S5YA 2J6EA 4IU3A 5DUBA 3S48A 1G5GA 3C08L 4Z7NF 2BSRA 4OIIL 1B0GB 1JWUA 3LPFA 3RWJA 1YHPA 2ODIA 3TA4D 3WNOA 4QNPF 4OFYD 1FAIH 5IMOA 2CO6B 5DZAA 4C56B 1K8IA 1RAMA 3TMNE 1D7CA 5HYEA 4W6YB 2AI0L 3OKDB 2J8UF 2EDXA 1HXYA 1IGYB 4KVPA 4KY2A 3VFNB 3QNYA 2HJLB 3MV01 1HZKA 4CBPA 5CJQL 3U7WH 4AR8A 3NIDF 3QNZA 3JV6B 4TOYH 1BAFL 4ZMPA 3NSDA 3DYOA 3G6AA 3V6OE 3V9CA 2FJFB 5LUMA 5D1XA 2YGOA 2RHEA 3WOVA 2CD0A 4XNMA 2ZPKL 3BLPX 2XXGA 1D5ZB 4LLUB 1ETB1 4A7QA 1HIMH 2YPVH 4FFYH 4LFHG 5HJDA 3VYPA 3HB3B 4FD0A 1SYSA 1HEJC 2WINA 3QXWA 4HJIA 1U8KB 4D9WA 2DWTA 1KV3A 4YSPA 2A9CA 2R69A 2DQFB 3MLXL 4XP5H 3ME0A 4XC1H 3IFNL 3NGBC 2BSTA 4KRPD 2Y5EA 2HJLA 4G42B 2BS8A 4Q4EA 2E75C 1IC7L 2NX5B 3KPLA 3ZKNC 4L8CA 3CN1A 1QFWH 3LX9A 2OZ4L 4UT6A 5HI5C 3JWOH 1G0YR 1DQDH 1USZA 3L3GA 2ZSWA 1OZTG 3SGEI 2W94A 3MV9D 2VMJA 4MKMA 5FB8B 2Z8WC 1G6RH 3CBJB 5E1GA 2BVOB 4NWTL 5E2TL 1ES0B 1PBYA 3HG1E 4X4KA 3SDCA 1CTMA 4CVXB 3L3OA 3KLHC 5FLUA 4Q9QH 4KH9A 2PCFA 3FDWA 4PLJC 2WBJC 3CCHA 4HLZG 4RNRA 4EUPB 2AHIA 3L5JA 4GRLB 1WZMA 4L37B 4PBVC 3M8OH 5EF1A 5AAWA 1UT2A 3HN8A 3HZVB 1E30A 3BT2H 4G5AA 2GPZA 4LU5H 5C0EB 1MFNA 1N6QL 4JDZB 4MZRA 4IIZA 3VWJC 5KSBE 3GKZA 3SGDH 1K4DA 2DQDH 4UANA 4Y4HA 1B0IA 1JPGB 1WE5A 3VTTA 1JN6A 1DLFL 3OQRA 3SDAC 1UQSB 2QADD 1NAKL 4LCCA 4NPYB 1MELA 3G6JA 3MUY1 2A7GE 1ETZA 4J4PA 4RLDA 3I9GL 1NDMB 2K7PA 3UTTE 1TYRA 4HIXL 2AMGA 4JDTL 3L9BA 3FOMA 3H7BA 4ELMB 1LO3H 3MN8A 4GW1A 1I7UA 5F9JA 1EEYB 4K9EC 4YLBA 1BAWA 1O9VA 1YEIH 3KJ4C 4D94A 4XMLL 3LN5A 4DTGL 4XCEB 2DB8A 4MB1A 4H88H 3RY6C 1T2QL 4M48L 5C08B 2B4CL 1M2VA 2R1XB 4DGYL 4QRAA 1G84A 2DMCA 3HI1A 3MSFA 4C58B 1P9MA 3GRGA 3MLUH 3ZSTA 5IFJB 2ARWA 1Z3GL 5E8PB 1JXDA 5FYKL 3FNKA 5HPMA 3KPSA 1FZKA 4GB9A 3CZKA 2HFGH 4WW2F 5I1LA 3W9EB 2ZP9A 4YHOH 1I8IB 2VITB 2NXYD 5FOJA 4FL4C 3EJJX 4H40A 1MAML 3WS3A 4LSDA 4UOW1 1NDMA 4Z0XB 5KJ7E 1YNLH 5L9DL 4YDVB 1SVZA 2K8MA 4UCFA 2YXVA 1XSKA 3WLBB 3WIHH 4R7DA 3PF2A 1MRFH 4FJ6A 1PY4A 1F00I 3UAFA 2HTKD 1TMNE 4DH2A 3VXOB 3CPLB 4OVUA 1GTNA 3BUYA 3V0JA 3EGSA 3LMJL 4EDXB 4ZYKA 4QCIA 4R8WL 5DD0L 3T2NH 4MMXB 3KPTA 1CFVH 4Y2LA 3GUTA 1EXHA 4S1DC 1I3VA 2GG1A 2XZCH 5DK0A 3MNZA 1BQ5A 4FG6C 4M29A 3LHPL 3HJEA 3UZQA 4O58H 1JWMA 4Y1SA 4FQXB 1ZEAH 3KHOA 2W65A 5L0QC 5LGYA 1EAOA 5FV2A 2X6MA 5JHAA 1FYTE 2KDGA 4LQFH 1O9ZA 2A4CA 2VJXA 3EYQD 3Q0HA 4YSOA 4UDUB 3QDMD 3DRTB 1VZGA 3C6EA 4YZFE 2XLLA 3U1SH 2AJZA 3ZL2A 4PB0H 4ZTOH 4ZO8A 4Y1TA 1QBLH 4LL1A 3K4DA 4CJ1A 2W92A 1PNDA 1QNIA 2AJUH 2X0UA 4A67A 3P0YH 4FFVD 2CMRH 5JPNA 3LXBA 4P5TB 4KXAA 1EVUA 3UJJL 3OHXC 3ULUC 2P46B 2VJ0A 3HEIB 5EBWB 1A3LH 3WD5L 1YEJL 3S8FB 1BBJA 4N2AA 5EUOF 4CVZA 2H41A 1T22A 2H6PB 1R33A 3PRZA 1FVDA 4XBGB 3DO7A 3EOYG 4HGWA 4PJHA 4P9MH 3MNDA 1SOQA 1SFDA 5DJCB 2MCPL 3TO2A 2E9JA 4PS4H 1TQTA 2VZUA 3ZDYE 3QIWD 4N5ED 5DJDB 4MQTB 1UWFA 4NZUH 4KWUA 2V8MA 3W11C 2KL6A 4LSVH 3GJFK 1NC2A 1VZIA 4IBLT 4PY8J 3BEWB 5IGXL 1KCSH 2GI0A 3BVNA 5AALA 5DURB 3KD4A 1JRHH 3MOAL 4LSSL 1THLA 3OKNA 3DX2A 4JN2A 1K5NA 5H94A 4X80L 4UM8A 4OD3L 5C0FA 1WC7A 4N90E 5C2BH 1AE6H 1RSFA 4P3DB 2R7EA 3OX8A 4P23A 2VC2B 1ZS8B 3U2JA 2J72A 4QGYA 3SYOA 3ARUA 4DP4X 2YZ1A 3NSXA 4DGVL 4MCYB 3E7JA 4GT0A 3GS4A 1KTJA 5D6CA 3U2IA 4HKBA 2CGRH 1TZOA 4U1MB 2WZAA 1KB5A 4U31A 5GS1C 2GI7A 4NT6A 3B8SA 1HYRC 1NGPL 3LZLA 4I77L 1PFOA 2R0LL 1G7IB 4I0PA 1E5AA 5I15H 2HKHH 1INDH 1H3PL 1NGQH 4PY7B 1XSJA 2BMKA 2CIIA 1KB9K 1HCFX 1QACA 1ZHLA 3VFRA 2XQBL 2CCVA 3C5ZB 1PE8A 4X6EB 4IBSA 3MSNA 4HH9B 2EE3A 3SKNB 3B2VH 3SPIA 4NZDA 5JOFA 1M2OA 1N8ZB 4FFZL 1VGKB 3HRZC 4MCYA 2EADA 3IJYB 5IB4B 4Y5YA 3PV6B 2DDQL 2FLRT 3PHOA 1ZA3B 4ZD3H 3N1GC 2VLJA 3QORA 1SM3L 2H1LM 4L0PB 5EU6E 5FUOH 3KGSA 1G7IA 1DL7H 2XIIA 2IWEA 4GSDL 2CDGB 3FL7A 4NS0A 2ITEA 2X4QA 5E8DH 1XR8B 2EYTB 2D7NA 3NH7L 1WFIA 4Q9CA 1A6AB 5C0DA 3IFPA 1QSVA 3LEXB 5FO7B 5DZNA 3WFHB 4AEHH 4DKAA 1U91B 2DJSA 2VDRL 1J10A 1YJDH 5FK9A 3RDTB 2FECI 2VWEC 3N2JA 3NSYA 4M9OA 1G5AA 4M6NL 4PGBA 3SKNA 4CJ0A 2DQTH 1J87A 1OT4A 1BD2D 4WCYH 1A64A 3QG7H 5C6WH 1LDSA 1KG0B 1BVNT 3II1A 2FSEA 3MRRB 4PRHD 2CJUH 4K89A 2IAMD 3T0BA 1HHGA 5HJGA 1H8NA 1E4WL 4KDVA 4XVUC 2PR9A 2VZ1A 3VXME 4KK5C 3DJTA 3O6LL 2OLDA 4F8LA 2CA4A 1BX2B 2EE6A 2EYTA 1S7WB 3K1DA 4OZGE 3T4AC 2WMPB 2HMIC 1AAJA 1KC5H 3QUZC 1TJHH 1WGOA 3DBSA 1CVSC 1NEZA 4AKQA 1IGCL 4B27A 3CXDH 5IVOA 3TT3L 4JGUA 4HZLB 3GM0A 2JKRM 3GB7B 1MQKL 4DZ8B 3IDNB 4PV8A 2CK2A 3GBEA 3WGUB 5LGHL 1XBDA 3EKCA 5HD8D 1P69B 5INDA 4L1SA 1ZPUA 1DHKA 1LP9F 5IESH 5IMKB 4ELMF 5CD3A 1QRNA 2UY6A 4W9ZA 4OQ1A 5FYJL 3DSFH 2WXOA 1JXJA 2O72A 1GIGH 1RHHB 1DSWA 4F20A 1R5IB 1UB6B 4HUMB 4JLRB 5ADOH 1JZHA 1KPRA 5DQDH 4W9CC 3S35H 4HCGA 4YVNA 3AFLA 3IDMB 4ZRGA 1FO0A 1AHWC 3GNMH 4F5CE 2A1WL 3QO0A 3FUIA 1PL3A 5FW6A 1J9CT 1QA9A 4G8GE 1CGUA 2WOYA 4JE0A 4UQEA 3MRMA 3O2VH 4HKZB 1CG9B 1TYEB 2LABA 3L9EA 4KZCA 2YSSA 5DQJA 4XZ4A 5JXAH 2YD4A 1XGYH 3CIQA 5GZNA 3VRLE 1XSOA 2P45B 2B16A 3FMGH 2G5UA 4POZD 1TYJA 2DMBA 4Z3TA 1GC1H 3CFJB 4ODTL 1MOEA 3FN9A 5CMAB 4XP4H 4JY6B 3D39E 5BVJB 2C7UB 4ISVA 4NM8L 2IFFL 5C0CA 2G9KA 3ROLA 5DU7A 2OAAA 1RI8A 3QC6X 1A6WH 1XF3A 2MPAH 5IQNA 5KVGH 1DJHA 3K0WA 2B0SL 3WEMA 2A9AA 5HYJA 1AD0B 5BV7C 1WAAE 3DBXB 2EDQA 4MJIB 3ZR5A 2WTPA 1SDAB 3AWGA 3VA6A 2QGBA 4HKZA 4P5KA 1CIDA 2GJ6B 3BZ4B 5D71H 2EH8L 4UM9B 3GRWH 2F5BL 2WBWB 1OWWA 3FQXA 1XF1A 1ZMYA 4RIRA 3HI6H 4TN9A 4TSBH 3M7FB 3RFZB 1KULA 4LEOB 4UIMA 3QXUA 1HFUA 2R0ZL 4WLCA 2AXGA 2E74C 3DHMA 1W9XA 4D9QE 4U6HA 1KELL 2E27H 4X7DC 1OGPA 4FA7B 2CWRA 2CNYA 3V4VB 2BS71 4JFFB 2F7IA 3TA3D 1G6VK 4FNQA 5DFVC 4F57L 4M65A 1UOVA 1NBYB 2GTWA 4RMSA 1R46A 3GJEA 4JANA 3JSSA 1UXWB 2DIBA 1FJ3A 2FB4H 3ZW3A 3UYRL 1CD0A 4OLXL 1H5BC 3G04A 4Q6KA 4RX4A 5K9JH 1ZTXH 5I66A 3LXCA 1WA2X 4YHZH 3TASA 1CFBA 1RK7A 3E9TA 2TLXA 1KYDA 4H26A 4W9LC 3GFUA 4WI8A 1MWOA 1U3HD 5DTFB 2APWA 3CFTA 5I5RA 1FAIL 5D70H 2HTLC 3TCLB 4FJYA 4JZOB 3EYFA 4NKOB 4WY7L 2A6DB 3ARPA 3ARFA 2IANA 1N64H 3ZJAA 5L88H 5C07E 1L3WA 7FABL 3DJSA 3UXFA 1NBYA 3BZFA 3U7WL 4E68A 4ZNCD 2AAAA 4TOYL 1JK8A 4PGEB 1YEDB 3BN9C 3L7FB 1WVZA 4G1MA 5AOKA 4L3CB 1ZGLA 5E08L 3KVDD 3SKJL 2ZD0A 3O11A 1AS7A 1QSEB 5IHWA 4HUCA 3LCYA 4A2MA 4LCWE 2WKOA 1CIUA 2WSDA 2WXGA 4WJKB 2YARA 3B37A 3VMNA 2F8IA 4B97A 4C47A 1HIML 5C97A 2QGDA 4FFYL 2IAAC 1HSBA 2LVEA 1O75A 1TQWA 1TSRA 3H9SE 2NZ1A 4YIQB 3ILDA 3GMNA 5CWSB 4H0IA 3GI9H 5TF1H 3QDGD 2A6DA 4XP5L 5BZDA 1X5XA 2W9LA 1L3FE 1FFQA 2D73A 3O45B 3WFZA 1TLIA 1ZJBA 2FGWH 5AVWB 3S36H 5IWLC 3LB6D 1VZHA 1J8HB 3JWNC 4QRRB 2NUTB 2VR7A 3UTSE 1QFWL 4IRJC 1ESPA 3ZKXB 1X5AA 4P4KB 3ILQD 1YEDA 4KKBD 3JWOL 5KVFH 4N4EE 1DQDL 2WQRA 4MD4B 1R5WA 5DFAA 4FQHA 3GHEL 2CAKA 5B38B 1K8DA 1YDPA 3M07A 3IVKB 1QD0A 4L8BB 1QFUH 4ZUVB 1DCLA 3G9AB 1AGFA 4G83A 4XPFH 2WZPA 3SBWC 4Z7VB 4DN3H 4C56D 2PXYD 2D0FA 1BVLA 2XWJB 5AW7B 2AKRB 3AREC 2D7TH 4HALA 3KBHE 2R23A 4Q9QL 4IIQB 5D1QE 2VLKB 5C3LD 4FMVA 1FL5A 4PRIA 3TFKD 5HHXH 3KWXA 3T0EA 2CHNA 4R4FH 4YGVB 3M8OL 5JO5B 1ZLSH 1F41A 4WAFA 3MFFA 3BT2L 1MCNA 1GZPA 4LU5L 3VXRE 2W38A 2D4FA 2XX1A 3T8XB 4LQ1A 1NA8A 5AZ2H 5I6MA 4J2XA 1R17A 2DQDL 1Q72L 1UWGH 1WFUA 2FQFA 2BNRD 4C4KO 4PJ7E 3MJ9A 3RNQA 5I6KA 3QXDA 1ZT4A 3G6DH 3TPUA 1KJ2H 1CD8A 2E6JA 4TQEH 1ZHKB 2XNAA 1MNNA 1FV1A 1ZA6B 5D9SB 3KR3L 3N85H 1BZDA 4WSGA 3MRQB 1LO3L 1HHJB 2Q7YA 2ZUQC 4X6FA 4N28A 3VQ2C 5BS0B 2K4AA 2VUOA 3O9WB 2NX5D 1YEIL 1KYUA 1QRKA 4Y9GA 3WJLC 1JYVA 1UD3A 1XQ4A 4LARH 3WY4A 3TL5A 5JW5B 4LLQB 2B4CC 3IAGC 4UTAA 4LVNB 4ZMYA 4CMHB 2O61A 2GSGA 4MSWB 1XIWC 2OCFD 4Q52A 5F9OH 5I71B 4OCYH 1NCHA 3BPNB 3G5VA 2HFGL 4NQCB 3RWFB 1R47A 2NY3D 2OMTB 5IM7B 3GINA 4YHOL 1PD1A 1Z9SB 1UUNA 4A6YL 4M5ZH 3EYOA 1UXSA 2QMKA 1ZA6A 4KZEH 3MTRA 1YMHB 1JF1A 1X5FA 3TBVB 2YIHA 2YAPA 1UYWL 5K9OA 5L2KE 5B4MC 4GRLD 4OGYH 1J5DA 1T20B 1H9DA 4XNZB 1ZDPE 4DF9A 4HJEA 4AUUA 4MS8C 3O2WL 4F7EA 2Q86B 1DJYA 3S37L 1NWPA 2ZYRA 2CKBB 3TFBA 3PU7A 2AK1H 5AOZA 2MCG1 4WO4C 3EFFB 1BYOA 4IGBA 4L0ZA 3RTLA 4F7CA 4F33A 3ZKSD 2A4EA 3T2NL 1CFVL 3BE1H 4EZMA 5EPMB 2XZCL 4DPCX 4U3SA 3A3YB 4NUJA 4WQOA 5CSBA 5T3ZE 3V10A 1RJYB 2JB6B 2J44A 4YR6A 4FQCH 4O58L 4QWWD 3VGBA 3O3DB 3WBDA 3MXWH 3GXNA 4XTRC 2Y07H 3D0LA 3AW5A 5ACZB 3PY9A 1QEXA 3GSNA 2QZ5A 4NBZB 1ZEAL 3K8KA 4ORZC 4B7LA 4PR5A 3LNGA 3N40P 4HWEH 4UAHA 5D5ME 2VLRB 2DLIA 1CQKA 4DPRA 3ARRA 3AXLB 4LQFL 5CLZA 1NTDA 1DQJB 5EO1B 1WHPA 2B39A 5C08D 1E4JA 1O9WA 3FU0A 3U1SL 3D7PA 3V0EA 3ZT6A 2FQGA 3NIFE 4DQOH 4ZTOL 3TYFB 1QBLL 2C3XA 4HMCA 4NO5B 2X3BA 4HJ1A 4FULA 2AJUL 2G4EA 5E6RB 4XPBL 4MMZC 5DLMH 3P0YL 2CMRL 4AK2A 3ZIMA 4B9IA 5K9QI 4W9GC 3PP4L 1UXMA 3ULUE 3CIAA 3J2PA 1D6EA 1A3LL 1WTLA 4FFWC 3GSXA 2WXRA 3IJ8A 1OSZA 3ECBB 4PJCE 43C9A 2QMJA 3QEGH 1D9KA 5T1MB 2KDYA 2YLKA 1AS6A 7PCYA 4RZKA 5DHVA 1ZIBA 2CR3A 4MB5A 4EI5D 2Y1VA 2OP4L 5IB5A 4KK8D 1KB9J 4LIQE 5GRUH 2PW2A 2GIMA 3PWPA 4D8OA 5EIQA 4DUXA 4GRWE 1U3YA 3TVMC 1MH5B 3UAJD 4ANXA 4LSVL 1F42A 4AL8H 5GGRB 3LQMA 4AQ1C 1KCSL 5E6ID 1QUPA 5AQ0A 2W0PA 4EIUA 1ADWA 5BNXD 1JRHL 3BGMB 4Q89A 1N59A 4HPHA 1SDDB 4U49A 2NR6A 4RMQA 1ZCRA 4DCQB 4HGKC 1RIVL 5C2BL 1AKJA 1AE6L 1VAHA 1WBYB 1K9TA 4LCUB 4PGZA 3ECBA 3AG4B 2GCYA 4Z7IA 3TJEH 4IHOB 1EMTH 1S7SA 4ZOBA 1X3DA 2R2CA 1XGPB 3KBFA 3CG8A 5LCVA 1YN6B 4XO8A 1SFHA 4FYTA 3Q01A 2HT4C 2OR9H 1GGBL 1KENH 4D0CA 3TJHD 2OK0H 3TTYA 3C6LA 2V0AA 1QSFE 5F7UA 5C0AD 4XZUB 1H3VA 5ANMB 3HE6B 2K4WA 2VDLL 4MAZA 5E9DD 4NQEB 3SJVB 4Y88A 1INDL 1NGQL 1FORH 3FXIC 2PYFA 4FTVB 4XWGH 1JP5A 4O2CB 1BQRA 1ONQB 3REWB 4XO3A 4RDBA 8FABB 3CC1A 3S5LG 3BWAB 3RGVC 1YEEH 3FN0H 3TBTA 4JJOA 1M6OA 4Z95L 3ZXAC 1FZOB 4F2ME 3P02A 4MJ5B 1OOAA 1LQBC 1SJHA 4ZAKB 1DBAL 1ORQB 4RGNB 4I18A 4R26H 3PIQB 4ZD3L 1U4GA 1Q94A 4LDEB 1HQ4A 4L4VB 4L8DA 1E3XA 2PTTA 4UU9B 4GIAA 4NQDE 2EIZA 5E6SB 1FFNB 1E27A 5FUOL 5HI3D 2B7DT 2YXWA 5JORB 5AOIA 3FC8A 3CFMA 4R5XA 1DSFH 3F6LA 5DURD 2JCWA 3HFMH 4N8VB 4MA1B 2HVBA 5E8DL 1HK6A 5GZOC 3TESA 4KVNH 1FSKB 4JRYA 4TS6A 1ONQA 4JFPA 5T5FA 4OFDA 4AEHL 1B2WH 1FH2A 2OMZB 2XWBA 1CLYH 5KOVC 4HT1L 3L2MA 3CZGA 2X70B 1R75A 2R0WH 2DQTL 1SYVB 2A77H 5EG6C 4WCYL 3QG7L 1L5GA 5HVHB 3QXVA 4Z7VF 1FCGA 1ORQA 2J55A 2VZOA 3HOGA 4G80B 4WNSA 5CIPH 5E6ZA 3RVUD 4YXKH 2CJUL 3MBED 3PIQA 5EO0B 2WQ8A 3HR5A 2JVUA 2NNFA 5DRXB 3SY0B 1XMWA 5LXVA 4BELD 4JAMB 4Y4KB 5ES4B 3QR0A 3FORA 1MWAA 3S3PA 4BE6A 5BXFB 3LZNA 3ULSA 5DVMA 3O81A 2IOIA 1U2CA 1XTMA 1HTYA 5CCKL 1HX0A 1YECH 1I9EA 2V8LA 3Q2WA 1GGCH 2FT6A 1KC5L 4QHMA 1TJHL 1RUKH 4UQ3B 4EZLA 1OW0A 3C5ZD 2HVJA 5E70A 3CXDL 1H15B 1S46A 4NBYB 1CDGA 2EDDA 5AOJA 3L5IA 3CSGA 1DANT 4R3SA 1AIFA 1ZK9A 3KYKH 3WU1A 1VEMA 1S7XA 3KWWB 4KJQD 2FHBA 5CBEA 1F1AA 2XI9A 4IBUA 4U1GB 1I31A 1G9EA 2BLFA 1A7PH 4MA3A 3BP7B 4PJFB 3F7LA 1GIGL 4NQXA 4Y4KA 1TLKA 4MWFB 1KTCA 1AC6A 4Z77B 4JQIH 4OB5L 1SEQL 3LRHA 4HH8A 4L2LA 2AV7B 5DQDL 1SJEA 1OTUC 1CXIA 4P4RA 5JHDE 5T1DH 3B5GA 2Q3XA 2MQ0A 3KPPA 4FLSA 4EVNB 2Y2TA 3GNML 3JUYA 2WJ7A 1G7HA 3DOHA 4MNGB 1HEZB 3O2VL 1OLZA 3AU1B 2AEPH 2DM3A 5F89B 2CDEB 2MCMA 2R2EA 4R4BA 5GRZA 2Z1KA 1UM5H 4XXCC 3OJ2C 2H7WA 2FIRT 1XGYL 1HXKA 3PDDA 2NNAB 3FMGL 3KWWA 5ICUA 3BDYH 1J1OL 3PWVB 3QJFB 1NWOA 4JM2B 3NAAH 1GC1L 3VFWB 2BINA 4XP4L 3WN5A 1MCRA 1F11B 2P7TA 1KNOA 2QGEA 4P5SA 4ETQB 5F6IC 2XYBA 4HJGA 2IGFH 1CXHA 1A6WL 4A7UA 2F1EA 5KVGL 5MEPA 3C5SA 3S88L 4PCKA 1KFAH 2A9NH 1F3DH 5EV7A 2MCAA 4F91B 4MNHA 4M1CC 3ECVA 1AP2B 1DLHB 1S7UA 2VM4A 2W81C 3N06B 3QB7C 4HSAC 1NCUA 5C9JA 2CGZA 2WWOA 3A4FA 4PRAA 5I73B 4QPEA 4M61B 2WLIA 3GRWL 6CGTA 1RZPA 3H3PH 3HI6L 3GPEA 5KSVA 2WXQA 3TNNB 2ODHA 1FL6B 1ORSB 3O8XC 4N0FB 4RCAA 1J11A 2BSDA 2Y3NA 3RBSA 2E27L 4Y2DC 4FYSA 4J6RH 1JXKA 5D6DA 2ZWYA 3IJEA 4PG9B 3ZL1A 5CEXB 4KROC 1OGTA 3HE7B 1NGXB 1M7IA 4P3WA 3T8VA 3ZTCC 3D1MC 4JKKA 5AW4B 1GYWA 5I17A 3P11H 3TOPA 3PL6C 3DX1A 3MRPB 3T2HE 1J0ZA 2FB4L 3HUJE 2FX9L 4GH7B 1BZEA 1B0RA 1T04B 1YPZE 1LNCE 5D7IA 2ENQA 4IHQA 2GW5A 2D3NA 5K9JL 1ZTXL 3WJJC 3BKMH 2P48B 1E5YA 3GSWB 3MGTB 3QVAA 4M62H 4E42B 4TVPH 3Q8FA 4NQSA 3K91A 4X6BA 3DVIA 3C60C 4MLSA 1JE6A 2QPEB 2N4IA 5EORH 1NFIA 4UQBA 2XZQH 2K3HA 5C0BE 4AYEC 4J3WA 4LPCA 4P46D 1L7IL 1QI5A 3FS9A 3R06B 3MRJB 5E0QA 4E9SA 5L88L 2YD2A 3KJ6H 4BKLB 1XCWA 3IF1A 3QUYD 2C4FU 3TM6A 1CLOH 1A7NH 3WELA 1CICA 1SEBB 4YE0A 4TL5A 4WWKC 1GOFA 2GJ6D 4UM9D 1RPKA 3K2IA 3FONA 4JZJC 3N41F 1N3NB 5DSCB 1KLGA 1NKRA 1SDYA 1YVLA 1ZLEA 3DOSB 3OXRA 5F72S 1MAJA 1XEUA 5IB1A 4ZFFA 1N8OE 3PDOA 3DIFA 2ZTBA 1A7OL 3ZOAA 3LKQB 4B7IA 2PPFA 2XZZA 3GI9L 5TF1L 3CH1B 1MVYA 2CLRA 1AGCB 4GW4A 4JFFD 5ALBH 4F8NA 3FB6A 2FGWL 5LWYH 4PFEA 3S36L 2VRAA 1A6ZB 3KYMA 3JWNE 3IPFA 1U8IA 4X7CC 1IAOB 3MUZ1 3F12A 1F58H 4RDQG 2RJMA 5KVFL 4KRMB 4BGLA 1JGDA 2A6IB 3JWOC 3WE6B 3IRZA 5GS0D 3NRQA 2Y3AA 3OJDA 2WSPA 5TDNB 2DYPB 3IJHB 5KAQG 3W1ZA 1QFUL 5DSCA 4I48B 4Z3IA 3I6GA 3P54A 2PYEA 3Q3GB 1WWCA 4XPFL 3IGFA 4PHZA 3L4ZA 4F7PB 4NPJA 1C8PA 2NDGA 4DN3L 5HYQA 1X4XA 1TNMA 5ETUA 4KXDA 3FB0A 3CE1A 3DBKA 1MCSA 4YLCA 1T21A 4NUMA 1YY9C 3K0YA 4ZUUB 5HHXL 2X9YA 3B9VA 2RFXA 2PCXA 1G43A 2CJ3A 4R4FL 4ZMQA 4QRPE 1ZLSL 3O6KH 5J3HD 2DWEA 4LL4A 3GHBH 5FO2A 5KVEL 2OM5A 4FAAB 4EZKA 5DJZB 3VQ1C 3BT0A 4L4JA 1QSED 5AZ2L 4C4KT 4H8WL 1CYGA 1N70A 4UDTA 3WO4B 4J23A 2HLEB 4LNRB 3DRQB 1TQBB 2N0MA 3DTXB 4M4RB 3HG1B 3DX7B 4ZQKB 3G6DL 4IW4C 1KJ2L 5DR5H 4TQEL 4NO2B 4CMMA 7PAZA 3QHTC 2KYIA 3T6WA 4FGMA 3GF8A 4L5FH 4PJBA 4D0BA 1ACZA 4QRRD 3MZTA 1MRCH 1DVUA 3VQMA 2ESVA 4JREC 4P4KD 3HG5A 3AJ7A 4XOAA 1LO0L 4L9LA 5MP6H 4KRPC 2AJVH 2Y7MA 3DTUB 3DURB 5EEUA 5KSBB 1JZ7A 4HWBH 2FJHB 3BVVA 2H3XC 2VERN 2NW2B 2J2ZA 4PJ9C 1VIWA 3PQYE 4M43H 4XMPH 2YD6A 4P2QD 3IJSB 5T3XD 3SEPA 5MEOA 1QOKA 2HZHA 1LYQA 2VDQH 4U1NA 3CV5A 1S5IH 3UTTB 1ND0A 5IBUB 2OFQA 4M5ZL 3BQUA 4KZEL 5T1LA 1VHPA 2VLKD 4B9JA 1T1WB 1AS8A 3O3UN 4HJJH 2YGNA 4OGYL 2A6KB 1KCUH 4KQ3H 4PEEA 4YFLI 5K59F 1HHHB 1SY6L 3CNKA 4ZPVA 5H35B 3ZQXA 2FE0A 5FKPB 2VLMD 4OZIF 2H2PD 4OR1A 2FRGP 4PJFF 5KJ4A 4KFMA 2ZXGA 2EUXA 5CSZB 3ULVE 3AC0A 2AK1L 3KEHA 3TN0C 1KXTA 1TRLA 1AXSB 3V4PB 3UC0H 3MLTA 4OUOA 5SX5H 2GK0B 3ZKMD 5IHUL 3BE1L 3WFEL 5HYSG 3HG4A 3ZT7A 2Z7ZA 2ZX5A 5ID1B 2QT6A 2NSQA 2R59A 2XY1A 1TLPE 1ZVNA 3OKEA 1UASA 3INUH 3RJDA 2QADC 3MXWL 5INCB 4A2EA 1WFMA 2Y07L 3GI8H 3KPNB 3SBPA 3V6ZA 4TLKA 4HISA 3CN0A 3C5XA 1MY5A 5HY9A 2BY3A 4CSZA 1OAJA 4PBDA 1U8QB 1LE5A 3PP3H 3RTQA 4JFEA 2COQA 2G2RA 1I8UA 3MGOB 4TTGA 1KPVB 1YYLH 3KYNB 5CSZA 2VXQH 3T3PE 4DQOL 2ICWB 5LVEA 3BP5B 4AY0A 1QF1A 2F15A 1GMEA 1QP1A 3BGFB 4HULB 4U3HA 3L45A 3OLIA 1L6XA 1S9WB 4NQCD 4WFEE 3VTMA 5DRWA 3VH8G 3EYVB 5DLML 2RAMA 3LSOB 5IK3A 5C0RH 1I8LC 1T0NA 2OJEB 2XWCA 4A2DA 2VO8A 2JB5H 5T3XH 5EUKB 2DLHA 3F05A 5DHMC 2P28B 2E9GA 4KTYA 3QQ9C 4JCLA 2NXYC 1YMMA 4B96A 4NRYB 3MRLB 1COBA 3QPXH 1FYTB 2ADGA 4JFYA 3QEGL 3QIBC 4X4YA 4NCC2 5EN2A 3FTSA 3AQYA 4NUGH 4BWUA 5BOJA 5DC0A 2DLTA 1QFHA 1U9KA 1I7TB 2GVYA 2VDKB 2XHNA 4X4XB 4MAYB 5C3TA 1T4KB 3UBXB 1DJIA 3CH8A 3WXWH 4AL8L 1HHKB 4QLWA 4LVEA 1U4FA 4GUQA 2B3IA 1QLRB 3LSOA 3MSAA 4IOSD 1S9YB 1V10A 4ZUWA 5C8JA 4KKQA 2XICA 2VMFA 4RQQB 5IT2H 1M7UA 4KDTC 1KXVA 3KPRE 4NHCH 3ARXA 1CLVA 1F4XH 5GGRY 4PJEB 2FEDD 4AH2B 4APQC 1EMTL 1KCWA 3GT6A 2NSXA 5IZ7A 2ZUWA 5DJ6A 3MR9A 3ZDYB 4KI1A 1I7TA 1KENL 3CD4A 3CFDA 4TLIA 2Y6SD 1T4KA 3QG6B 2BOBB 5LAPA 2J88H 3ASWA 4D9RD 2DI8A 5IQ9A 3NZ8A 2BP8A 1MFDH 3LRSB 5CU5A 4LBAA 3CSYB 4EIGB 1FORL 4Z76B 4XWGL 3LZFH 2JJVA 3VD4A 1G0XA 1X5ZA 2R39A 1DEEA 1IC0A 4FFVC 3ORJA 4LLMB 1X5MA 1HCVA 1JNHB 2NY6C 3D0VA 1BF5A 5JZ7D 2XBZA 4XGZB 1YEEL 3FN0L 3EJQA 1DJWA 2WKGA 3BIKA 1NGWA 2V2WB 1U8OB 3VD7A 1MFCL 3FB7A 1QFWI 3D69B 1NLDH 3D18A 4R26L 3ML8A 3LQAH 3B9KB 3NFNB 1PLAA 3HC4L 3VXUE 4XPAH 4FJZA 4ONFH 4ALAH 3GMRA 3DVGB 4MRBA 2OXGB 3O4LA 3QIWC 1U33A 3QQ4A 3WTSA 2OCJA 3CSYA 4NAMA 1NZRA 2PP7A 1AHMA 3HFML 4L18A 5CILH 1CFQA 5I6XC 3VCLB 4OI7A 5J57B 4KVNL 1HH6A 1TZ8A 1PEWA 4AVJA 4G1EB 4XAKD 1B2WL 5I1EH 5HJ3A 4HUXB 1CLYL 2GY5A 2Y7QB 1BQLH 3NPZB 4POUB 3S2CA 2A77L 3PAYA 1B3JA 1R19A 2UXTA 3BC9A 4WNQA 1LEKA 2E4FA 4F9PC 4XN9A 3HTLX 4YXKL 4BQ8A 3L4CA 5LLIC 2KHAA 4YK4C 5DXWA 5EU6B 1WBZA 1U8MA 1U3JA 1XB8A 4PJ5E 4YDKL 4G70B 4BUGA 1W6LA 4XNXH 3OGOE 3ZMRA 1BFVH 4XXWA 4JB9H 2FHFA 2OXGA 3IKCB 5SWSE 5DJ2A 1DVQA 1U42A 1S9VB 1NH6A 5EU7C 2XV2A 1Z5LA 5BRZE 1JGUH 3X14B 3HAEG 5JSSE 1KTLB 3QUMA 5ICXA 3ZTNL 1YECL 2GJZB 1XD1A 2J6WA 4LKCA 1RUKL 2WNGA 3NRFA 4Q74A 4G1EA 3QIUA 2PO6B 2A73B 2WO3B 1I7ZB 3LEVL 3LQZB 3DUHA 1DN0A 1KCKA 1A7RH 3KYKL 4YSTA 2VN7A 4JFTA 4XC3H 2XETA 4ZAKD 2OMUB 4YBLC 5C09A 4ZK8A 2GUOB 3A47A 4MTWE 3EG9A 3VFTA 5E2WL 1A7PL 1P7QB 3OG4B 2XKNB 3N55A 2ARJA 3VXMB 1WS7A 3MV11 1MHEA 4N0YH 4JQIL 2EYSB 3SHSA 2R56L 1NGYB 2O5YH 3HBPA 4OZGB 3HCVB 2X4UB 4I5BB 2A9MH 5T1DL 5KSBF 3P7TE 3CZNA 3D85A 3FSAA 2X44D 3TJPA 4Y16A 1MPAH 4F1SA 3EOAB 3IM1A 4D9LL 2XPGA 3IWUA 3STZB 3CSFA 3P0GB 3TLRA 2AEPL 5I76B 4YBQC 4UQIM 5K1JA 3VD9A 1HDMA 3DVNA 1UM5L 1PKQE 3AY4A 1DDHA 2DOCA 2VC2L 4JCWA 1HQRB 2IH8A 4ZTPH 1UD8A 1DVZA 3BDYL 3QFDA 3CBRA 1I1AB 2B14A 4PCTA 3QWRD 3NCYP 1GC1C 3EDEA 3PE9A 3QUXD 4ODVH 4LP5A 4ZFZB 2G3NA 2IAMC 2IGFL 4I2XA 1P7KA 4AXWB 3KGUA 1YUHA 2P5EA 1KFAL 4JVPA 2A9NL 5G4NA 2Y7OA 5A16A 3TBYA 2X9XA 4DP6X 4G8GB 4R0LB 1I3RB 5BMFH 4NC1C 5DYOB 3QI9B 2HP4A 2VW6A 2D31A 3NEOA 4GIOA 4MDIA 4R6UA 4UYPA 2QQLL 3T6VA 2WLLB 1EJOH 1N68A 2OX5B 2W59A 1YO4A 3F00A 4QYAA 3U4BH 4CVUA 5A43C 9PCYA 4OV5A 1GW0A 1J1PL 2V3DA 4LHUB 4YQXH 3HJ0A 2TMNE 1I3UA 3H3PL 3UZEA 2BY1A 5BRPA 5T1KA 3PWJB 1ADQL 1C5DB 1QPPA 2P8MA 5K1VA 3D39B 1I1AA 5CLWA 2QPFA 4PJ8D 3TBSA 5AW9B 3SDXB 1G7MA 4AQEA 4HUWA 3SPVB 2K7QA 5HD8C 3R1GH 1B9ZA 4GKSB 2BHZA 1OT1A 4W9IC 4PREB 3KLSA 1WS8A 1MLBB 4N8CH 4QXTA 4FEMA 1BVNP 2K9UA 1RSYA 5B7FA 1XB6A 1J9TA 2XTSA 1AO7A 4HKJB 1WWWX 4O9HL 2Q76B 3BSHA 1EBPA 1CFNB 3DYMA 5J5EA 2N7SA 3LS4L 4KXCA 1K3IA 1F5WA 3BKML 4M62L 4TSCH 4S1SL 5LDUA 2Y0SA 1EEZA 4FLRA 2AJSH 1VEPA 2HFEA 1NC4A 2X40A 3KPOB 3RAJH 4FS0A 4YAQA 4GBXB 4NRZA 4LPXA 5EORL 2J5LB 1BJ1H 2XZQL 2MWCA 1OS0A 1OARH 3U9PH 2QEJA 2IWFA 1GAFH 2EIJB 5EEYA 1U30A 5AKTA 1RVFL 4POZC 4B9FA 3GSQA 4Y5XB 3QYNA 3O4LE 4HS3A 4U1HA 4WI0B 5JQIB 3FBQA 1NICA 4QIRA 3KJ6L 4YZFF 1O7SA 2FAUA 1ET5A 3EXJA 1WYJA 3ATEA 1CLOL 4JPSA 5FEBA 5I0DA 2F54A 3NP3A 4G9DB 2APVA 2GBAA 4OQTA 2HLFD 3ESMA 3OLGA 4MB4A 3SCMA 3DC0A 4WW2C 1CFNA 5EFIB 2ROYA 4L4TE 1KF9B 3CLWA 2FWUA 3NT0A 3L1GA 5D2NA 2I69A 1A9EA 4MDRA 5TTRA 2FL5A 2MQGA 3E1F1 2QSCH 1RULH 2VSDA 2FT8A 3IDUA 1OB0A 1C7TA 1DUZB 3L3DA 5IG7B 3WS6A 5IB3B 3GQFA 3L5WA 5I0VA 5C07B 4FNSA 3D25A 3U9UA 5TLIA 3ARVA 4KHXH 1HNFA 4LKXB 2HJFB 1HH9A 5ALBL 1ED3A 3ZDYF 2P8PB 4MA7H 3VAEA 5ADPH 3VD1A 3SB3A 1UWXH 2YJLA 1F58L 2X10A 5CN3A 1B6DA 3TA3C 3D3VA 3QWQB 4JY4B 1LLAA 1W8NA 4HCRH 1EDYA 4LCWB 1C12B 1M42A 3FRUB 4AM0B 4UI2A 2VUYA 4HHWA 2X4OA 4GXUN 5DHXB 3Q44A 2JIXA 1E4KC 4J28A 3H9SB 2J1KA 1RUAH 1NLBL 4OF7A 5F88B 4IRZL 5HHPB 2YAFA 2VISB 1BXXA 2VGLM 2DBLH 2J4WH 3NGBB 1M1XB 4G7YH 5HGHB 4YPGA 1U3HC 3QPKA 3LVTA 1HEHC 3UG4A 4MQXD 5DLHA 4JG0H 3UTSB 2FEJA 3MLZH 3QJHB 3BYTA 5IW6A 4YX2L 3OMZA 3FCQA 1N5AA 2IADA 4JG5A 1QFOA 2R2BB 3WIIH 3O6KL 5AZEH 4LBEB 3GHBL 4WHTB 2DQMA 4XMVA 3Q9PA 3WL9B 5LKNA 3VFVB 1DUYA 4M8RA 1XF5B 5JNYA 1MI5D 1MDAA 2AK4D 3CSPA 3IU3B 3ES6B 3BPCA 4H8WC 3DDGA 1HYSD 1W0WB 3D34A 4HAGA 4DKEH 2JQMA 1P7HL 5FSPA 2BVPA 4F27A 1J0HA 1X6NA 2VLLB 3MBXH 3P4NA 4NP4H 5SWZE 4EXPX 4R83A 1E2WA 5AG9A 4WZ9A 1YNTB 5DR5L 4ENEC 1UWYA 3EH4B 2WBJB 5B3SB 1HILA 5E8NB 4AK1A 1GGTA 1KLUB 3V4VL 1PLGH 1MRCL 1BQHB 1W72H 1FFRA 2HT2D 3MJGX 1WAEA 2YKKA 2OL3B 1I1FA 4KDWA 3S3BB 3FFCA 3VWJB 2AJVL 4N9GB 4P3CL 5DDHB 5KN5A 3GMQB 4HWBL 3VFVA 4GKZB 3ZYJA 2VDNB 3SDAB 3ILQC 4KKBC 1NCJA 2JJTA 4MFHA 2OTWB 4PWEA 4PJ7B 2ZSVB 5HDBF 5HGBB 4M43L 2CLVA 5T33H 5AW5B 1W0WA 3ZPDA 1GYAA 1MJUL 1NGZA 1UOLA 5EZJA 3CUPA 3EGDB 2W0KA 1AJ7H 1S5IL 2ITFA 4XOBA 1Q90A 3TLIA 2Z31D 3QBTB 3HKZA 1UJTA 2VXVH 4O00A 3RG1C 4E41D 2F6AA 2GY7B 4HJJL 4S1RH 2BOCA 2PXYC 3TH3T 4KQ3L 1KCUL 4NQQA 1JI2A 5ESAB 4HOXA 4CAGA 2B2XH 2PCPB 1OGAB 1WFNA 3TFKC 4K2UH 3R18A 2H4EA 1NEUA 2UVFA 2EEBA 3L4XA 1WH0A 3MJ7B 2X09A 3QXAB 3CU1A 4YSCA 5BZZA 1ZGLM 2P3YA 4ACTA 1K4CB 2OTWA 1UH3A 1ACYH 2OW7A 2ZSVA 3EH3B 4OZGF 3HC3H 3UC0L 1R5VA 1CBJA 4FL4B 3BJ91 2M8XA 2P52A 5C7XL 1EZUA 3RWIB 1OALA 3JTTB 3MRCA 4DKTA 3FQUA 3INUL 3NN8A 1VDGA 3I85A 4IOIA 2XJLA 3GI8L 5L2KB 4JPKL 2XTJE 3L6FA 1QWHA 4TQHA 4ZMLA 1UM4L 3O3EA 5C2UB 3DX8A 2FWSA 5I8OH 1DZ0A 3S5ZA 4OZHA 3HVDA 2ZQKA 3QJXA 3L9YA 4C83B 3D2UB 4QHLA 1YYLL 3EHBD 2GC4C 5D4JA 1Q4NX 1G7JA 3O6MH 1D3CA 1JZDC 3Q5YA 3MO1B 2VXQL 4KU1A 3UGUA 1CFSB 5H37H 3MNMA 3G08A 2WP3O 2NY5H 2LTQC 3RY4A 3SKOA 1BPVA 4WEBL 4PLKD 1GZHC 2XWTB 2Z7WA 4OKDA 4BSVB 3BX7C 1MCIA 2P80D 3UTTD 3VXQB 5C0RL 3GSUA 1ZSHA 2JB5L 5T3XL 2EQDA 1A1OB 1D6VH 1PG7H 2NY3C 1SN0A 5L0QB 5FM5O 5IHHA 1FF5A 4IHBA 1SZNA 5D5MB 1E2VA 4J3OG 3SPCA 2MHAB 4BWTA 2XVLA 1NUFA 1KB3A 5HHOA 1OE3A 1UGKA 3DJ9A 2WXKA 4NUGL 4YDIL 1RXLA 4O02A 3WEXA 3ZUNC 5A2BA 1G1KA 2B59A 2BVYA 3QFJD 3NIFB 4GRLC 3K72B 3K7UA 2UZYB 1T5WB 4D0DB 1WAAF 3PNRB 3WXWL 1DQQA 4WO0A 4UZSA 4AL8C 3CSBA 5CS7A 5I6NA 1E5BA 3OHXB 3K2KA 2R51A 1TENA 4OBSA 4ZODA 4K7PY 1OB1A 4WEMB 1T0PB 3QE5A 3T4YA 3FO9B 4JPWH 2B3RA 3BO8B 5EIIB 2YUVA 2BNQB 3CFEA 3E6HB 4TNVF 2F53A 1WFOA 1CGXA 4PJCB 5IT2L 3OJMB 5D4IA 1J86A 2I85A 4NHCL 3O2DA 5B39B 4QWWC 6PCYA 4XCFL 3EO9H 3FQ1A 5J6GA 3IXAA 2DS4A 3FFOA 4CU6A 3GZOA 4Y5VA 4EO5A 5E2UH 3VGFA 1U8NA 5LNDA 1NIAA 4ZW3A 4GRWB 5KBDA 5ELIA 4BSJA 4LLVB 3EADA 1NDGB 2K8QA 3AQXA 2KKQA 1EZVY 2J88L 1E7UA 1FL3B 1S3KH 3QDJE 3BAKA 4X4MA 3VH8A 1QVOA 1MFDL 5F1IA 4I1NB 3M1OA 4R2GC 1WBXA 1ZVYA 2FZ3B 5DHDA 3TU6A 1PYWA 3LZFL 5EIIA 5D7JA 5IVNA 1XCQA 3DMMA 4FKKA 2E7DA 4GG8A 5JIIA 1FYTD 5B39A 3TIEA 4K71C 1FFPB 1X7QA 1TEYA 4ORGA 5GRJH 4F7TB 4XBEH 1L7TH 2PLTA 1NLDL 3FUDA 3FQNB 4B0MM 1OGSA 3VDAA 3JUZA 3RUGA 3LQAL 5GS1B 1DFBL 4BV1A 4XPAL 4MAYD 5IVXA 3P9MB 4ONFL 1FJ1A 1QSFB 4L29A 4ALAL 4EI5C 2P43B 3FCGA 1M71B 3VG0H 4N22A 2Z7UA 5GXBB 4KK8C 4Q0XH 3S4SG 1RZ8B 3OBAA 5HDLA 3RHWF 3UAJC 4QXGH 3ZHKA 4MXWH 3RU8H 1S7RB 5CILL 3L3HB 3I3DA 3UIZA 1T4WA 1TJGH 4NLHA 5E6IC 2B15A 4RZCB 2V7HB 1S7QA 3GWJA 4F2MB 5I1EL 2Y36H 4RVBA 1A6PA 3BCFA 1BQLL 1NBCA 3K5RA 1FVCB 1H3TA 3FFDB 3HRZB 1FFPA 1DJXA 1RURL 2CH8A 3GXUB 2BHFA 3RWGB 4M6AA 1TITA 4U1LA 4OI9A 4PVBA 1TTFA 3QJVB 4NQDB 1JHLH 4XCFH 2IPTH 5CD5D 4YHYC 3IXTA 1PTZA 2EEDA 4XNXL 3SGJC 1M71A 4PMEA 1BFVL 3LYRA 4JB9L 5DHEA 5TFSH 5KSAA 3JVGA 5FO8B 2X4TB 3RZCD 2J6EH 2Y4SA 4PVMA 5DUMH 5EU7E 4ABVA 1GSKA 3KYAA 1IMHC 1JGUL 3S96A 4ABQA 1CDHA 3SDCD 4ENZA 3EFDL 4N90D 3R7QA 4HVBA 3GXTA 1OD9A 2BY0A 4ZX6A 2MOQA 3OR7B 1B6UA 4Q9RH 3GD1C 4IU2B 1YUKB 4NIYE 4ZOEA 4B0MB 5SV4A 4QNPE 1A7RL 3LKNA 2NY0D 1I8KB 1F02I 1NCGA 4NHUA 4XC3L 4OZHE 5GIRB 4Y8AA 3OAYK 4P48A 5F1KC 2N7AA 5B1JC 5IKCB 2J8UE 5AYUL 2IH3A 2F19H 1S9KC 3BVDB 3NIDE 2QDVA 4N0YL 4Q2ZA 2K70A 3QO1B 4OKVB 5EOQH 5JT9E 1N19A 1OP5K 1L6PA 1TVBB 2VL5A 2O5YL 4J4PD 3KG5A 4WUUA 3T4AB 2A9ML 1QATA 5A2AA 2VDOB 2BC4A 2WWKO 3QUZB 3LPGA 2CALA 1CR9H 4WDIA 3K6IA 3TBBA 4PJ7F 3RL1A 2R69H 2FX7H 4FOMA 3JYBA 4XPHH 1UA7A 4M02A 2D7MA 3NQXA 5IQMA 2Q20A 1PKOA 3SBQA 3Q8BA 1KDJA 1P4LB 2DLFL 1URIA 2MSPA 1LVEA 1G0DA 4UT6H 2WIMA 3WMSA 1BD2E 4BE5A 4TYUA 5EU6D 3STLB 3VRIB 8PAZA 4OIAA 3WFCH 3IGKA 3VX0A 2AJ3A 3KPSD 1KBWA 4N6QA 1HOCB 3O0LA 4PRHE 1JBJA 4OUUA 4OKVA 3MBEC 2FO4B 1UT9A 5JHDB 4OZFG 5DVNA 4WRLA 5KVGE 1TVBA 2A9BA 3SO3C 1AHWB 4L3EE 3U6RB 3HAEA 5LBSA 1DVYA 3A23A 5JIKA 1HI6A 1NINA 5BMFL 2HRPH 2KUTA 4GG6A 2YD5A 5CR1A 1EJOL 2X4PA 1WCBB 3CFKB 4HPOL 2R15A 1O7VA 2ZZUT 4JFXA 4MNQA 3WSQH 3C5ZC 3WHXB 2Q2LA 1CLCA 4Q97A 1CFTB 2WYHA 3HHSB 3J8F7 4IMKA 4H8HA 3TZVB 3QUGA 4G9FA 4WGVB 1AZCA 1S7VA 4MJ4A 3MV8E 5DJXA 3R1GL 4I4WA 4KJQC 3T6ZA 2VE6B 4CUCA 2X9WA 4XP9L 5A6IA 4GQQA 4NKQB 5BV7B 1YC8A 2Z4TA 2RR3A 4KVCH 4HHGA 4W93A 4NNXB 4N8CL 1N0LB 4MD0A 3NSCA 4LASH 2UVEA 3LRLA 4XMKH 3EOTH 1OCCB 3ARBA 1I8AA 5IW1A 2C9PA 4Y1AA 4PB9L 4LP8A 3HI5H 4MMYB 3L3IA 3BYYA 1OQOA 1LNUA 3PG2A 1PFCA 1QF2A 1KWGA 1MVUB 5DRNA 4AENA 1LO5B 4TSCL 3NCMA 3BQVA 1I7RA 3CXHK 3FZUD 3DX9A 2AJSL 2Y2YA 4FQLH 3RAJL 1QBBA 3GS7A 4EPSA 4YHPB 3KNBB 2XA8H 4HC1A 2FD6H 1CN4A 5D7KD 1MHCA 1FJWA 3ATBA 5D5MF 2M26A 4TV3A 4PBXA 2DQUH 4ZOAA 1JS4A 1IEBA 1KJVB 2J21A 2RA1A 2HXAA 3LNEA 1FH5L 1SJVA 4ZFOB 2I7OA 3U1QA 2NUPA 1E9QA 2HRGA 3NIFF 3II3A 3QCVH 5IOPA 4P9HH 1NCNA 1ESOA 3QI9D 4QF1A 3HUJB 5A7BA 4QY8A 1YPZB 3NZUA 4OFQA 2MIZA 2ZAGA 1H5BB 1OP3K 2WKOF 3A4AA 2DQCH 5GGTA 2VUKA 2WTRB 4LHUD 4B95C 2NW3B 3WENA 5ENWA 4NKMA 4WJ5A 1A4JB 1AOHA 3ULUF 4X5WA 3B83A 4DFHA 4HIJB 4JDEB 2L7UA 1GYUA 1KTDB 5C0BB 1RULL 2ITCA 3F7PC 4FQJH 5EEZA 4PJCF 4I89A 5DZ9A 4Z3HA