4P8QA

Crystal structure of human insulin regulated aminopeptidase with alanine in active site
Total Genus 289
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
289
sequence length
867
structure length
860
Chain Sequence
KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-cystinyl aminopeptidase
publication title Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 289
structure length 860
sequence length 867
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4p8qA02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 4p8qA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 4p8qA01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4p8qA03
4FKEA 3FH8A 3CIAA 1Z5HA 4XN8A 3B3BA 4P8QA 3FUJA 5BPPA 4XMZA 3FHEA 3KEDA 3EBIA 3FUFA 3T8VA 5CU5A 4Z7IA 3B37A 4XN9A 4ZW8A 2ZXGA 4ZX3A 3Q44A 5C97A 4MKTA 3FU6A 4FYQA 3EBGA 5DYFA 5LHDA 3Q43A 4FGMA 4K5OA 4KXCA 5AB0A 4KXAA 4QMEA 2XPZA 4XMWA 2XQ0A 5LG6A 3MDJA 3SE6A 5J5EA 4XMXA 4NZ8A 3CHSA 4Q4IA 4XMVA 4MS6A 4F5CA 3FTUA 3QJXA 3B34A 4QHPA 4XMTA 4QPEA 2DQ6A 3FUNA 4XO3A 4XO5A 1Z1WA 5FWQA 4KXBA 3CHPA 2DQMA 3FTSA 3FTYA 4K5LA 4XO4A 2HPTA 4KX9A 4ZW3A 1GW6A 4K5NA 4R5TA 3FUKA 3FUMA 3FUIA 4ZX5A 3Q7JA 1H19A 4ZX4A 4QUOA 4FYRA 3U9WA 4XNAA 4ZQTA 3FU0A 3RJOA 4FKKA 3FH5A 4KXDA 2XPYA 3FH7A 4QIRA 3FU5A 5AENA 4PJ6A 4FYSA 2YD0A 4JBSA 4XNDA 5K1VA 3CHOA 4WZ9A 3FULA 4Q4EA 4FYTA 4PU2A 4ZX6A 3FU3A 4J3BA 4GAAA 4NAQA 3FTWA 3B2XA 5DLLA 3FUHA 4R7LA 4XN5A 4K5MA 3B7TA 3B2PA 3B7SA 4XMUA 4KX7A 4K5PA 5AB2A 2R59A 3FUDA 3FTXA 4R5VA 4E36A 4ZW7A 4R5XA 3QNFA 5LDSA 1SQMA 2GTQA 3CHQA 4L2LA 4XN1A 3PUUA 4HOMA 4FKHA 4ZW5A 4PVBA 4DPRA 2HPOA 4PW4A 4OU3A 3EBHA 1HS6A 4XNBA 3FUEA 3B7RL 4XN7A 3B7UX 4RVBA 4RSYA 4ZW6A 4XN2A 4XN4A 4X2UA 4KX8A 3CHRA 5J6SA 3FTZA 3FTVA 2VJ8A
chains in the Genus database with same CATH superfamily
4JHWL 1WPCA 3HNSL 2E4FA 5F7KC 5B38G 2WBJC 3FQ1A 2BVTA 3KBFA 3OWEA 3PABA 3DV6B 2VDNB 3Q05A 3TF7C 1IEAB 1QACA 2XQYK 2G9KA 4FQHB 4HAFA 1NWPA 1INDL 4HIIB 3BPNC 1QLRB 4IMLA 1ODAA 3WNJA 2XU9A 4BHUA 1RK7A 1HOCB 4WUUB 2XA8H 5DQDH 5F70A 3V9CA 1Q90A 4G8IB 1A3LH 2QKIA 4M1DL 4HH8A 1J1XH 3TN0C 2XY1A 1C5DA 2H6PA 1UXWA 3QEQA 4N0UE 5BJTB 5I9QC 4KTDH 1IC5L 1J1PL 1S9WA 3RVXC 1Q9WB 1TJGH 3OKDA 4M62L 4D9RD 5HGAB 4R7VA 2ADJA 5EO1A 3WJJC 5JXNE 3MRQB 1DBAL 1PG7L 4JFUA 1YEIL 2H1PL 3DRTB 3QZOA 3GJFA 4NAJA 1TYJA 5JYMA 5D2NB 1A7OH 1XZ0B 4K0OA 3T0DA 2ARJQ 3QIUD 2VE6A 3MLTB 5BO0D 3FCSA 4F1SA 3WFDL 3ETSA 5TQ2L 5EO0A 1F1AA 2IGFL 3KJ4B 1TVHA 4R8WL 1XGPB 5DMGC 5KJ7E 3PXLA 5TD4A 4YL9A 3U0PB 1AMXA 5E94B 1UCBH 1V3KA 1OGAE 2I7OA 4PBWD 4C57C 4WTZG 1TJHL 3QWRD 3WDJA 5KUMA 3KYKH 1P7QB 5I2IA 4PJ8B 2F5AL 1VGKB 2BNRE 3THML 3T2JE 1OE3A 3TFBA 2I9TA 3D4YA 2XN1A 5SV4A 2RFXA 1AS8A 3QHTC 2JI3A 2YZ8A 4Z7AA 2FJSA 4P59H 1LO2L 3CVBA 1ACXA 4PJ5E 3MRPB 1KLFB 1FBIH 4BK5C 4DUXA 3LS7A 1CICC 1N4XL 1R5IB 2ORBL 3EO9L 2GIXA 2VLJE 5JHLL 2Y1VA 3CQFA 2K8QA 4K5PA 4KROB 5E6UB 5EEWA 1A0QL 5JQ6H 5T1MB 2DV6A 2QSCL 2IH3B 2YPLE 4L8DB 1KZYA 4JQXA 4G3YL 3T08A 4YPGB 2P5WD 1JMXA 3NJXA 1LNBE 3OR7B 2DQJH 4AYGA 3DO7A 1H8NA 1N59A 2UZIH 3IPFA 1GRWA 4JE0A 1EXUA 1XEDA 5B3JE 1OTSC 1TLKA 1KG0A 3RY4A 3UTTD 1A4JB 4BZ1H 4F2MA 3BISA 1A4CA 4XXDB 4Q58C 1KBKA 5E8NB 3ARFD 4I0CC 3PDDA 3T3MB 5L2KD 3B4NA 3SDCA 2WI0A 2FLMA 4JN1H 1JV5B 4JFFE 1AQDB 5DURB 1HL4A 3IJ9A 3R19A 4L2YA 1G9HA 1KOAA 4AIZB 4C83B 3L7EB 1BZ9A 1A4KB 1NCWH 2IPUK 4R7XA 5LBGA 4JFVA 3WEOA 1XX9C 5JHDD 4Y4KC 5EBWB 1HU8A 3ZKMD 1L3WA 3GO1L 4WNSA 3IGAA 3EF7A 2EIZB 5HGHB 4BD4A 4H2AA 5BZXA 3M45A 4M9OA 3ISYA 3MREB 4QXVA 3FMGH 3QI9C 3ZTJG 1N8ZB 3GUFA 4QRUB 4BFEA 1KY7A 3WKYA 3BDXA 3HJ0A 5SWZA 3SEPA 3FO0L 4Y5XA 2VQ1A 3SJVB 4CSPA 2YQGA 4DAGH 3F64A 5AOZA 1I8MA 1CFTB 1UWGL 2CRYA 4P2YA 2EYSB 2YGVA 5IROC 3U0TB 5ES4B 3B5HA 1EDQA 1HXYB 2B9BA 3CN2A 3ZKQD 4GW1B 1ETB1 4OFYD 4KHTH 2TLXA 3RWCA 2OZNA 4ODSL 2XV0A 5TK4A 3QO1A 1ITBB 3MRIA 1MJ7L 1V7NL 3EYUL 1MY7A 4L37A 4FQJH 2O6DA 1RUML 4XHJD 4QXGH 1MKFA 2GJ6B 3OR6B 4I4WA 1CD1B 2PO6B 2ESVB 1RFDH 4WHCA 5HPOA 3QJTB 2N3JA 4NRZA 2WXFA 4HWEL 2O5ZH 4JAMB 1DBJH 3VYNA 2B1AH 1PTZA 1JDAA 1DQLH 3EUUA 3MGTB 4WNJA 2YUZA 3H53A 1HEHC 3WE6B 3ALPA 3JYBA 3LXBA 4TMNE 1F56A 4FE9A 1AO7A 3FKUS 1RY7B 3QZWA 2X7LA 2R29A 1NM4A 3HCVB 4ABUA 1BREA 1TZHA 3BUYA 2G5BA 1N3NA 3LEYH 5F88B 3VWKA 2OSYA 1MLCB 3RA7H 4LSSL 3MLVH 5K9OA 5KJRH 3VFGH 3DX8A 4Z7WA 4PBXA 5DFVC 4ODXA 4HWBA 3HRZC 5JPNA 2Z0BA 3FFCB 4F9PA 3LPOA 1MRFL 3RAJH 2E6PA 5I5IA 2MNWA 3H7BB 1IC7L 4BDVB 5B39B 4FZEH 1GR7A 1TDQA 2Z92A 4WEUD 1BQSA 1FZOB 4E9SA 2BW4A 2GSMB 3EUDA 3C6SA 3L9YA 2ZYIA 3K6NA 1RV6X 2W81C 3D3VE 1ZE3C 2AZAA 3KYNB 5GRJH 1KGCD 1GSKA 5CMAB 3TIDA 4BZ2H 4HHAB 1SF5A 1BOGB 2VJXA 4U1GB 2QEJA 1FYHB 5EBMB 4NOFA 5FYJD 2O6FA 3MRDB 4ZUTA 5JTWA 4S1QL 3VSVA 3TBYA 2DYSB 5LN4A 3FF7A 2ADFH 3JXAA 5IJDC 3ZY7A 4CW1B 1MVFA 4L5FL 1H0DA 1ETA1 4M3JA 1X9UA 3GTVA 3T0EB 2DLFL 2C5DC 2DYPA 1Z5HA 2YD3A 1CF1A 2X4QB 4YAQA 3TBSA 4QOKD 5A2FA 4Z3JA 1E4XI 4G7YH 3K6OA 3TWYA 3HE7C 3IWVA 3U7YH 3KGUA 4DGYH 4KV5E 3GM0A 4UTAL 1KCVL 2AJZB 1I7TB 1A6PA 4LSUH 2G5RA 2L8AA 3BPCB 3CFJA 3BT0A 4OUOA 3IAPA 5IW3A 1L9TA 4L5FE 5AOJA 5BV7C 4CUCA 3K72A 1AR1C 4OIAA 1EANA 2OMWA 1AQMA 4BKTC 5FOJA 3X2QB 3IPBA 1QRNB 5FV1L 3MJ6A 4CDGC 1PLAA 2Q76A 3HB3C 4PW3A 2Q7AA 4TVPL 4X6EB 3RVUD 3S37X 3TVMC 3ZKXC 1E3FA 3NQZB 1PGRB 4UU9B 4A7TA 3GSNL 4R96A 5D2LB 4KXBA 1QFUH 1GTFA 1OW0A 4XC1H 5EC1A 1MCNA 1AE6H 4FMFA 2IH1A 3EFOB 1D9KA 1J7VR 3NCMA 4KK6D 3NIFB 3WFBL 3CG8A 3EYSL 1VDGA 3US1A 3HG1A 5CP3A 4TVPE 3J8F7 4YE0A 2J6EH 1Q0XL 3DBSA 3PGDB 5HYQA 4R2GD 1GMIA 1CFQB 3P77B 2AJ3A 2OS7A 1CE1L 1EMTL 4KFZC 5FC9A 3D85A 1FG9C 4R4NC 2XG4B 1PLCA 2VDOL 5T33H 3V4PH 3VD7A 2ZOUA 3ARZA 1G5AA 3FQ4A 3GEWB 3B1TA 2W91A 3OG6B 2X4SB 4KY1H 2Z31D 3BMWA 1HESA 1JVOA 1H9VA 3FO9B 2MOGA 3L3GA 3C60A 1BZ7A 4LOUD 2GITB 2YPVA 1KN4L 3T6QC 4J3BA 1K8DA 5I17A 2UWEB 2A38A 4S1SH 1M71B 2QVFB 3TV8A 1NQBA 5HXMA 2IAMC 4NRXA 3LNHA 3D12B 5E00B 3P9WB 2X12A 3IGKA 3ELAT 2DIBA 3WXVL 4M1GH 3F7LA 1Q9OA 1TQCB 3LRSB 3MACH 3OPZH 4JFED 1CGVA 2X28A 4KUZH 4M6AA 4Y16D 5DJZB 5AZ2H 2Y7LA 2BHFA 2XWBA 5L8JB 3WV0A 4K3JH 4Z7OB 3T8GA 5EBLA 3BZ5A 3MJ7B 3QZMA 1K9TA 1OT4A 2X4UA 1YUHB 2EIJB 4N2NA 4CU8A 3IMTA 4N2KA 1OLLA 4U1SA 1MW3A 4MMZC 3QIBD 3V5KA 3WL9B 3INUL 1QI5A 2ZX5A 2VWEC 2NSXA 1OF2A 4AIOA 1PU0A 3K4DA 4ONFH 1G7QA 3VD9A 4J3UA 2YBRA 2IDQA 3MV7A 2AGJL 2C34A 3T8VA 2DM7A 1J8HA 2FWOB 1A14H 2AJXL 5E08L 2H3XC 2EUZA 3B3BA 4XCNA 2NY6B 1IM9A 3GNML 2NXZC 2OL3H 4G6AC 2J1ZA 2ARJB 3GEFA 3AS1A 4KJWC 4QNPF 1AXTH 5D7JD 2F5BH 5IB1B 4HQQH 4ZW8A 2P42B 2BP8B 2O5YH 1A7QH 1NANI 4IGBB 4J3VA 5AVSB 5FK9B 1GC1C 5C2BH 3W5NA 4QHMA 1HOEA 1CT8B 2IWEA 3LEXA 6FABH 4BEIA 4U6YA 1MFMA 1XVSA 4P23C 1T1YB 1C12B 3C2AL 3ZMRA 3HFFA 1GJUA 4Q52A 4OZIA 3EDKA 4KJPC 1WT5C 3LSOA 5TDNB 1X5GA 2PPCA 4Q0XH 4B9YA 4WFFE 1M57B 1CD8A 3TT3L 3KJ4C 4PJ9B 5MEPB 2X09A 2A4CA 3ROLB 4RWHA 2XKSA 5KS9A 3CLFH 4XO3A 4K7PL 1T6BX 4NKIH 3BO8A 4HDIB 4OVVA 3W38A 3VFWA 4PJ8C 4DETA 1SJXA 3MJ9L 4NM8H 5GRVK 1EEYB 4PG9B 1LP9B 3HG0A 4FQ1L 4ZZFA 1JGUH 4WI9A 3ZE1F 1YRKA 2UXFA 4JHVA 3NYKA 4FHBD 2WSKA 5CN2A 1UD2A 1NUGA 4LQ1A 2YXFA 2X6BA 1U8PB 2GSGA 3EYOB 4NZRH 4PIRF 4PRID 4OGQC 2AJSL 3O2DL 4N8UA 4QRRB 4Y2NA 4K89A 3RVXD 2APVA 5T1KB 3OKOA 3P11L 4M5ZL 3QG7L 3B5TA 4FG4A 4RWYH 4RBPH 3TJEL 3GQFA 1X4YA 5D1ZB 3BEWA 1GHFH 4JANA 2VR5A 3DVGB 5C07A 1TSHA 2OMXB 4AG4H 2VQTA 4R3SB 5DJYB 4PRBB 4HGWB 4NZUH 1ZSHA 4AXWB 1YYML 4NOBA 2MWCA 3W11C 2EC9T 3G6JB 3H0TB 3R1GH 3SKMB 3VMNA 2EDKA 5TE6L 1UEMA 1AHWA 3TIEB 1WSST 4A7QA 4PJ7F 5K9JL 4IBQA 2P5WE 2WWNA 5T1LD 1RIHH 4X6CB 3KPSE 3B83A 4OZFG 3EGDA 4OCSL 5KZCD 5CIPA 2X1XR 1SM3L 2Z1KA 2YD6A 2DKSA 4HFWA 4PS4L 1E8YA 1YJDH 1ZK5A 1NCDL 1CK0H 3GWJA 4RDQG 2MQCA 2WO3B 3QVAA 5EZJA 4BH7A 5IQ7H 1CLYL 1RZGB 3ZGIA 3UPRB 5I5JA 4Y8DC 3AMLA 4X9BA 1IGMH 1ED3A 1JHTB 1CICD 3UTPD 1V5JA 3CSPA 5EN3A 2MTPA 3FTVA 1EDYA 4DTGL 1K4CB 2YAOA 5FHAH 4NHUA 1D2OA 1DJHA 2D7TH 4LLUA 3X14B 2FJFB 3FB6A 1KFGA 1K5NB 2G60H 2VGLM 4JJHA 3HN8A 2YRZA 3E6FB 4N0RA 1HVXA 5FSJA 3DMMB 3SCMC 3ZYZA 3EG9B 3F00A 1IVLA 2AQRA 3M17B 2VMEA 3H9ZA 3QNXB 4QJ3B 4HG4K 4HKBA 4XE0A 3ULUE 2I85A 3OGOE 3GF8A 7CGTA 3FU6A 3KPMB 3ZO9A 1KB9K 2ED9A 2G0KA 2XZZA 3HAEH 5ISZA 3UEZA 5C09A 4F5CE 1OAXL 2PO6C 3HZYA 4HYTB 1NGQL 5EUKA 4JGJA 1V05A 2DJ4A 2HFEB 4X5WB 5DVMA 3UAFA 5I1AB 1MRDH 1JPTL 4H88L 5TH2B 4IHOA 4XE5B 4U7MA 1OIOA 4ZT1A 3FTUA 2X0WA 1K3ZA 4I48A 4XPGL 2Y07H 3D25B 1XIWA 2K3HA 4XPAL 5KSBE 5JHBA 2Y06H 5MI0B 4Y4KD 2FAUA 3A24A 2HPTA 3S98A 3L1EA 2QHRH 3OB0K 3CU1A 2WXKA 4OF5A 2NY3D 4DWHA 4RA3A 1E67A 5DZPA 3AG1B 2WUBH 2C1PB 2JCCE 3FT2A 2AABH 1IJNA 4R4FL 5D96C 2J5LC 2WHZA 3P69A 3ZE2B 5CJXA 1OQXA 3FU0A 1DVFA 4ACPA 4H13C 3IJYA 3RRQA 4C4UA 5D71H 3HC4L 5C6WH 4GKSB 3FS9A 5IBTH 2XV6B 3MRJB 3T65A 2DQGL 1JK8A 1KIRB 4IS6A 4UB0H 5J3HC 5C0CA 3NH7L 2FL5A 2GW5A 4D8PB 1CPUA 1I3UA 2HZHA 2BMKA 2R51A 4POZC 2V9QA 3CSFA 1PZSA 5EH1A 3F12A 4WTWA 4N0CC 1EHAA 3MV11 4FMKA 5FYJL 4XN5A 2ZF8A 3UH8A 2IAAC 2ILLA 5IP4A 1UC6A 5E2TH 1HC1A 5INDA 3H2QA 3VFVA 2IPKB 2BP5M 1U3ZA 3WLBA 1BBJA 4I2XB 4NN6B 1SEQH 3EO0A 3EGXA 3WEBA 5CSZA 1MNNA 2EE6A 4TULH 2CUMA 5F3BB 4HGKC 2DQFA 3T2PA 4JO2L 3MGOB 4JDZA 2BOCB 2M83A 2RIKA 4H0HB 1HS6A 3HS0C 4OAWA 5DUBA 2GSIA 4JUSA 3C8DA 4L4VE 3U30B 1JRHH 3V0IA 4RLDA 3T2IE 1A1OB 1MVYA 2JK5B 5IW6A 3RHWF 1CGYA 3ULSA 3AQDA 4HLEA 5HDBB 1G43A 2IGTA 1VPOH 5LBSL 3QUXD 3DOSA 4V2CB 5IUSA 2KI6A 5D7LB 5LGYA 5D7IB 3AG2B 4WFEE 2XIDA 5DPFE 3C8KB 1WVZA 2EICA 2J7LA 3CFKB 1BHGA 2VZTA 3O0RL 2XX1A 1G9MC 3HMXH 3BGFB 5FCUH 3F58H 2D9CA 2E59A 5JT9E 3AREC 2Y25A 1CE6A 3D69A 2X87A 4KRPC 1IKFL 1B4TA 2DJSA 2R15A 1R3KA 4MTWE 1MHCA 3SD2A 3VQMA 4LAQL 3L3JA 4YQXH 4M48L 1Q9KA 3RNQA 1BFTA 4I87A 3CC5B 4MTMA 1N7MH 1II4E 4LPVA 3RZCB 2K9UA 5KW9L 5DK2B 4GRLD 4HLZG 5D93C 5CJOH 3V6ZA 2GFBA 3CZEA 2GVYA 4MRCA 4PUBL 3F28A 4IBYA 2IV8A 1ZLVH 5CM1A 4M3HA 5CD3A 3U1SL 4LLYA 1AR1D 1C08B 4HCRL 4B0MM 1AG6A 5F7WC 3L95A 3STZB 4GQ9L 4X83A 5GRYA 3N1MC 1NJ9A 4DGUA 2NW2A 4KDVA 3SDDB 5JIMA 4W70A 2JJVA 3ISWA 4H4NA 1CLVA 3ISRA 3OLEA 4OTXH 3Q6GH 4K9JA 5I75C 4PJFE 1T3FA 1ES0A 3H6AA 3DURB 1KY6A 4QF1B 2VMFA 3PWVB 1CDIA 1JPFA 2WK2A 3N40P 4WI2A 4EXKA 1UXSB 1CGXA 3PHQA 2XQBL 3TV3L 2R4RL 4MJ2A 3KWTA 3VDCA 1FJWA 1YY9C 2EDOA 1E30A 2BNQB 3OC8A 3FU7A 2VDLB 2FBRA 3VNYA 1DVTA 3JWNC 2FQDA 3C6EA 3QAZB 1CQYA 5AB2A 4JFEE 5LXVA 2GUOA 4Y2DA 3X1NA 4R4ND 2NZ9C 2C9PA 2OI9C 3F7QA 2FATH 3T4YB 4ENZA 1DSYA 1BLIA 2NY6C 3RDTC 1MXDA 5I8CB 4ZDHB 4JFPA 4X42A 4X6DE 4AQ8A 5ICZB 3MYZA 1AGDA 2R1XA 4MVBD 5I26A 2B20A 2F54B 2ADGB 1JERA 3KCPA 5T3ZH 5DD3L 2WIIA 1UD8A 2B1OA 2QSVA 1GCFA 1ZIAA 2IAMD 2UY7A 3AS2A 4Z76B 3NJKA 4KQ0A 3B9EA 2ICWJ 3L3IA 3HC0A 5SWSA 1FNLA 4KY2A 3N41F 5GHWL 3AMKA 4Q9RL 1A3RL 2YLKA 2IDSA 3L17A 3RGBA 3I85A 4PGBB 2CKBL 3F2PA 3CQPA 5CWSB 3L5WB 1NFDB 4PJBF 4X7TA 5F0PB 1FN4A 1Q94B 5KAQG 3O11B 2WBWB 3JWNG 2X42A 4TSCH 4HPYL 3Q06A 5C0JA 5JIHA 4JKNA 3ASWA 1KB5H 3QCVH 3BWUF 4TLIA 5KOVC 3V6OA 4K2UH 3NA9L 3P4LA 4B27A 2ED6A 4KMTH 4FZ8L 1KJOA 4X6FB 2D9QB 7TLNA 2NLJA 4CVXA 3GIZL 1HSBB 2HCZX 4KJWD 5JOFA 1BIHA 1C7TA 4URKA 2IALA 4AYMC 1ESOA 2DQHL 2F19L 3ZYJA 2VL5A 1IL1A 2D31B 2FEDC 3QT2A 4HMCA 4ZFFA 2UYLA 2XSKA 3SYOA 3DX1A 15C8L 2EYRB 2Y2YA 2HH0L 1XBDA 1AI1L 3QA3A 5IK3B 3NACH 5HPMB 4KJPD 1I85C 3TBWA 4PJAE 4F7TA 3MZGB 4U1JB 3A6BH 4PRIE 1G87A 1H3VA 4GW4A 4L1TA 3RVVC 4HS6B 4HEPG 3NCFB 5B7EA 3GBMH 4KKLD 3UMTA 5EUOB 4PLKD 4WHYG 4IU3B 1LWHA 2XWJA 5JXEA 1YEDA 4AUJA 3BVWA 4M5SA 5C0EB 4Q4EA 3VG0H 3B2MA 4YVNA 2H0EA 4II7A 3VFNA 2R0WL 1S7SB 1NAKL 4IRJB 4XT1C 2QMKA 2W60A 4K8RC 4A04A 4WI0A 1AG0A 1IGYA 4IRZH 4N2DA 2X38A 1VA9A 2CDFB 3M07A 1TFPA 3P3YA 4UAOB 2OJZL 3P40A 2J55A 3VAEA 5IMLA 4HFUH 1IRAY 3IGLA 5HYFA 1C16A 1O6SB 1OARH 4UT9A 2EVHA 3ZYOA 4B0MB 2X4NB 5TLIA 3PXJA 5D4IA 1KZQA 1NWOA 2YEVB 4WJG3 1XGUB 2VAAA 4MD4B 2GIYA 1JGEB 1PLBA 2ICEA 4A6YA 1KL6A 3MC0A 4QKXB 2JE8A 4BCZA 1UFUA 1YYLH 3DVIA 4LLQB 4PV9B 1JV2A 3UTPE 1QSFD 3AY4A 3WJJA 3NQYB 2WLLB 5C2UB 4AM0A 3BP4B 2OX5B 2FIKA 3E6HA 5IJKA 3OMNB 1DVXA 2Y5QA 3NFNA 1DLFL 1E4WH 4QHUB 3V0VB 1RPUA 3EYQC 2ZPKH 4KTEH 5J57B 4N5PE 4LCWD 3L2MA 3GKZA 5D5MA 4LFHD 1BX2A 4Z7VE 1FVCA 3V10A 1SF3A 1YNLH 4PTTA 5MI0C 1N5YH 2XX0A 1R6VA 2JB6A 1X9LA 2CBTA 4Y19A 1J88A 2Q0ZX 1NEUA 2Y7QB 5LQBL 4O58H 1M42A 1QW9A 3QO0B 3FFDB 2ZUWA 4NDMA 1T7WA 5HGDA 3ZDZF 3Q2LA 5I5MA 3GB7B 3NIDF 4G5ZH 3TH4T 2NNAA 4AVHA 2IQ9H 5AW6B 4NUPA 1BM7A 2NNXA 2OYPA 3UYPB 4LEXL 3SE9H 3SCMD 1URLA 2XCMC 1JDCA 3I9IA 4EUPB 2VLRB 3MA7A 3FTSA 2J8HA 2V7NB 1GA2A 1MFAH 4WQOA 2DB8A 2FQEA 3CXDL 2VDPL 4PI2A 5ESQB 3UJJH 2J8UE 5IVZB 3EJCA 4UTCA 1XGZA 3VI4A 5IV2B 1FH5H 3WIFA 1THCA 4K94H 2XN2A 1WZMA 1FPTH 2UXVA 3QPQC 4D8OA 3EYVA 1DLHB 2AERT 4G6ML 1Y18A 4PRPA 1BXUA 4H8UA 1BVKA 1Y6KR 1G7JB 3RVTD 3FU5A 3BT2H 2MCG1 3U25A 1O7DC 1TQSA 2A9NL 2EXYD 5DC9B 1FAIL 2M2DA 3LS4H 4YGVA 1GCYA 4BA8A 5AVTB 4IOSD 2H26A 4QT5B 5E2VH 1UJ3B 5EOCH 1NIAA 1WFOA 3DTXA 3DX2A 3QH5A 4JGMA 4MXWL 3ZZLA 1R0AL 3PWUB 4K5MA 1KPUA 1NC4A 2A9ML 2J1YA 3QUMA 4JX0A 3CSTA 4NNPL 4JKPH 4NJ9L 4JRXA 1F45A 3QWQB 1I7UA 1VACA 1EHLH 3FVPA 2ZUUA 2BIPA 4U6VL 1CU4H 1H3TA 3Q9PA 3FCUB 2J88H 2D0HA 2F68X 4XPBH 3RZWA 1A1MB 3DA0A 4RGOL 3OMZA 1RLBA 1KTRL 4GUPA 1QBAA 1IEBA 5I15L 5AWNH 4OZ4A 5EORH 4JPWH 1L0YA 2AEWA 4Y4FA 4L9LC 2CGRH 3QUZD 2A6DB 4KVCL 5E2UL 2BVYA 4PLJD 3UG5A 4LNRA 1ORSB 2COQA 2EH8H 1CCZA 1A3ZA 1NPNA 1JHLH 4OJDH 2OSLA 1QATA 2XICA 5D8JL 2XVGA 1HWGB 3B37A 4NNYB 3V9EA 2E75C 4L29A 3RZCC 3PWPD 1S9VA 2ROYA 4CJ0A 5J6GA 2QGCA 3MLZH 3GRBA 4MD0B 4NPYB 4WLCA 3I9GH 4PJEF 3JV4B 5FHBH 5LHDA 5EOQH 1CO1A 2DWDB 1A6VH 1LMKA 1P53A 3QH1A 2X4PB 3OKNA 4HS8L 1S7UA 2D4FA 3BUIA 4WU7B 3BIBX 1IB5A 1QSEB 1OGSA 1RP8A 2O6PA 3CLWA 1UFGA 1QKZH 2VQUA 2GCYB 3P2DA 3AWGA 4Y4HC 4F57L 1IGFL 4JRYB 4JFZH 3AXHA 4M7KH 3U36A 1JI2A 1U8HB 3B6SB 5D1XA 5F1SA 3ZSTA 3HBQA 4HJGB 4DEPB 2E46A 1OPGL 3NN8A 2VLKA 1NPJA 2AEPL 5J0BA 1CVSC 4JRFA 5I18L 4KJQD 3ARED 2VDRL 5EZPA 5EB9A 5IEKA 1A5FL 4ZXBD 4PVLA 3VRLF 4DPAX 4JKMA 4XAWL 2OLDA 1F1DA 4DP2X 2RD0A 4EQ2A 1O7SA 3GKWH 1J0JA 1RZ7L 3HUJE 3QNYB 1A3QA 3O3AA 2RAMA 3HC2A 3BPLB 5DGRA 3S5LB 3MNWB 3D39A 4LPUA 3VGEA 1PCSA 3BSHA 2IBBA 1NM9A 1DQMH 3VACA 2X4TA 5DUPH 3ARGA 5M95B 5ESVA 2AXHA 5K93A 2FVNA 5E6IB 2F53A 3SPVA 1A9BA 1YEJH 3N6YA 5L9DH 2TAAA 3PL6D 3K6FA 4FLQA 3PABB 5DTFB 1PF3A 4V1DA 3WJMA 2C7UA 4PTUA 4H1LA 4OCWH 2P52A 3IJ8A 4P2RD 2AVFA 3QXDA 5BZZA 2MQ3A 1I7RA 2XC8A 5DRWA 3L8QA 1J5CA 4MQSB 4NT6B 3G04A 4DP9X 4HHWA 5J11C 3P4MB 3WN5A 3FU9A 3BH8B 2GJRA 2Y7NA 4OQ1A 3RUGB 5DS2A 2CQVA 1C5DB 2BH0A 1UXWB 2B1HH 2NZIA 3QEQB 4S1RH 1KNOA 3GS4A 5LGHH 1GYWA 1P2CA 1K5WA 2QVKA 1S9WB 4G6KH 3D0AA 4XCCH 2ATAA 1YY9D 2N01B 3IDYC 1PZ3A 4JY5L 3OG4B 4W9IC 1NSNH 1T4KB 3PDOA 4AEIL 2LVCA 1IAIL 2ADJB 3H9SA 5EO1B 4OBSA 2E9WA 4PN6A 4HK3J 1SOQA 4MBRA 1PD6A 4CA4A 1WBZA 1YAZA 4C56D 3S8GB 2WM0A 3VMOA 4X9GA 2EC8A 4ZSOA 2K4WA 3VA6A 2YARA 1CFBA 5EO0B 1BZOA 2A4EA 3RDTD 1TVHB 1MCPL 4KKNA 3RWIA 2I5YL 1Q1PA 2VN4A 5E4OA 2VXTH 3EYFA 4PWEA 1GC1L 2VWEE 3RL2A 5I2IB 2X6MA 1XCWA 5BW7A 3EHBB 4F7EA 1AAJA 3EDFA 4B60A 4LCCA 4YSCA 3N06B 1RUKL 5GGTH 1CXEA 4JO3L 4YSOA 5G4OA 3GMLB 1IGCL 2E9BA 2R9HD 1TJIH 4KKQA 4D0BA 4GBXC 3CFDA 1P9MC 2K6WA 3B7YA 4OCNC 2XTJC 4MDJA 3MODL 4LCYA 3W39A 1GZQA 1NMBH 4GT0A 1LM8V 5F97E 1AZVA 1YEEH 4L8SA 3GI8H 4AE0A 5DFWH 1KGIA 5B4MD 1OCZB 2K70A 4X8JA 1T89C 4ZMWA 1NFKA 5KSAD 4PS7A 3DO7B 2PCFA 2DKMA 3APDA 1UWYA 1WD9A 1R5VA 3QHFL 5BRPA 2F9BT 3LNIA 2C26A 3SKOB 1EXUB 3KEHA 3QJZA 2X41A 4OLWL 3RIAK 3RIFK 2R4SL 3CFBA 3TPKA 1BQUA 2FK9A 2F7OA 3HPJA 3FH5A 2R23A 2PXYC 4OB5H 4JM2C 1JGVL 3SDCB 3SDXA 4L1DA 4TLUA 3SN6N 2IG2L 2VN3A 3HNVL 3RGVC 1QG3A 3N21A 1NCCH 1SYSA 1G0DA 2F7PA 2VUKA 1U0QA 2FEDD 3FB7A 1BZ9B 3P9LA 3QPKA 4FEIA 4LARH 4BQCA 3MRGA 4HIPA 1EJOL 5JIKA 2HTKC 2NMSA 4WNQA 4KUCF 4QRPE 2ZX7A 3IGAB 5DD6A 1ET5A 1KIQA 2VDNH 2IPTH 1G7IA 4NZTL 2AJUH 4PJ5A 3VB9A 2DN7A 4JO8A 1MCLA 2VQ1B 1I8MB 1S7XA 3DXAA 2BVPB 2BM3A 3VTAA 1OY3B 3DETC 3NIGB 2YPLA 4BQ9A 1TTRA 4MB3A 2Z4TA 3RURA 3RWCB 2CRMA 3S3PA 1E9QA 3M1BB 2OSWA 2DH2A 3QO1B 1J1XL 3MRIB 5A2IH 4K8RD 2P8PA 4L37B 5K1JA 5KWYC 2EUWA 1QSFE 5BRQA 4M03A 1TJGL 3H2WA 4I4WB 2YRPA 3T3ME 4W6WB 1R3HA 5HHOA 4MXJE 4JY4B 5JHLA 1HYSC 1T1XA 5EPMA 4TLNA 1CFSA 4NRZB 1NCUA 4N8VA 4TUUA 4AH2A 2RHEA 4BJLA 4KPHH 3FHEA 4IM8A 2PCYA 5I5RA 3WY1A 4K73A 3QUYA 4RESB 2F15A 1XF2B 3L4ZA 3V6FB 1MCWM 5HHME 1AO7B 2FWLB 3QDJE 3FT1A 2VSKB 2K4AA 1KBGH 2X7LB 1IBBA 4URTB 2JKLA 4M7LT 3WEAA 3MUJA 3VU2A 2VIRB 1JOIA 1TZHB 5CEYA 2G5BB 1N3NB 5GGVY 1UCBL 3FSWA 3L5HA 5E6SB 1ID5I 5K9OB 1RZ8A 3DX8B 3KYKL 4Z7WB 4NM4H 5JA8B 1D5IL 4NI3A 3GJEB 5JNYA 5B21A 4QXWA 1I7ZA 1HXKA 4PJCF 5JPNB 2P7TA 1XH2A 1OEZW 4WW2B 3WIHH 3FORA 3KPQA 3LIZH 1MW0A 4DZ8A 4FHKA 4O02L 1Z1WA 2Z92B 1JXDA 1LLAA 4NO3A 4RAVA 4NI6A 1H6EA 1EO8H 3ES6A 1CXFA 1HYRC 1BJMA 3NFPA 3U7WH 1AGFB 3Q13A 3S35L 3TIDB 3MSAA 3FCGA 2D03H 3KPOB 1FFNB 3EJYC 3GRWH 4MZ3A 4ZO7A 3D6GA 3FRUB 5C0RL 3MLRL 4DGVH 1UA3A 3TBYB 3GMQA 4F58H 3W2DL 4BZ1L 1F90H 4MJ6B 2BSDA 2I60H 1CZ8H 4X9IA 1H0DB 5J6HB 4OF0A 4B3VA 4D7PA 5AAMC 1GH7A 2NCMA 3SZ6A 3BP6A 2DYPB 3CGTA 4G9DB 4JN1L 1JSYA 5BOZG 4YAQB 3TBSB 4N2EA 3FQNA 4W9JC 3B2UC 5CJ8A 1EZLA 1VFMA 2NPLX 4TYUA 3QGVA 3FUHA 2HFGH 3ARWA 3FO2A 5I8KH 3T3PF 4HJ0C 3II1A 3JT2A 5E2WH 4F15B 1FLRL 2OXHA 3CFJB 1VFAA 2OTWA 2JH2A 2EDNA 4CN4A 5FA3A 3BFWA 3LQAC 4KUCD 4N90D 2OMWB 4YDVA 5I1HL 3E9UA 4M61A 2Q76B 4PSPA 4R90H 1U3HA 3EH1A 5CGYC 3FQUA 4DAGL 5D9SA 1YEKH 3D3VA 3AU1B 5HJGA 2W88A 2NW3A 3K4ZA 5IQOA 2VABB 2YLHA 4J3WA 5PAZA 3DBXA 3E9TA 1YPZF 4MS8C 2R0LH 3AQZA 3D48R 1ZDQA 2C9UA 3PV7A 3KXFA 1D9KB 4Z78B 1UUNA 3QW9A 4ABQA 1HYTA 3W0WE 4NN7B 2NXYC 3NMEA 4ONGH 3P3TA 1W15A 2APXA 3BAKA 1MHPL 1GIGL 1BQHG 1RFDL 4OLZL 3ZDYB 4CAGA 1G9NC 3L4UA 4GO8A 4WAFA 2KZ1B 3SKJH 1DO5A 3PHAA 3QJSB 1QF1A 2AJ3B 2O5ZL 1G9ML 3AT9A 3W37A 1JUFA 2EO1A 4QAMB 4U3XA 1DQLL 4JNXA 3T4AA 3MRCA 4H25A 2Y23A 4G59C 4HIXL 4YR6A 2WXNA 3ZHLA 3UJTH 2C3GA 1XWVA 2JJUA 1KBPA 4H57A 1BXXA 1SN2A 1XF5A 2E7BA 3C08H 5L6YH 1BZ7B 3F01A 5HI4C 3LEYL 1K8DB 5C86A 1IIKA 3PU7A 5I17B 2OK0L 2AQ2A 3KPLA 4LASL 3MLVL 1AYRA 1DJSA 3LKOA 4NRXB 1I4FB 1XF4A 1BWWA 2ATKB 2P5EA 4BXVA 4WEBL 3RAJL 4BQ6A 5IVXB 4AENB 5ETUA 1GOFA 3ZL1A 2ZX8A 3K2IA 4UTAA 5GRUL 1RSFA 1A7NL 5EBLB 3SYQA 1IAMA 2BY3A 3NIFE 4RMUA 2X4UB 2IJ0C 1PZAA 5F9OH 3GMOA 4RETB 5DQJA 4TNLA 2IANA 3P3RA 4U1SB 5GRJL 3AXLA 3V5KB 4Y4HD 1DQKA 5LLIC 1F8TH 1OSPL 1VAHA 1M7IA 1G6RA 4JZJA 4ZAKA 2OYLA 4EE2A 3BN3B 1NGPL 3GBNL 4FHJA 4Z7NF 4IBUA 3AZUA 4FXKA 4R97C 3KWWB 1J8HB 3RKPA 4UOJA 2ADFL 2QKIC 3GSNA 4XCNB 3BOVA 4IDJL 3Q0HA 3CH8A 5EV7A 2PABA 5D7HA 1HH6A 5AVZB 2NX5D 2P26A 1KEMH 2J4WH 4IIQB 4P2RE 5D72H 4JK0D 3WUZA 4XBGB 4QHMB 1S5IL 4CDHA 1L5GA 4DGYL 3LEXB 2QSQA 4U6YB 4BELD 1FO0A 3BAYA 2AV7A 4XVJH 5CJXC 4N0YH 4HK0A 4MHHG 1X9QA 1IC4H 1RJLB 1AACA 5EOCJ 3ME0B 3LS5L 2E56A 3SO5A 4GEJA 4N5UA 4R7DA 4N4YB 3ZQ9A 4L8CA 1NGYB 3U9UB 4Z8FL 2QPUA 3QDMB 1NC2D 4LCIH 2JSFA 1HL9A 3ATBA 4P4KD 3N43F 3JWNE 3VFWB 2P44B 5BZDA 1A7RH 1W0VA 4XC1L 1CXLA 1BWMA 4A55A 4AJWA 1E8ZA 4GUOA 1AE6L 2YXMA 4GG6B 4AKPA 3BVTA 5I23A 3ZTEA 4K23H 3D1MC 1FRGH 2FX8H 4FFVD 3VJ6A 4IHBA 2IOIA 1DDTA 1MQKL 3LN5A 4AC2A 3VWJD 4GP4B 1BEYH 2E9JA 3OKOB 1CMOA 4KXCA 2NDGA 3FSVA 1MIMH 3RX9A 2NUPA 5T33L 1FV1B 4JANB 1M2VA 5EWIH 5HDQH 3BRDA 5C07B 2X1WL 1BJ8A 4KY1L 4PB0H 5ANMA 1NDGA 2HKHL 1UB6A 3C5SB 1S8DA 3O3UN 1LNDE 4S1SL 1MREL 1E7UA 2ZNWA 4UINH 3RI5F 1HKLH 2P49B 1XH1A 3BPOB 3Q2CA 1WDAA 2CCLA 3HMWH 1Z5LA 2XWEA 1IARB 4M1GL 4R5TA 3P7PE 3EGDB 4AUUA 1U93A 4FFWC 1IFHH 1J8SA 3FAWA 4HFWB 5AZ2L 1CXHA 5ALCL 4K3JL 1RUQH 4BH7B 1FNAA 1LHZA 3PAVA 3QIUA 3RBSA 1DDHA 2XTJD 1JZHA 2XN9E 4U3SA 2FIRT 4M5TA 5KG9B 4X5XA 2X88A 4Y5XC 4FG2A 4NHUB 4LLUB 2MH4A 3FB6B 4LL4A 2YUXA 2AK4E 3UBGA 5KYWA 4GIAA 3MZTA 2A9DA 4P3CL 3QWRA 4ODWB 4MJHA 3VH8A 2KQNA 3AADB 4UNVA 3VI3E 3MJ9A 1B9ZA 1ACYH 3DUUA 2VOTA 1I1YB 4HKBB 4K8RL 2YAHA 3HZMB 6PCYA 1QFHA 1AXTL 3G5ZB 1UT1A 4NKOA 4Z23A 3O4OB 5ISZB 3CXHJ 5C09B 4IW4C 6PAZA 2XTSA 1MI5E 3VXQB 1A7QL 4MB5A 3KLKA 1G1YA 3FCTB 3UO8B 5T3ZD 5C3LD 2WQVA 5C2BL 1IQDA 2XZQH 2X5PA 2BP3A 3MX0A 4J27A 1QTPA 2D4DA 3PWJB 4KRMB 4IHOB 2G5UA 1DZ0A 4H8QA 4AK2A 4ZUUA 1XGRA 3BFOA 3CFEB 1WA1X 1U91A 1SMAA 1OAUL 2P5WA 2ZXQA 3GXMA 4FXGB 4MXVE 2WLYA 1K2DA 4OUUA 5CSBA 5JPMC 4F8NA 5AZUA 4OLXH 5DEGA 2BSRB 4AM0Q 3QCTH 5I1DA 3TBTA 3FRPB 2ZWNA 1JWMB 4C54A 3ATAA 3LKSA 4OZGA 5BS0B 4NKMA 4WFGE 1JN6A 4UM9D 4WHDA 4XX1E 3UTTA 3VWKC 1GKOA 4J39A 4NKIL 3K2UH 1L0QA 3ARFA 2DJUA 4LEOA 1BFSA 2K8MA 4W68A 1RULL 5L2KA 4FTVD 4YSRA 1TIUA 1JGUL 2ZXCA 3UTZA 4F9PC 4Q97A 2QMJA 4Z7IA 3VFUA 5IFHH 1DVFB 3FT4A 3OHXB 3T04D 2NQDA 3IJYB 3MMEA 3SPHA 5ERWA 5BMFL 5CZXC 1ETZA 5DYFA 1QWNA 4RFOL 3MRMA 1ZANH 3T65B 1JK8B 4IS6B 5JHDA 4UQ9A 1HEJC 2VC2L 2ZCHL 3UZEA 4QR7A 3C2SA 2BMKB 4HPHA 1CTMA 1KXHA 4LQFH 3ULVC 1RMFH 4G6FD 4F5CA 3AVEA 3OB0H 3H56A 2RTTA 1XAUA 4P5KA 3QZWG 5F8QC 3PFUA 4GXVH 2OZ4H 3VFVB 1KCSH 1T5XA 4LCUA 1R24B 3WLBB 1BBJB 4XWGH 3VRJA 4OFYA 4F7KA 4KNTA 5CSZB 2WJ5A 3GTNA 2I9LB 5KSBA 4JZNB 3W3BA 2DQFB 1TYEB 5KVDH 5F7DA 3QQDB 3ECQA 2J72A 1PQZA 4CL7A 5DUBB 2GSIB 4A2DA 4AW4A 3O8XC 1YJDL 3KGRA 1QAWA 5D7KD 4KXDA 5TTRA 1CK0L 2IQAA 2JCCA 5IW6B 1GY2A 3ULSB 4XZUA 1BPVA 1EGJL 3QR1A 1OSZA 5CD5C 1QFWM 4FL4B 1CLOL 1IGML 1SOXA 2R2BA 1PG7X 1AD9B 3IU4H 1KBVA 1VFBA 4XCFH 1HHIA 3LJ3A 1WS7A 4NIKB 5FHAL 2B5IB 3NSDA 4IKLA 2D7TL 2ODIA 4ICXA 2V0AA 4OGYL 2G60L 4I3RL 1FFPA 4AMWA 4PJGE 3L5JA 4G42A 5DXWA 3LQZA 1OW0C 1MCSA 3EJYD 5HGBA 1MHEB 5K59E 2ZKMX 2JKWA 1KENL 3D69B 3KYAA 4I2XE 1D9KC 4Y88A 3D06A 2CJUH 1MHCB 1NBVH 1WFTA 6CGTA 4NN7C 1O7DE 1Z6JT 4TQEH 3FTGA 2A74C 1G7PA 3ECUA 1Z9MA 1Q9KB 4PVBA 1RUAH 3RNQB 5DQ9A 5T3XL 1E8XA 1MRDL 4MNGE 5KJ4A 3DWTA 2X40A 1H3WM 2FSDA 4KC3B 2G2NA 2YSSB 2Y07L 3MS3A 2L4OA 4O4YH 4P99A 4S10A 5ICXA 3MN8A 3AB0C 3HFML 3V6ZB 2GFBB 4MJ4A 3S3SA 3CBRA 4JRWA 4MCYA 2XBZA 1WEJH 5HHXL 3C60C 4Q9BA 2H0JA 4XRCA 3BSGA 1MAML 4G72B 4LLYB 5CD3B 1HZHH 3BH4A 4P5TB 4OD2A 3CC1A 3L95B 4FG6C 1SMDA 3LQMA 3VM5A 1OOAA 2OMZA 4A63A 3PP3K 5T3XE 2W80C 1NJ9B 4I8DA 4QO1A 2WUBL 1NBQA 5GGSA 3KDPB 2XETA 1Y0LA 5JW5A 4QOKA 2E7MA 4X7SL 4LB8A 1T3FB 1ES0B 1U8LA 3GBLA 4G8GB 4ZQKA 4LOVA 3V4LA 5F6IC 5IBTL 1FNHA 3NABH 5L88H 1PSKL 4EDXA 1SJMA 1YMMB 4JFOB 4LVOB 3FU7B 5LBSA 2V37A 3ZT5A 1PZ5A 4EBQH 4HT1L 3CMOH 1JF1A 5CEZH 3NRQA 4XPTL 1UH2A 3KS0H 5DD5L 4Y2DB 2BZDA 3NG5A 3BH9A 2XXGA 4Q2ZB 4ZMOA 3HEIB 5IB4B 1DBKL 3BLKA 2YA1A 3RFZA 1TEYA 4YDMA 2V6HA 4JFPB 4JHAL 1JPGA 1E50A 4KRLB 4PQXA 1E6OH 1VGEL 1W2KT 2YEQA 4TVSa 4TULL 2FTAA 4LSPH 4GKNA 2H4EA 1KCLA 2VH5H 3KCPB 3EDJA 4UCFA 1P7BA 5LNEA 3NBNA 1LK2B 5IESH 3AWFA 3D87B 3L3IB 3HC0B 4RH4A 5EN2B 5SWSB 4PJHE 4YSDA 5DEFB 4NO0B 2W9DH 4NO2A 4HOZA 4ZYKA 4PRNA 1M1XB 5C6PB 4NENA 3QXAA 3FQRA 3LTVA 4B6ZA 4LRNH 1VPOL 1JFHA 2Z7UA 3B5GA 1OCOB 3BKYL 3D18A 4UDTB 4WFHE 2GABA 1IC1A 4X7TB 1WIOA 2NR6D 2YSTA 2Z31A 5F9WB 1FN4B 2NX5E 3S4SA 3GXTA 4NZFA 2MFNA 4FX5A 2QELA 4CC4A 1DQDH 3CVCA 3HMXL 2E9GA 4HCRA 3F58L 1IGJB 4AGQA 1EVUA 1MCKA 1MCRA 4TV3A 3QQ3A 3HVNA 4KO6A 1AD0A 4GQQA 4JFEA 4M5YH 4GH7B 4QTIL 4Y1AD 5DR5L 4Y16A 2VDQL 3VFOA 2WLJA 3NZ8B 1P4UA 5JOFB 4HZAA 2OR9H 1P1VA 2CPCA 5GS1B 4X6DA 5FKAA 1JZ3A 5J6SA 2EEDA 2O6EA 3GXNA 3VX0A 2MQ0A 2Y1AA 5B38A 3QIBA 4QD2E 2ZKHL 2CXKA 3MYJB 3ARDD 2WWKO 4FN0A 3WAKA 3OKLA 1YYCA 2XV2A 2MHAA 1OT1A 3CFUA 3TBWB 4NQED 2AI0H 3EJJX 1JPST 2HUHA 3A0OA 3LB6C 3K6IA 5I6KA 5D4HA 2A9BA 3OD3A 4ZTPH 1AHWC 1ANUA 5EU4A 5GSVA 1ONQA 3IKKA 5D7JA 5IGXH 4OCRH 2X1QA 2DTSA 2XWJB 2ZOLB 1YEDB 1LNFE 4XB8A 4HD9A 4XO9A 1BD2D 2W0KA 3RTQC 3VFNB 5DA4A 1WFIA 1LO5B 2W60B 2ZJSH 3HN5A 5F96L 4NQVA 2ZNXA 1URIA 4PJXE 1C16B 3NZHH 3NJNA 4PR5A 5HTSA 5IHZA 1A9VA 1X5HA 3ATFA 4EDWH 4NQTA 3APFA 3MQIA 1U95A 1E2VA 2FATL 2ICEB 4A6YB 4ZMTA 4RZCA 4ZFZA 1YEGH 1HFUA 3V5DA 2A0LC 4LLMB 2Q8BH 1FDLH 4OJYA 4DZBA 2PP7A 2XTJE 1JV2B 2WO4A 2IWGA 3T8HA 5T3ZL 4PG2C 3TEUA 1HHGA 4AM0B 1RIVH 1X3DA 5CHNB 4Z3EA 2YA2A 2FIKB 4PJAA 4HUUA 5FO8A 4PRIA 4YOKA 3VYOA 3GSXA 2EDLA 4PU2A 3PJSA 4K3EL 2PCPA 4XP9L 1F86A 2VW6A 4YS4A 2C8NA 2EUVA 4WDIA 4TTDD 2FR4A 1XIWC 3BW9A 3IFPB 3JTSA 4OGXL 1TYRA 3TZVD 1BX2B 1FVCB 1QLFA 2H2SC 4PTTB 1WC7A 1MCOH 1A22B 4KOBA 5LWDE 4ZNEE 5TF1L 4Y19B 4DN4L 3S37L 5CNHA 3IPEA 2XXCB 5T3ZE 1FC1A 4OM1L 3G5XA 3LEVH 4LEEA 4KDTA 4NDMB 4UYPA 5HGDB 5HY9A 4ELKB 3D2UB 1OB0A 4DGIH 2DQIL 3SE4C 4ZW5A 5F0LB 3L4TA 1L9PA 5T1LA 4K2UL 3QDGD 4KMTL 3JV6A 4JDVA 1PVHA 1B0GA 3V0DA 3MA7B 3GSWA 5E8PA 1KR6A 1AGBA 2Z8SA 3EZ8A 2BCMA 4N6QA 5C0AE 4RGND 2VSCA 1GGBH 4JFHD 1Y6NR 4ZUVA 4BK5A 3VI4B 3WIFB 1CICA 1YHPA 3GTTA 1TU2B 4FTVE 3AITA 4PWFA 1HAUA 1RZJH 2Q5BA 2W0FA 1RVFH 3GS7A 3FJTA 4NX0A 1WTLA 3NACL 4PRPB 1TETL 1BVKB 2F58H 2EIEA 4RDQF 4MNQE 2MTAA 2QQKH 2IF7A 2CG9X 4LLAA 2LAAA 4ACTA 2Y7OA 2W65A 4Z7VA 2H2PC 3TA3D 2HP4A 3KLHD 2OMVA 1H5BA 3DTXB 4I9XA 5GGQH 4YLBA 2ZUXA 3VG0L 3ZHNA 1F6FB 2DMHA 3C5XA 1FIEA 1SJHA 4NB7A 1CGSH 2ZOWA 4GRWE 3MI6A 3FHQA 2IOOA 1MCHA 2WN2A 3NJHA 4LP8A 5KBKA 1ZHBA 2IADA 4WENB 4JRXB 1I7UB 1VACB 4FD0A 1TNMA 4FL4C 3DJSA 4JFQA 3PAYA 1T21A 2ZWZA 5FO9A 4Y4KA 5A7EA 4IJ3C 4UZGA 4MJIE 1RH8A 2DICA 4IKIA 1ZTXH 2VISB 2OMBA 1TMNE 4GUPB 2ATPA 4DSYA 1IEBB 3GLEA 1E27B 1X9RA 3IJSA 4OZ4B 4CGTA 1PW3A 4LU5H 4WZ9A 2WZ0A 2MJWA 2F08A 3D9AH 1JXKA 3ETBF 3FZUD 1J10A 1YEHH 3I6KA 4LNRB 1BM3L 1SY6L 4APXA 4NP9A 3WS3A 3WTWA 4HVBA 1JNHA 2OSLB 2WP3T 1O75A 4JEGB 4OLUH 4CRPA 3MV8D 2YA0A 1FJTA 4L29B 5J6GB 1S9VB 1YA5A 5B1AB 4YSPA 4WUUD 4RIRA 4Y1SA 2A6JA 4AGOA 2ZPKL 4KTEL 2D2CC 5JA9A 5F7HA 4B50A 3O8XD 3ZN6A 3IDXH 2UV3A 3OKNB 4HJUA 1J9RA 1IAII 4P2OB 3K1DA 5CD5D 4KOCA 2APBA 3IGFA 1UWFA 1C5CH 4O58L 1VADA 2D7QA 4ZUWB 2LHAA 2WQAA 3APNA 5MEND 5E7BA 1ET8A 1BYOA 4G5ZL 2E3VA 2IQ9L 5IMKB 3NN8B 3NCEB 5H8DA 3CCHA 1IEHA 2OMTA 5EFIA 4NS0A 4PJ7A 3LHPH 1XFPA 1OV8A 1KPRA 5LCVL 3W9DA 3HRZA 1BXAA 3EH3B 5IEKB 3P2TA 1MFAL 4EUPH 4U05A 5I66A 2YD7A 3KG5A 1MWAH 3UJJL 4F7CA 1NFIA 2KZWA 2VB5A 4YDIH 2CCVA 4Q7DA 1SN5A 3QUXA 1PDKA 4HALA 1LJMA 2JKRM 2VKXA 2YOAA 1G9NL 4M00A 3D39B 3PYCA 3QDAA 1P7QD 2WVVA 1FPTL 1I9RH 4Y7OC 1A4AA 4UT6H 2X4TB 3ARGB 4HSQA 5ESVB 4HG4J 1N10A 4HUMB 5AKRA 1UWXK 2D3VA 2RA1A 3VGBA 4L3ED 4Y8AA 1MFDL 1A9BB 3PWLB 2R56L 3S97C 4GMTL 3SPVB 1KB9J 4WO4B 4JW3A 3UZVA 4AQ8C 3AQYA 4V1DB 1LNCE 3WJMB 4C59B 4ABVA 2C7UB 2ZUTA 1OGTA 3LS4L 2WNGA 4PTUB 1JD9A 3VXUB 3JT0A 2DQTL 4FG6D 2L7UA 3UROR 3ZQWA 4KITB 1BSIA 4XP1L 3BP5A 2ZCKH 3QAQA 2JVUA 2EXWD 2H6UA 3KPRD 1UM5H 5SX4H 2JI1A 1DQVA 1JK9A 1RK1A 3WN5B 1EX0A 2FJGA 3H9HA 4Z0BH 3BVNB 1WAEA 4OKVA 3GBDA 3LZOA 2ZWKA 4AGLA 5CU9A 4JDEB 5F9JA 5I0ZA 4QLRA 1S5HA 5K33A 3GSRA 1Q1JL 3H9SB 3P4OA 2BERA 4XWOC 1LO4H 1J9QA 1KXTA 4GXUM 1PY0A 4YC2B 4YHKH 1WBZB 4IOFC 1H3PH 1GXWA 2VL4A 3TVMA 2XVKA 5EORL 2A77L 3MBED 4IYKA 4L9DA 4P07A 4GERA 4GAAA 1I9JH 1Z32X 3BZDA 3ZRCC 4B53A 4E5XB 4ESKA 5DYOA 4BSWA 3BD5A 4JHBA 5T5FH 2I07A 1F42A 4X5PA 3RWIB 1JHLL 4YHIA 5L8PE 1MFBH 1J5IA 4LDOB 4AEFA 1UZ6E 5B8CA 2WANA 3EYFB 4JQVA 3FSOA 5FGSA 3HE6D 3ARBC 4G83A 5D2LF 3VXNA 1DANU 1AKJB 2BZ7A 2WZ5A 4EI5B 4LCCB 4PLOB 2MKLC 5IF0A 3I9GL 3ZZ1A 4M6ML 4FXLA 3Q1SH 4IU2A 4ODVL 1QA9A 3N44B 5A3IC 1A6VL 4D0BB 5DD1H 2GAZA 4Y1AE 3VM7A 1BVLA 2NNFA 2YC1A 4MDJB 1T1WB 3QEQE 4N1HB 3QBTB 3L54A 3BE1H 3HKFA 4XN7A 2K78A 3DBKA 4GXUN 2GJ6D 5CF3A 2DS4A 4L8SB 4AITA 3MRFB 3ATEA 4P9HC 5DWUH 4N0UB 3DVNA 4X8JB 1IQWL 3WHXA 4F9LC 5KYNA 3LNGA 1HCFX 1M6UA 2PCFB 2IAMA 1L9OA 3BHBB 1R5VB 3TJHD 3VXRD 5E4IA 4ELDA 2WLKA 2LLLA 5KSUB 1OM9A 3BIKB 3C6LB 5AEAA 2PTVA 1MAKA 4OLYH 3ZIYA 3GKWL 1S3RA 3VB8A 1RIUH 2RB8A 3HPJB 2YEZA 5J13B 1DQQA 1KCWA 2GBAA 3D4GA 3N2JA 1SEBA 1UHVA 4U1LA 1DQML 3BEVA 1ZGLB 3P9LB 3FB7B 4I0PD 4MMZA 4PGDA 1OGAB 3FFCD 2HRLA 3MRGB 5AAWC 4Z7OF 5JZ7C 4WWNA 5KVGH 3D50A 3HI5L 2BNRB 5F6HI 4WNQB 1DBBH 3N55A 4QHPA 1BQLH 1PKQE 5DD6B 3L9EA 5BUPA 3FAXA 3A23A 3WG7B 2BVEA 2NUTB 3AY4C 3EJPA 1G7IB 3I50L 1SLWA 1A2YA 3GXFA 2XLLA 3MLXL 4HWZB 4OCWL 3FB5A 4PJ5B 3U4AA 4EI6A 3IMBA 1E4HA 1S3KL 4AR8A 4OI9A 2X4OB 5LVEA 5CGMA 2V2XB 4JG0H 2Y2WA 2YPLB 4XNAA 3RTQD 3D07A 4GIOA 1S7TB 4P23A 4S1DD 4F2ME 3CFCL 3KS0J 4S1RL 3KJ6L 2P8PB 3LZNA 3GHEH 5DMKA 4ONHA 3BC9A 4LGPB 4HLJA 3T0ED 4YXHH 1R9FA 2WXHA 5T8IA 4U33A 1R3HB 1A25A 3FBQA 4P0DA 1AOZA 2GPZA 4JGUA 5DSCA 5EPMB 1HKFA 5GS2H 3WYRA 3K2KA 4N8VB 4AH2B 1TCMA 2VQ4A 3K8LA 4JFFB 3RU8H 3DTUB 4W9FC 4HU8A 3TTYA 4UM8A 1WWBX 4KX7A 3RJDA 1JNJA 4OZFA 5DPEE 5CEYB 4ZW7A 1T80A 3S96A 4A2MA 2TRYA 2OCJA 4K9EC 3KBPA 3L13A 1JWUA 1SLXA 5IB5A 2VXTL 3PIQA 1KMGA 3JYCA 4XI5D 5D6DA 3ESUF 2FT7A 1RZ8B 5HYSG 5SWZE 5T1DH 1LP9F 3KM2A 1DQJA 5SWQA 5GGTL 2P7TB 4NN5C 3F5WA 3KPQB 4M6NL 2A4ZA 4TRPH 5D7SL 5TE7H 4A67A 4DZ8B 4W9EC 3GGWA 3WFZA 2DOCA 3CAFA 4UMGA 3SDYL 1JZ7A 3SPJA 1QO3B 4NFDA 1GY1A 2NY1B 2XIBA 2J71A 1T2QL 3QQNA 4NO3B 4DW2L 3ES6B 5I1JL 4FLRA 1GSMA 4JFHE 5DJDB 5C6TH 2WJ7A 5CXPA 2OMUB 3U2JA 3UBHA 1QSFA 3DV4B 1BMGA 3UTOA 1PZ2A 3FW6A 4UUJA 1AQKL 1PYWB 5CUSH 1JD7A 4G82A 2EYTA 3O3DA 5FO2A 5DHVB 3BUBA 1SFDA 3IS1X 2WPGA 4JPKH 3MU3A 3GMQB 3D08A 3EOTH 4U4BA 3DECA 4QKTA 3G6JF 4LCWA 1OT2A 4LCVA 5L7XH 5FKPA 4NZ8A 3ARXA 4IBSA 3A67H 3OLGA 1OK8A 4X6CF 1F4YL 4LZKA 5TFSL 5CLTA 3VFSA 4PJDE 5TE4L 3ULVL 3DO0A 4PJBA 3FO2B 1EFXD 4LARL 2W9EL 4G1MB 1IAKB 3DX6A 2ICCA 5J9PB 2OXHB 1VFAB 2FYYB 2OTWB 3X3FH 4UILL 4Y4FC 1X5XA 2ERJB 3MLWH 4FQPA 3SCMA 3B8SA 3EJZD 2E74C 4YDVB 2AJUL 1AZRA 3ZGHA 1U3HB 4BRVA 4N9GA 4LEBA 5JIDA 3ULVE 3FQUB 2F8XC 5D9SB 4A2HA 5E5RB 2P45B 3D3VB 3FF8A 32C2B 4MDRA 3WKNA 4AMKH 2NW3B 4EMZA 4ECNA 5FSSA 4OFQA 3WFHA 2VR8A 4ELME 2H45A 4M1CD 3DBXB 3GUTA 3CN0A 2JKJA 2A9CA 3IDIB 3NSJA 2NTFA 4W9KC 4MYWB 3UYRL 5I1CL 2R1YA 2GC4C 1GJIA 2X53A 3MV8E 4IGBD 4NWUH 5ABAA 5D1XC 4NQSA 3ILQC 2OP4L 3RWFA 3VTTA 1JUFB 3O4LE 4WF7A 4IOSA 3WTUA 3T4AB 4QDGA 3VTMA 4H25B 12E8L 4J8RA 1SXBA 1KBGL 1UB5A 5DT1L 1FGVL 1U92B 1U8MA 2Q3ZA 2R29H 1OVZA 1PZCA 2YAQA 4H20L 1TCRA 1U33A 4RGMB 2J43A 4BZ1A 2CRIA 3HBPA 5MENE 1TJXA 4O51A 4ZD3H 3LKOB 1KN2H 4L8BA 1XF4B 1Z9SA 1MJUL 1U8JA 3V0HA 3ZE2F 3OV6A 4HWBH 3WIHL 5AFAA 1J8RA 1LK3H 5ETUB 3VFRB 5GISH 2XHNA 3QCUH 1CLZL 1JNLH 1RUPL 4HSCX 1FZKA 3SE8L 3I6LD 3K71A 2J44A 5KANG 4V11A 4FNPA 1XSKA 2VERA 3HG1E 2IANB 4OSUH 1DN0A 4FS0A 3MROA 3AXLB 4YUEH 3TO2B 4QRRD 4FCHA 4PWGA 1VZIA 5AOIA 1M7IB 5T1KD 3W0WA 2D03L 1ZXQA 2FCBA 2N4IA 3X12A 1TITA 3GRWL 1RZFH 3L9BA 3QJVB 5CZVL 3I74A 4L3EE 3NUKA 2VXUL 3PWPA 2FX7H 1MVUA 4PCKA 3GSNB 2Z8VC 2XFXA 4B7IA 2L04A 4CBZA 4Q4IA 2F7RA 1EO5A 1I1AD 1UYWH 4U1HB 2WHVA 3CN1A 2CO7A 3F7PC 4UQ3A 4BQ8A 4S0HA 2YMXL 1CTNA 3KPRE 2HFGL 3O2WH 4QHKJ 1EAJA 1L5GB 5E4EC 3OQRA 5F2FA 4OCMC 4E9LA 1KELH 2AV7B 3UMNA 4YBLC 4HK0B 4B9ZA 4W4OA 3TPUA 1A6ZA 5AYQA 5HDBF 5TGBA 1A6WL 2VDOB 3S88L 1U6AH 3EOBA 5JORA 2YO3A 1CB4A 1J1OH 1KJ3H 4R7DB 5DRXA 5TDOB 4L8CB 3AREA 4H1LG 5D7IF 1XL4A 1Z3GH 1BF8A 4ZXBA 5DS8A 3KLAA 1IX2A 4UOQA 4E9VA 2WGNB 2CHDA 4R90L 4I18A 3QEUA 2PR4L 4YHPB 2EEXA 3G9AB 3MXVL 5DO2C 4LCCC 5BZDB 3HG4A 3MV7E 1W0VB 3DMMD 2R0LL 3NSYA 3H3KA 4GRMA 1I8KA 3H1ZA 2IOMA 2CALA 2BIQA 3UCQA 3LRGA 4A2GA 4RMVA 4ONGL 3VJ6B 3ESVF 2DM4A 3PL6A 3LN5B 1YSOA 1H3UA 5LBVA 1W91A 4Y0GA 4LMQE 2IDUA 3BKMH 3BZEA 4HV8A 2ZX6A 1RJYA 5SV3A 2XWCA 5TQ0H 4P2RA 2AJYL 1NCHA 3OX8A 4OZIE 4TKWA 1JGLL 3BD4A 1KLGA 4H0GA 3UP1A 2VR6A 1NDGB 3C08L 4PW4A 2JTYA 3UG3A 1HSAA 1UB6B 4J3OC 4YZWA 4KMQA 3GSQB 1S8DB 3P7UE 3HLAA 1E4JA 1NMCB 1UQSB 2YPVH 2Z35A 4I3GA 5EIIB 3T0VA 5KS9E 5I74C 4M6OL 5L4IA 2AXFB 1FHNA 3QFJD 1Z5LB 4RRPG 1JZGA 4U6TA 3B9KB 3BVDB 1T22A 1U93B 3NJIA 2EQDA 4IBLT 3VXRE 3ARBD 1E4KA 3U2IA 1N6QL 2O1AA 2XZCH 3WJLC 1URZA 1I9IH 4ZFGH 5EF1A 1SVZA 3EBIA 2IFFH 4G80A 5CILL 1CDJA 3GZQA 1R33A 5A3ID 4C56A 2MNJB 1CD9B 4YHYC 3ET9F 5F1NA 4EQ3A 3QIUB 2ZF9A 3ATDA 3QB7C 3ESOA 4HZLA 4U3SB 2X70B 2VZ3A 2DI9A 3RDTA 2QZ5A 1F8TL 5ENWA 1MN4A 5CEZD 3MDJA 2AC0A 3V4VH 1UCTA 2DQEH 2A6IB 5HDOA 3Q8AA 4F24A 2X2IA 2OR8A 4PWIA 3CX5K 2CLRA 3VH8B 1LO0H 1PY9A 5HHVH 4J3OG 5J7CC 3DUUB 3GHBH 1UD3A 5L4MA 3L3OA 4H2CA 3DGGA 3ML8A 3BZ4B 1KKKA 3I2CH 5MEQB 2ITCB 3SY0A 1ZT4A 1GW6A 1KEML 1G7LA 2EIBA 3TONA 1ZT1B 3NCCB 1IQDB 4P4RA 2NT0A 4KRNA 1W16A 4QY8A 3MX0B 4ZX4A 1VEPA 2QZQA 4FYRA 4NHCL 4XVJL 4FQQA 1A65A 5FW8A 4XAKD 2CK0L 1XGRB 1Y1UA 3QUYC 1U91B 1IC4L 4KQ3L 2P5WB 3P54A 5B3NA 1IT9H 1K2DB 1JZJA 3V4PA 2VZSA 2B4CH 1NFDF 4ZOBA 3T8XA 5IQMA 3ZI6A 4U2YA 3LKSB 1VZGA 2FGWH 3L4XA 4NKMB 1JN6B 1IGIH 3UTTB 5IHHA 1J87A 2B7DT 3N3EA 4LSDA 3MTRA 4JFSA 1P7KA 1X5YA 2XKUA 2FT6A 4LCIL 4NUGH 1U42A 3DRQA 2XN9A 3HG5A 4P9ML 2CKNA 3N85H 1FVEA 3WS6A 3BQUC 5IFAL 5FS5A 1A7RL 4YWGH 3UTZB 3LKRA 3VFUB 2VDKH 3FT4B 5KVMC 4OI5E 3FXPA 1I3GH 3J07A 3NFSH 5ERWB 1XMEB 1PE5A 1ETZB 4YDNA 1TKWA 3TFKD 1VERA 3VI3A 4BSVB 1E4XH 3U7AA 4B9KC 1BEYL 4MAUL 3O6LH 4MMXB 4HIJA 3SBQA 3L3HA 3Q8CA 1RJCA 3SOBH 4DPRA 3HJEA 5HDQL 4P5KB 2MCPH 3FHAA 1KYUA 2EDEA 3JVFC 3S48A 4I3SH 1E65A 1T5XB 2XOTA 4LCUB 4P3WA 1L9NA 4MNHA 4XNZB 3FQ2A 1CG9A 5E8DH 4HISA 4UINL 5KSBB 2DI8A 4AQEA 5EUOF 3WNIA 5FSPA 3HMWL 3IVKA 5CR1A 3FUFA 1KACB 5DJ2A 3FFOA 3SDDD 1PQZB 4D9QE 2PUQT 2O26U 4JG9A 3Q44A 3MHZA 1SUJA 4UNTA 4AT6B 2ID5A 3EBGA 2IQAB 2JCCB 4XZUB 5I1IL 1OSZB 3KD4A 1ZHLA 2X2UA 5FUOL 5EU3A 3VRIA 5JW4N 3FPYA 1KGWA 2R2BB 3VGHA 5C0CE 1FL3B 4JPSA 1HILA 3NVQA 2BNQD 1HHIB 2DTMH 2ZYHA 5MERA 2CR6A 2XVBA 1ZLDA 4QRSA 1U3HC 4I0KA 3S8FB 4GNKB 4EIZC 2XG5A 1EO7A 1KFAH 4O9HH 1XV8A 5I28A 2BHUA 2KYIA 2HKAA 1NZRA 5J12B 2PW1B 4BBWA 3WTXA 1CF8H 3LQZB 4GI8A 4X8GA 1GYUA 5FGBA 5KYYA 1ACYL 1CGTA 1QUNA 4DO6A 1GGIH 2EDXA 3VXMD 2WWMD 3SPIA 4YK4C 5GRZA 1ZT7B 1BIIA 2Y2TA 3V52H 1TZOA 4X9HA 2F54D 4LSTH 3FTGB 3SGEI 1SXAA 1G7PB 4N2MA 2DLEA 2P1YA 3TM6A 4UQIM 5FEBA 2H6OA 1SNRA 3N42B 2FO1A 4H26A 2YXVA 2J25A 3WTVA 3L4WA 1RZKH 4OCXL 1SXZA 5F89A 5ICXB 1B6DA 3S5YA 2VXVH 3TF4A 4R26H 4TUKL 4WHTA 4OLXL 5FDWB 3GXUB 3QCTL 2CO6A 4MCYB 3IFLL 4L4VB 4NP4L 3I02B 1R17A 3ZUCA 1T4WA 2AQ3A 4OF3A 5L0QB 2ZXWB 2KMWA 4XNYH 1MH5A 2HA1A 3K2UL 4JQIL 2OMZB 1HIMH 4RISH 4NCC2 4QO1B 3GMPA 5GGSB 2B9AA 3RKDD 1Y0LB 3R0NA 5G4NA 4JFDD 3CD4A 3S3DB 4A2FA 5IFHL 3OSKA 2WQWA 1EEZB 3D8MA 3MOBL 1U8LB 1KTDA 1PY4A 4ZQKB 3L16A 1E2ZA 1T83A 3O6FD 2R8SH 4N5EC 4PJGA 3IDJA 2AJVH 3QORD 1B3IA 1NANH 4EDXB 3KDMA 1U58A 2AVGA 2PW2A 3ABMB 4P06A 4F3FB 1N5AA 4U6XB 1PZ5B 3MRLA 3PHSA 3ZL4H 1RURL 4JZJC 3BCDA 1YQVL 4JFYA 4ZAKC 1JF1B 1MFNA 2UUDK 4MWFA 4DVRH 5HVHC 5LNDA 4KZDH 3ILQD 3QP3A 2QQNH 4JY6A 4MNGA 4FXKC 3PP3H 3BH9B 4WWID 2XZAL 5E99H 2HRGA 3MRNA 2EDHA 2C9QA 2KKQA 3MTXA 5KVFL 1JPGB 2DMCA 4UOW1 2WV3A 1FZJA 2BP0B 4F8QA 4GKNB 4XMKL 3HPLB 2V17H 1ASPA 5BQ7A 1EPFA 3ZOAA 2X6AA 5EO9A 5AW3B 1DSWA 3TNNA 4NO2B 1J5DA 4ZYKB 4PRNB 5BO1H 4IRJD 4HBCL 4GMSH 3FQRB 4I77H 4M4PA 3UIYA 3LKQA 4IJTA 2MPAH 2Y22A 2C3VA 4ZTOH 4N8CH 5KVFE 1B4RA 2HKFH 4PJFB 2K3TA 3WY3A 3IU4L 1PAMA 5FYLH 4XCFL 2EE0A 1QPPA 5H37H 2BRRH 1TTUA 2XPGA 5HD8C 5HVGB 3S34L 2Z1PA 2B77A 2EADA 1LO3H 2DY2A 3FUKA 3QUKA 1D5ZA 3ZK0A 2VXSH 5AZEL 5IT2L 4BH8A 1KGJA 2LLNA 3QQ3B 2ZUQC 1QASA 2CGYA 2WD0A 4KAQL 3QARA 2JJTA 4JFEB 2Q2LA 2CJUL 1FQ9C 2KUTA 1NBVL 2LLGA 3N1PC 4Z5RA 4Y16B 4HHGA 5FV2A 3VFOB 3BAXA 5IBUG 4DQOL 5IY5B 1ZPUA 5DDHA 1FJOA 4TQEL 1QNZH 4BWWA 3PFQA 4M29A 3T8FA 2BOBA 4HUKB 4R83A 4LSVL 8PAZA 4ZBJA 4X6DB 5FKAB 5K39A 4FQXD 4G7QB 4L23A 4JKKA 5B7FA 5EZLA 5B38B 3QIBB 1CBVL 4Y4HA 5I0DA 1OP3K 3GPSA 3VMPA 3DJRA 3WKMH 2VLME 1O6VA 1TO4A 2BWQA 3SO3C 3OKLB 5FM8A 2IGLA 3BKCL 5L2JA 1G1KA 2MHAB 4IMKC 1PBYA 4PJHA 3H3BC 3S35X 4FA6A 3PRZA 1HZHL 1JWSB 4F33A 4HKXA 4YPJA 1JZFA 1XCTA 3CK0L 1FSKB 1ONQB 3L2NA 3FTXA 4PHXA 5AOLA 5AW0B 5BXFA 4YEEA 3LY6A 5GGRB 2NX5A 1SGKA 1L6ZA 1L3FE 2G3XA 2LTQB 4JDTH 1AIFA 1GS8A 2D73A 4XXWA 2X44D 3G5WA 5T5NG 2ZAIA 3LN9A 4NQVB 2AF2A 2CKBB 2HJFB 5C0NC 5I6LA 3QFJE 5IJVB 2WBJB 1KSRA 1QFOA 4F8PA 3WAJA 4FNLL 4QCIA 5DVNA 3B8YA 1A9EA 2YUVA 3BN9C 4W9GC 1NC2A 2KC0A 1EVTC 3BPNB 3HMXA 1U95B 2XN0A 1PL3A 1KJVA 3BGMB 4RZCB 1KULA 4MCNA 1TUPA 3S0PA 2VYRE 4HA1A 2WYHA 4KHXH 4L05A 3RWEA 2QFPA 4GKLA 2HJLA 2V2WA 4LSPL 1WH0A 4LGSB 3RIAF 3RIFF 3UEQA 1HHGB 4FFTA 2G30A 1KWKA 1J0YA 4PJAB 3TN0B 3FN0H 1LGVA 3X3GH 5FO8B 5I9QB 5IESL 4PRIB 1VESA 1JCKA 2YQBA 5ALBH 3FGDA 4AJYV 3UAEA 5GS3A 3VWJA 1FC2D 1I53A 3CHSA 2FSEA 3FN9A 4PP2B 1MJJB 4WDIB 4WEEA 5FM5O 3FDWA 3GDCA 2FBJH 4XVTH 3BW9B 3JTSB 5C0BD 5I0XA 3RUGF 1KWGA 2DQDH 1QBMH 3FSZA 4LRNL 2ZOKB 2FD6H 2GG1A 2WYZA 1T0MB 2DQMA 3QRFM 3I75A 4G6JH 3CVIL 4BFOA 4FNQA 3X1GA 5KBMA 3N91A 3G5XB 1RJZA 4KK5D 3GSUA 3MPCA 1UGKA 3ARFC 4FABH 5CP7A 3OAWA 5HY9B 1NDTA 2JELL 1BEXA 3QJRB 4PJXA 3K5RA 3KYMA 4G9FE 4P49A 4EN3C 1TJMA 1XB8A 4HXBL 3UFIA 1MRCH 3CSYA 1QX1A 4JDVB 4M5YL 4PBDA 4PVMA 1B0GB 2FLBT 2XPYA 3GSWB 3FK3A 1RKRA 1UH4A 4U6HB 4Y5VA 5E8PB 3RPKA 5JHMA 4HIEA 4XC3H 5E8OB 4AC4A 4QRQB 1A7PH 5C0FB 3UADA 2OR9L 3ZKMC 5DRNA 1TG8A 3UZEC 1P9MA 4M4RB 4OW3A 4K71C 1HH9A 1CICB 4XMLH 3SKNB 1LTXA 3CHXA 5E03A 3LN4A 1N12A 3NCWA 2W0FB 4HH9A 1BZQK 5FAAA 1Y3GE 3QUHA 3B2PA 1SDAB 1SDDA 5D5ME 1FVDA 4LF3A 4X4KA 2AI0L 3UC0L 2O6CA 3BD3A 4ZO8A 1QSED 1ETJA 2W65B 3EJUA 4N28A 4RDBA 4Z7VB 5D1QC 4XN1A 4KKBD 4JRYD 4BFBD 2OMVB 2WXLA 5IGXL 3IFOA 1OZTG 1WJ3A 1H5BB 1HT6A 4XHJC 3VW3L 2NDFA 3QDHA 3PGCA 4XNUL 5E9DD 4OI7A 4DOHE 3KR3L 3BQUD 1SJHB 4RFNC 3ROOA 1S7QA 5D70H 3R06A 5CCKL 2IADB 3RDJA 4M7LL 1UWEH 2OV0A 2ZJSL 3EJSA 4JFQB 4J5VA 5GGVL 4FKEA 3W1ZA 1XT5A 4MMYA 4Y2OA 2HRPH 5FO9B 3T2HE 4Y4KB 2NY5H 3AWEA 2YKKA 3NZHL 3CWGA 1R5WA 4UM9A 3UBXG 1BAFL 2J8UB 4JMXA 4APQD 4Z6AT 2AQTA 2NY3B 1C1EL 2R2HA 4EDWL 3DPDA 1GXEA 2ATPB 3QI9B 1DR9A 4PD4K 4BUHA 2ITFA 1KB5A 4FTVA 3QUML 4XNQA 2B16A 4WK2B 2Q8BL 1AZBA 5I19L 3WNOA 3QG6A 3G5YB 2C9AA 3T2OA 4KI5F 2HFFA 4YFLF 3MLYH 4FQLH 3C5ZC 4APXB 2AEQH 4YE4H 4ALAH 3MBWA 2VDPB 3O3EA 1QD0A 1ORQA 3NIGF 5FIEA 3QQ4A 4MHHI 4XMTA 4J3TA 4R4BA 4TSBH 4RIRB 1ZEAH 1FL6B 2A6JB 2DDQL 2FEEL 5J4MA 3POHA 4TN9A 1WAAE 3VXSB 5EULV 4E42A 4FC3E 3VXME 2Z7YA 3FB8A 4XNMA 4JS7A 2PF6A 3NP3A 3SQOH 3EH5B 2ZX9A 2E27L 1DUZA 4UWQB 35C8H 1JTTA 3ARRA 1ITCA 1EAPA 3LEVL 2EXSA 1F3RB 1NCBH 1YDPA 2SEBA 4DP6X 4JPIA 5GS2D 4HC1H 1IAIM 2VUYA 2WN3A 4DGIL 3WLWD 3P4NA 5ILTH 4Q8BA 3CCHB 5EFIB 1UOKA 3OJ2C 1BQRA 4K15A 5FFLA 1J48A 3ZZQA 4QRAA 4G1EA 1F2QA 3ZE0E 1XH3A 3L9RA 4IDLA 3QJQB 3W9DB 3HRZB 1P7HL 1L7TL 4LHQB 5HYIA 5I66B 2MOQA 4OT1H 4BK4A 1NGWA 3FV4A 1R1CA 2WCGA 3BYTA 4F7CB 3JUYA 2Q6WB 3W82A 4BGDA 2YR3A 1GGBL 4Z7WF 3QUXB 1PDKB 3QJFA 1C5BL 2PTTB 4DUWA 5IM7A 4N20A 2WVVB 3WY2A 3RVUC 5A2JH 3EHBD 3CFTA 4WW2F 4JFDE 4NJAL 1OAYH 4ILDA 2EZ0D 4LIQL 4F7PB 4LPCA 2H8PB 5FYKU 2IBGA 3UO1H 3GZOA 5I8OL 5KYXA 2UZXA 3RFZC 1M4KA 4NQCD 1FZMB 3O6ML 4ICWA 5A2CA 3O3BA 4DEUA 5KSVB 3HR5A 5BUAA 2OMNA 5D1XE 2V3DA 3BP5B 3DO3A 3TYFA 1SY6A 3T6XA 5L8LB 5JOPD 3IU3A 2EVGA 1TTFA 1QBLH 2VLKE 1ZAGA 3ERXA 7FABL 1CGSL 4LIQE 5DUMH 5I76A 3LMJL 4R2GC 1JK9B 4X0KA 1RK1B 2JKXA 1KTLA 5ABDE 3HE7B 1DO6A 1AZZC 3H9HB 1TEFA 4XPFH 2B39A 5EIVA 3DHMA 3DI2B 4OKVB 4W9LC 5DLHA 4AGNA 2Z31C 3D0VA 1UWXH 2J5WA 1CDYA 4I7ZC 4LOUC 1OAKH 1DVUA 1MJ8L 3A6CH 2FB4H 1AR1B 4N22A 3V0FA 3HUJB 1E43A 4K5OA 4J4PD 4PB9H 3ABLB 2MNUA 3ZKXB 1H9DA 3E8UL 3TVMB 4TUJA 5EEUA 1XXFC 2F53E 5GZND 1I1FB 1TF4A 5EEVA 4XP4H 4AVKA 3U4EB 5DYOB 1N70A 5DHYB 1YEHL 2I07B 3I84A 4I1RA 2VDRB 3EGSB 4YHIB 4FJYA 4KI5D 4KKCD 3AAZB 4HEME 5B8CB 3FLFA 3GI9L 3CZJA 3QEGH 4RAHA 3US9A 1U3JA 1YN6A 3MRKA 2BNUB 5IF0B 1OD7A 2CWRA 5GGUA 2DRUA 3BX7C 3MUUA 3IDXL 1WFJA 3ECVA 3WD5H 1QOKA 1UM6H 2GAZB 4NKDB 3S4SG 1FG2A 1KIUA 1YNTA 3G6AB 1TZAA 1GGYA 1C5CL 3ZDYF 1I75A 4TSAL 4AE1A 1BAWA 3MRHA 5D7JC 3DVNB 3WHXB 4XNDA 43C9A 3L5XL 2XRAL 4G8EB 1E6JL 2IAMB 2ZZUT 2GTWA 3V4UH 4CMMA 2LTQC 3LHPL 4PGCB 1P0SE 2ZWYA 3E2HC 2QTVA 4ZSOE 2N56A 4ANUA 4H0LC 1G5GA 1YEFH 2QDVA 1MWAL 5JVIE 5I1EL 4YDIL 4LKCB 2R7EB 4K3GA 4WV1C 1SEBB 2XWZA 5JIIA 5GS0H 2HVKA 3D0LB 1NL0L 4U1LB 2MKWA 3WSQL 1N2RA 2K6YA 2NR6A 4DFIA 1E28A 1P5UC 4X6BA 3JSSA 4YEFA 4FERA 2OQJA 4EJ1C 1SQMA 5IVXF 4MMZB 3PUUA 3MNMA 1KXQE 1ICTA 1F11A 4JREC 2YPKA 4XGZA 4XMPH 1YNKH 1BDYA 3OZ9L 3PQYD 4P5SA 4W9HC 1NGZA 4MAYC 2G2RA 4JGNA 2K6ZA 1BLNA 2B59A 4Y1AA 5F71A 2NXZB 2O61B 3FB5B 3TGXA 2BXZA 2ADIB 1VKXA 3JWDC 1I3VA 2O30A 5A40E 1DEEA 2F74A 5C0GA 5IMOA 4X9FA 5HJ3A 4U0RC 5I1LB 1YAIA 3NT0A 5IR1B 5L6YL 2A1WH 4OZHE 1T20B 2G9HB 4XB7A 4JO1H 3ZTNL 4EN2A 4P23B 4OY9A 4R0LC 3QNZA 2OXGA 2CD0A 1NCAL 3ARDA 4RMRA 5FW7A 2ZKWA 4XOAA 1QQDA 3ZW3A 5DMKB 2WYTA 3APCA 4X98A 5HHNB 3Q43A 2KHAA 1MDTA 2NZ1A 4NQEA 4WWKC 1JZ5A 4GAJH 5C0ND 1J05A 4KDTC 4OF6A 3SDXE 5DSCB 1SBSH 1LO4L 1B0RB 4A68A 2EE9A 4TTGA 1FH2A 3DVFA 5C0BE 3BN9D 3CMGA 4YSAA 2ZONA 5EF0A 2YZ1A 1U8KA 2EH7H 1Q8MA 4N86A 1CFMA 1I9JL 4DHLA 1BD2A 3NZUA 5FYKH 2Y5TA 1OF0A 2LVEA 4OZFB 3TASA 1MIEH 3S96B 3UAJD 2XYBA 3P73B 3MNZA 4X99A 5E70A 1JWUB 2V7HA 5IB5B 4QRPB 4QXTA 5C9JA 4IKJA 1CJYA 2YBGA 4BINA 4UQBA 1PKQA 2V5MA 3MCLH 2QADC 3L1OL 3DXAE 3WI9A 3VD3A 2Q87A 2R0ZH 3F5WB 3Q1SL 4OLEA 1JYNA 4GG6F 5C70A 1TQBB 3GGWB 4IKNA 5DD1L 3UTQA 5EEXA 1UACL 2ZSWA 3CDGA 5C8JB 3GZPA 3HZVA 3T74A 3MUGA 3BSZH 3ZL2A 4JBSA 3BE1L 3C5JA 3P7TE 1ZLEA 2FHCA 3B2VL 4TVUA 4JHWH 1NLBH 3HNSH 3LX9A 1CGUA 1ZVSB 2QQLL 2GBVA 3GT6A 3WN6A 5HHOE 3ZHDA 1H5BC 2D7MA 1QSFB 4Z0XA 3TEWA 4TLSA 4X7EC 2RBLA 2KPWA 2A99A 2EYTB 2APWA 2X2YA 3WOVA 4EN3D 1HZLA 2W07B 2EIKB 3RP1A 2H1XA 2WUCH 3HS8A 4ZO9A 2WVTA 4DP4X 4G2AA 3TZVA 5LO7A 5MEOA 4OGAD 1AY1L 5HHMB 3QDJB 5I6NA 5BRZE 4M1DH 5TF0A 3OF6D 3VFSB 4LPTA 4ZUSA 2HJKB 1IC5H 4UYQA 1J1PH 2NY3C 5KVEL 3OJMB 5IVOA 4TXVB 1KTBA