4P8QA

Crystal structure of human insulin regulated aminopeptidase with alanine in active site
Total Genus 289
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
289
sequence length
867
structure length
860
Chain Sequence
KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Leucyl-cystinyl aminopeptidase
total genus 289
structure length 860
sequence length 867
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4p8qA02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 4p8qA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 4p8qA01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4p8qA03
3T8VA 3B3BA 3FUIA 4XMVA 4JBSA 3FTXA 2XPZA 4XN2A 4MS6A 5AB0A 3EBGA 3FTUA 5AENA 4R5XA 3FUHA 4KX8A 3CIAA 5AB2A 4WZ9A 4NAQA 5C97A 3FUJA 4OU3A 2R59A 3B7RL 3B7TA 3B34A 4QHPA 1Z1WA 4FYRA 3FU5A 3FUNA 4RSYA 4K5MA 3B2XA 3FUDA 3CHSA 4KXBA 4Q4IA 4XMUA 4Z7IA 4FGMA 3FTYA 3Q44A 3FTVA 4NZ8A 4FYQA 4FYTA 3FTWA 3FU3A 4QPEA 3FTZA 3FUKA 4ZX5A 5BPPA 3FH8A 4PW4A 4XO3A 4ZW6A 4FKEA 4GAAA 4Q4EA 4X2UA 4XN7A 2DQMA 3Q43A 4XNBA 4ZX3A 3B7SA 4ZW7A 4L2LA 4XN1A 3FH7A 4PJ6A 3FU6A 4ZQTA 4XMXA 4ZW3A 2VJ8A 3U9WA 4XMTA 2XPYA 4XN5A 3CHRA 4J3BA 4XO4A 4K5OA 4XNDA 4HOMA 5LDSA 4KX7A 3CHPA 3B37A 3KEDA 1Z5HA 3SE6A 3FHEA 5DLLA 4ZX4A 3FULA 5LG6A 4R5TA 4P8QA 4ZW8A 2XQ0A 4K5PA 5FWQA 4K5LA 3EBIA 3FUMA 4XN8A 3FUFA 3QJXA 4ZW5A 4XN4A 4MKTA 3QNFA 1H19A 3RJOA 4RVBA 4DPRA 3FH5A 2GTQA 3B2PA 5J6SA 2HPOA 4K5NA 4QIRA 3FUEA 4R5VA 5DYFA 4XN9A 3PUUA 4XO5A 2DQ6A 4XMZA 4XNAA 5K1VA 5CU5A 3B7UX 5LHDA 2ZXGA 3FU0A 4KX9A 4QMEA 4KXCA 2YD0A 2HPTA 4KXAA 3FTSA 4PVBA 4F5CA 1GW6A 3CHQA 3Q7JA 4QUOA 4XMWA 4E36A 1SQMA 4PU2A 4FKKA 4FYSA 4ZX6A 1HS6A 4KXDA 5J5EA 3CHOA 4R7LA 3EBHA 4FKHA 3MDJA
chains in the Genus database with same CATH superfamily
3OHXB 3NJXA 3KPQA 3ZVVA 3TCLA 3G6DL 5LXVA 4LASH 3ZHFA 1E4XL 4PJ8D 2GIXA 2XN9A 1F90H 2FATL 3N1QC 3RVWD 3TPKA 4JREB 4U0QB 1XDTT 4MAYA 2MCAA 3LKNB 2AEQL 2H6PA 2FLBT 3T6QC 2D3LA 4HISA 4S1SL 4BGDA 2O6CA 4WZ9A 2D0HA 3Q13A 4FP8L 4TSCL 4G80B 1FJ3A 5IHZB 1A9BA 1BQ5A 3GO1H 2NR6D 3P2BA 2OPCA 5IKCA 2MCPL 3BVDB 5C0FB 2FJGA 2VDQL 2WBJC 3N40F 5DWUH 1SUJA 1RZGB 4YFEA 1XZ0A 3SPJA 4OZHA 5KJ7E 1MH5B 1QO3B 2R23B 3DBKA 4Y1AE 1KGCD 1ULVA 2X4SB 5CN1A 2ZG3A 1N7MH 2EUVA 1AY1H 4E9QA 3CDGA 4XX1E 3Q1EA 2K7QA 4KK9C 3V6ZB 4Q2ZA 1R5VB 4I77H 2FEEI 4HHWA 2AAVA 4HGMA 2ZP8A 2CCWA 4N5EC 3CFQA 3WKQA 2BSDA 2WTOA 5JPNC 3BDYL 4N90D 1XF3B 1YY9C 4L2LA 4HJ0D 4Y5YA 3D52A 4YK4C 2NX5E 2H2PD 2JKIS 3BUYB 4JQVA 4PJAF 1D6EB 4CC0A 5IV2B 1P84J 2NXZC 4ZPTB 1NMBL 5E8NA 3TPUA 2WUCH 1CDGA 1RERA 3L6FB 3F58L 2Z93A 3FOMA 3LIZA 2Z7WA 1XGQB 4W9FC 4C54A 3A4DA 3QEGH 1QNIA 3RY6C 3AABA 2MJWA 5DJCB 1I4FB 5BS0A 5EO9A 3QC6X 3EYQD 3A6OA 1PSKH 2HN7B 4G1MA 3RX9A 1T20A 5CMAA 3ZO0A 2YEVB 2E59A 4CILA 4ZAKD 2FWSA 4QXVA 3CSYA 3WFBH 2YKLL 1GC1L 3QZMA 3AWFA 1PG7X 2HG5A 3DUHA 3QFJB 4P3CL 4A04A 5JPNA 2XG4B 3SDYH 2GABA 5EU4A 4KHXH 3BX7C 5DYFA 2Z9TA 2ZTBA 2Q2LA 2CUMA 4OM1H 5B39B 5I19L 4UV7H 1ZK5A 1OZUA 3D18B 3FF8A 2OSLA 1R5IA 3OD3A 5EZJA 5IHUH 2YFNA 2VLRD 4YDZA 2NSXA 3C5ZD 5DU7A 4G9FA 1FV1B 5IJVB 3D2UB 3EG9B 3NZ8A 4PV1C 1NCIA 4UNIA 4N28A 5L88L 3ULVE 4HCFA 4MMYB 2VXUL 4H88H 3NRQA 5TGBB 4UT7H 4WHYH 3CSFA 1FJTA 1NUGA 2EDBA 2V7HA 1MIML 2PR4L 4WO4D 3NCYS 5EA0H 3W2DH 3L1FA 2XZQL 1M7IB 2VIRB 3BKCH 2NY5L 2BFVL 5HDWA 2OR9H 4HKBA 1CICC 4BFOA 1TLIA 3UFIA 5KS9B 4WU5A 1EFXA 5HGHB 5BRPA 4JBSA 1ZHNA 5AZ2H 3T8CA 5AAMA 3L4XA 4J3OC 4M1CC 1WIPA 2OI9C 3BXNB 4QTHA 4TLKA 4ZNEA 1GGCL 2UY7A 3MRHB 4X7SH 2VW6A 3FSAA 1GW0A 4PJFB 4LIQH 4EDXB 2F54E 2NQ3A 4LDCA 1NKRA 2X89D 3BSZA 2TAAA 1R19A 2YXVA 1S7RA 3GJFB 3MCKA 2A9NH 1M1SA 1V05A 3Q2VA 5C8JA 1IRAY 1GR7A 4LLUA 1I9RH 3RY6A 4JZNA 5GZNA 1BIIB 3R4RA 1UEMA 4HWZB 4W9JC 4TSCH 1H3PH 4XH2B 2CBTA 4S1SH 4JHZA 1FBIH 3DXAE 3TYGH 3OR6B 1W72L 4Z0XB 5B4MD 4OZHE 1EERB 1JXFA 1TYRA 1KNOA 3T3MB 4OT1H 4ZX5A 3OGCB 4GQQA 3S3JA 4Z7NF 1E4XH 2SODB 4KZCA 4LASL 3S8WA 3FCBA 4DKFL 5T1KD 5CCKL 1UXWB 1B0IA 4L1DA 3L16A 5GGQL 1OXYA 4OKVA 2CUHA 3AY2A 3CFCH 4I13B 3DX8B 4I1NB 1TVDA 4AQOA 1VFOA 3BZFB 1OWRM 4XMTA 3OHXC 1IU1A 1A0QL 2Y6SC 5KVGE 5D7JB 4KNUA 1DLHA 3FQXB 3QFJE 4QAMB 1DVXA 3D0AA 2HX9A 2WLLA 1CIUA 4OFYD 5D7LA 5C0DA 2D9CA 1X9RA 1JNNL 5A2LH 4YE4L 5E08L 2BJML 5C7XH 4JY4A 4JO4L 1J05B 4UQ2A 4FNUA 1T2JA 1ZGLP 1KR6A 2Y25A 3PPEA 4ORGB 2J2ZB 1XGQA 1Z9SB 2C3VB 2VDPL 4JPVL 3BT2H 2F6AA 5CKGA 4U3SB 4H0LC 4U4BA 1HAUA 4UNUA 3SDDA 1DANT 3S34L 4GSQA 3W5MA 1F3JB 3DO3A 4LLAA 2WPGA 1BZ8A 1XF3A 5AW3B 1ORQA 1D5BA 4AZ8A 1NIFA 3ECBA 4NYLA 4GW1B 5AW2B 5FYJH 3ULUD 3LD8B 3H7BB 4BKLA 3QO1B 4UT6H 2HA1A 2F5AL 5FSSA 3H9HB 1FVEA 4P99A 4MJJA 4KZ0A 3MTXA 1A3LH 5HP5A 5I6PA 1IGIL 3T8VA 7TLNA 3SPHA 5C6TH 2FHFA 2BSSB 3G08B 5IQ9B 2C9QA 1QSEE 1U58A 2VR4A 1BFOB 1XGRA 3S6CA 5GSRB 5D7LD 1A6VH 1QAWA 2P8PA 3GSNB 5FO9A 3UBFA 3WEBA 3HZMB 4AYEC 1PG7H 3N44B 1XGYH 3C9NA 3B7RL 1MELA 2AAAA 3LN5B 3OZ9L 4NT6B 1GC1C 2MIZA 3FAXA 3PE9A 5MEND 3L6FA 4MLIA 1W15A 3U0WL 4ENED 5D6DA 2OTUB 3U6RA 2R69L 1A3RH 3IPFA 1UVQA 4N1CA 3HE6C 3X3GL 1FDLH 3WTVA 1S5IL 4MFHA 4KKCD 2YXFA 2OSWA 1MCRA 2PWFA 5ACZA 1ZLVK 4ES8A 3N0AA 4JAMA 4HMEA 4QPEA 5CXPA 1UCBL 3EH3B 4HT1L 4I3SH 3NSCA 4B41A 3HAEB 5DJDB 3ATBA 4JG9A 1QWUA 4LEEA 1B4RA 1XXFC 1A6WH 5FUCE 1R24B 2XZCH 5BRZE 2R0LH 1QFUL 2LLLA 5HY9A 2GI7A 2NUPA 1LO4H 1MCPL 2BOCA 2VXTL 3LZOA 1L0XA 1Z9PA 2A6KB 2EIEA 2NY5C 4LBAA 3D18A 1F11A 2CM6A 2JKWA 4L4VD 4XP4L 4KOCA 3O2VH 3O4LE 2PMZA 2XQBL 3IDGB 5F9OH 4WJ5A 4XZUB 3OKKB 5FYLL 4U7SA 4RIRB 5TQ0L 4PR5B 2YOAA 3DOSA 3O41B 5J1AA 3RTLA 3WAJA 3WKNA 1J0YA 2PP8A 4XX1G 1QSZA 5A2FA 4D0CB 3UZVB 1D9KA 5AZEH 3TN0D 4E5XA 5KS9F 2BIOA 2DIBA 1G7MA 4KRNA 3QZNA 4KV5F 1N8ZB 4LPCA 5IB4B 1CDIA 5DEFA 1DJSA 2BS9A 2IH1B 4DKTA 5IEHB 1F8TH 5F9AC 1PJWA 2ETWA 2AJSL 3ZU8A 2WKOF 2QLYA 2WIMA 1ERNA 1FYTA 2VO8A 3QR2A 2XTJE 4L37A 3UJTL 3GSQB 2D7QA 4YOKA 4EIUA 1J05A 1HQ4A 4RA3A 1BD2A 5ANMA 3QG6A 2OW7A 3FFDB 3OLGA 4QXUH 3UADA 4QRBA 1EXHA 3IMRA 1BVLB 3FRPB 1JV2A 5EUKA 4QCIB 1UYWL 4Z7QF 4GBXA 2DQDL 3OHMB 5CP3H 5ICUA 4X6CF 4K89A 3L13A 3GMNB 5C07D 3MJ6A 1Y0LA 4MQ7B 5AD0A 1N10A 4NAJA 2L4OA 4ABVA 2VN7A 2I25N 2X4SA 3U7WH 1P7QD 5FCSH 1HCZA 5E7FA 5FUZH 2QGDA 4M61A 1U8KA 3UCQA 4L8DB 4NUPA 4QRAA 1GAFL 1X9LA 4MXWL 4R97B 5F7EL 1X6NA 1L6ZA 2DJMA 2HLEB 4Y16B 1E27B 4HBCL 2W5PA 4NKMA 1YDPB 2NXYC 5C97A 1UADC 2VLJD 2X4OB 3VD7A 3ARUA 1RK0B 3ROLA 1OAQH 4M5ZH 3GKWL 1NGPL 2VN5A 4XH2A 5ICYA 1BVLA 5GJSL 3G5XA 1T5XB 2CHNA 1I8IA 1MVFA 4MXQC 4QY8A 2DYSB 3ARRA 4LLQB 4CNIB 1K6QH 1Z9LA 5F7HA 3PL6A 1KJVA 3FUDA 2VDLB 1HQRB 2B0SH 2DQUH 3Q2NA 3ZL4L 5CIPA 2WSPA 3SGDI 2DBLH 1G7LA 2W0LA 3UEZA 4YAQB 5TPWH 4NKOB 5HDBB 3SKMA 2VH5H 4GMTL 4U05A 4XPGH 5TE6L 3MACH 4KMTL 3FUKA 3FU9A 3BPNB 1RZIA 2IOIA 3I6LE 4NO2B 3RNKA 2BNQA 5JPMA 2R2CA 4JZOB 1MLBB 1G4RA 4XI5D 3BH9A 4TNVK 1MEXH 5LNGA 5D1QD 5DYOB 5K59E 3PP4H 2Q8BH 4M1GL 2ARJA 4Z7VF 4AQ8C 5G4OA 3FT3B 5E8DH 3VE0B 3QH1A 1RUMH 1BJ8A 4KI1A 1Q90A 4Z7VE 1OAUH 3HR5B 2YRZA 3TBVA 3V4PL 4OJYA 5EZOH 3WIIH 3SJVD 1ES0A 1S9WB 3KJ6H 3RRQA 4MJ5A 4FL4B 2QQKH 1U91A 5HY9B 1VERA 3HC4H 4FXKB 1U41A 3EGSB 2X4PB 4DK5A 3GM0A 1R33A 1BFVH 4NKDB 2YGNA 2XXFA 3NAAH 1TR7A 2DYPD 4Z77B 3K4ZA 3SO3C 3WE6B 3EO1A 2EO1A 4NCC1 3B7YA 5GZOD 5FM4A 1ZCRA 3GSRA 2DTML 2AI0H 3G3LA 5EC2B 2F1EA 3DGDA 3IK2A 4PREA 1M6UA 4KXAA 4FQIL 4PRAA 3RIKA 2WV3A 3PNWB 4X98B 2X38A 4EZMA 1XCWA 1IIIA 2WO3B 3QS3A 5AVSB 4G83A 1JTTA 1RURH 1INEL 1WFJA 2QGEA 4JFHD 3D50A 4O5LL 5AYUL 2HKAA 4QRPE 3ZHKA 1CXHA 3WNIA 2DQIH 1RZJH 2WSKA 5F0LB 1BV8A 5ESVA 2VDRL 4JO1L 1ZV2A 4Y9GA 4G8EA 3BD4A 2Q6WA 4B0MM 2W88A 1QFWH 3TV8A 3WTYA 3QZOA 1N67A 2BRRH 5KVGH 4QXWA 2C4FT 3I84A 3IDUA 2RBLA 1EEYB 2M1KA 3V7AG 4XB8A 4EBQL 3ZIMA 4JKLA 4PSPA 1I8LA 3P0GB 5DJ6B 1J1PL 1SLWA 2ESVE 2DMCA 3LKQA 3O6FC 3CVHB 5HDBE 3T6WA 3DGGB 4ZDHB 2AJXH 1A65A 4RZCB 4HX1A 1DVFB 4KVCH 1A1MB 3ME0B 1J8HA 1H5BA 5TDOB 3GSOA 2HKHL 1ZLSH 3EOBB 4PJ7F 2CO6B 3ZDYF 2QQLH 4WEBH 4GAJL 5MEPB 2YAPA 3ECWA 2Y1AA 3VU2A 2ZCHH 2ZOUA 3S2CA 3ZE1F 5K9KB 1RIHL 4F2ME 5D6DC 4FEIA 3NQZB 5EIIA 3CSYB 3Q6GH 5KBDA 4QTHB 5J6GB 3SE3C 4WFEE 2CRZA 3E8UL 1KTLB 1CJYA 1LE9A 4WU5B 5GRWA 2YPVA 2EKJA 2R4RL 4JDTL 2EDYA 4MB3A 4KXZI 5TTRA 5MP6L 1E2VA 1BBDL 4U6VL 1FL3A 5IMKB 1RJZB 5I75C 3R7RA 3BIBX 4E41A 5I6LA 1QBAA 4K23L 3I6GA 3H53A 2W95A 4WSKA 4S1RH 4RGMC 3V95A 4DVRL 5A3YA 5BOZG 2FX8H 1CFVL 4ZMTA 2ADYA 2A9DA 4P5KA 1IKOP 2J55A 5CBAB 1QYGL 5FCUH 1YEDA 2YPLD 4HZ1A 2FCBA 4L3ED 4X42A 1GGBL 1L4IA 1I85C 2ICEA 4MZIA 1S8DB 2CR0A 4TTDD 3A6CL 1EZLA 4PWKA 3QNXB 4KZEH 1UXWA 5KTEH 5LAXA 4JM2D 1J9QA 5IJKA 1S9KC 2ENQA 3AU0A 1FIGH 2MOGA 2B59A 3GMQA 1W72A 5GGUB 3TBYA 3LH9A 1TQCC 4O58L 4QHNB 2ADFL 4L0PB 4JREC 4OKDA 2X3AA 1JGEA 2EDMA 1XBDA 2B59B 2AK4B 3ZOAA 3BZDA 1VFBA 3LZRA 4ZMWA 3MU3A 3MUUA 1OQOA 2BSTA 4QOKD 4ACTA 2O93L 3ARSA 2H6PB 5BUGA 4ZYKA 1NDMB 3MREB 2VTFA 4KK9D 2P8LB 5MEOB 5EG6C 1NFDF 4ZFGL 1D5IH 3MHZA 5KSBB 3O3AA 4AGPA 1UXLA 3WO4B 3MJ7A 3QZWB 5I8OH 2XPZA 4YZFE 4PJEF 3NEEA 2ZX8A 4MBOA 1E3XA 3V0AC 4HJJH 3FUHA 2QQNL 1CICD 1FE8L 3VFMA 4HLZH 3CVHH 2FX7L 4M4RB 3CDGB 4BZ1A 1ZLUH 1T5WA 5CINH 1WQVT 1USZA 4DGVH 4KTGA 3U4AA 3K46A 3VCLA 5A2JH 3CCHB 4BZ2L 1A7RH 3PPSA 2RHEA 3KPPB 4ZSOB 3Q48A 4ZNEE 5EORL 5DHVB 3OM3B 4S1DD 4TVPL 2ZSWB 1T0OA 4HFUH 4ZPVB 4G1EB 1NGZB 4DGWC 1CGXA 2ZX6A 3WD5L 5D72H 5EV7A 4AT6A 4YWGL 2QHLA 3EGSA 3KZ8A 1PY4A 5AUMA 3GUFA 2I9LB 5I6XB 4FXTA 5C0AE 4G6MH 2OP4H 1YPZE 5GS2D 2XVLA 4JM2F 4FQJH 3O6FB 4XT1C 5K9JL 4EN3A 4K3DL 5FUOH 2AVGA 1UG9A 3HR5A 5L2JA 3LXCA 1LO2H 2OTWB 4MHHG 3HS0A 4QYOB 5CEZL 4PAZA 2AJUH 1DUZA 4HS6A 5IQMA 3MFFA 1UCTA 3Q0HA 3VGEA 1JPSH 1G6RB 3P0VH 2RR3A 4ODTH 1U8QA 3P3SA 4LOVA 4UZSA 3QUMA 3VI4E 5J56B 5EC1A 1DQQB 4NI3A 4AR1A 3L08A 4EAEA 3CX2A 5DVKA 5GS2H 4MRBA 3TH4T 2J8HA 2G3XA 2M2DA 3ESUF 3JV6B 4MJIE 3L7FB 3PS6A 5GSVA 1M3IA 2PLTA 3ZKMD 1DJYA 3HA0A 5E8PB 5EHFA 5IBTH 4RX4D 4P9ML 4G7SB 3ULSB 1FNEB 3QORC 3SKNB 2IDSA 4A6YL 2FBOJ 3IJYA 1KDJA 3RWDA 2YD8A 5BO0D 5F3HA 1UURA 4IOFD 2E27L 3U1PA 2OLDA 4KK6C 1ZE3H 3CSGA 3OF6A 3LRSA 2BNUB 1IKNC 1L7IH 3KNBB 2BHYA 1GW6A 1ZHLB 4PLJC 3R19A 1XCQA 3FN0H 1HXMA 1G9NC 5I1EH 3JV0A 2P5WB 3VDAA 3QDHA 5LCVH 1T03L 2AANA 5C09D 2LGNA 3UTSA 2HRPL 4Y0GA 3GNML 4GP4B 3N91A 4EN3D 3CHOA 1E2ZA 2CHDA 2QPEB 5EOCJ 5J57B 1W91A 1PQZB 2DKMA 3H85A 4WF7A 1QLEH 2A9MH 4N2OA 1KXQE 4C56E 4ZFFB 5L8JB 1OB1A 3P4LA 3QORA 3U9UA 3UJIH 3O6LL 1A4KA 3WFCL 3U83A 1PZSA 3SKNA 4FFTA 1NBYA 1LO0L 4DJMA 3MV8A 4MD0B 2H3NB 3OHXA 2KT6A 2CJUH 2OMXB 2WP3O 4GBXB 2Q20A 2B4CH 2OJEB 2LOEA 1T3FA 5I1CL 4DPBX 3SPVA 4R0LA 4L4VE 3ZYIA 5BQ7B 1MFDL 3DO0A 3PJSB 3CBJB 4GRLB 4J8QA 4R4ND 4JK0D 2A5UA 5DFWH 1MRFH 4L37B 3IM1A 1YEFL 1H9VA 2APBA 4LVOC 4QRPD 2PTTA 4XCYA 1KB5B 2Y2YA 4ZFOB 5HVHC 3VYOA 2AJYH 5D7KD 2PPFA 3KLAA 3F8UB 1TQCB 1ZGLB 5DD5H 1MUJB 2XJLA 1CZ8H 2WJ5A 4OLYH 4M62L 5C3TA 4J3OF 1SM3H 4ZBJA 1M6OB 4W9GC 3S4SA 2HKFH 2H45A 1T5XA 1PZDA 3IRPX 2ITCA 1IJ9A 1DQDL 3NFSL 2WYIA 5GPRA 3GK8L 3WJLA 1UD3A 3SZKC 4E9LA 4Z7QE 2WXGA 2CMRH 3D2TA 4CMMB 1IUZA 1SHXA 2WVUA 4OF3A 3C5ZC 4L5FL 1U4GA 3DSFL 2XWEA 1S78D 4XOAA 2ZPKL 1OARH 3SQBB 1Q9WA 3GMPA 3H7LA 5IMOA 1A9VA 5JS3E 4W6YB 5D1QC 3GBEA 3ARTA 3VRLF 5DT1H 3NJMA 5LIFE 5EPMB 4PRHD 4RBPH 1DQML 4FXGB 4HIPA 1OOAA 5JW3L 5JOEA 3GLAA 1SEQL 2EE9A 5EWIL 1CDBA 2XKNB 4O2FB 3L45A 2ZUQC 3BW9B 4LHUB 4FXGA 1XXDC 4OM0H 1LXMA 2VMFA 2WBJA 4KUCF 5IW3A 3T6VA 4AJYV 1TUPA 4I8DA 1FYHB 3ECUA 3L48A 3QZWA 4QOKA 3IE9A 2XIBA 4H0IA 1RPQA 4LNRA 3V79C 1JGUH 4RMSA 3UP1A 1ZLUK 4CJ0A 2HUEA 3L5WB 4GSXA 5JW3H 3GTNA 3TEYA 3JWOH 3ZHDA 4K3HA 3QI9A 4NUJB 2CCVA 2PW2A 2N7AA 2NOYA 3GMMA 4I7ZC 3HPLB 2VM9A 4XXWC 1OP4A 1CICB 1GY1A 3ZQWA 3Q1SL 3Q8EA 3AQYA 3DSFH 5GS1B 1XH3B 2H1PL 3DK2A 4E5XB 5CM1A 2PTVA 4MYWB 3NCYP 5SWSD 1J0ZA 1T80A 4QLWA 1CF8H 2F0CA 3I02B 3ZT6A 1ANUA 4K7PY 3CMGA 1JK9B 3C8HA 4X7TA 2CU9A 3ZN6A 4YIQA 4APQA 4TPRL 5E56A 1F02I 4J4PC 2D03H 4UZUA 5HDBF 2EADA 2OQJA 1F11B 1F5WA 1N3NB 4GUQA 5BOJA 5FM5O 4F7EB 1R47A 5IVXB 3LQAL 5AAWC 2GUOA 2IPUG 2NSMA 1ORQB 1PDKB 1A6UL 2VO5A 3ARBC 2OJZL 4ZO7A 3JQOB 1QWNA 4DUVA 2AQSA 1HHGB 4AK1A 5SWSB 1XL4A 4X5LA 2IVFC 1MFDH 1V3KA 1S7SB 3L1OL 4HUVB 3OSKA 1J87A 3NIDB 4I0PA 2EUWA 1P5VA 4DCQA 1J5HA 3GXDA 1JXGA 3WXVH 3FSZA 3QQ4A 2NY7L 3OJMB 4IGBB 3B5GA 1T4WA 4PJEE 3UZEC 4QLRA 2JFCA 7FABL 4Q4EA 2DLIA 1VAHA 5K9QI 3DXAD 4E68A 4F3FA 1ECYA 3OKDA 4Y19B 2DQMA 2OZ4H 4UQDA 3CHXA 4NLAA 3BP5A 3K2UH 4N2NA 4ZUVB 3PXLA 2VDKH 4QJ4B 2O61B 3SB3A 4PB0L 4WUKH 3UABA 4P3WA 2H26B 1R0AL 3GNMH 3RB5A 2QEJA 3CHRA 5LCVL 4MMXB 1YUHA 1D7FA 1MUJA 4F2EA 4XP1L 4WW2B 2UUDH 4PV8A 1C08B 1KELL 4RFNB 3ABMB 3BMVA 4CADA 4KRLB 5DWPA 1ZLWK 4LSQL 3CQQA 1WGOA 1YMME 4JFPB 4X5QA 4A7VA 1E43A 3SBRA 5C70A 5C2BH 2C9PA 1OZTG 5D4QA 1SRDA 1ZS2A 3MBXH 4JY5H 5EO0A 1S7UB 3WS6C 3QNFA 5FHAL 2QR0A 3UAAA 3E8VA 4HJIA 5DEJA 4ZG1A 3N43B 1DANU 1CD1A 4IJ3C 3WNJA 2AMUA 5LWYL 1CO1A 2E76C 3LNFA 2X10A 3QJRB 3VI3B 4LLUB 1FCGA 5GHWL 2QBWA 1MCIA 4LARL 4XRCB 3ZE2F 4HF5H 5BS0E 3QNXA 5TDNB 5I30L 2MPAH 2OA9A 3IJHA 3II3A 1MAML 1IBFA 4NKQB 3BXNA 3KJ4B 2ED9A 4E9YA 1N6VA 3QHZL 4JY4B 2E9IA 4G1EA 4LCWB 4WWKC 1B4TA 3P11L 5IQLA 4QT5A 4RDQG 3UIYA 1TJIH 5TF0A 4HV8B 3B3BA 1CDHA 1Z5LB 2CBPA 3DRTB 4PJ7B 3QXAB 2DM7A 2O5XH 3T4YB 2YUZA 4J1UA 3MS3A 3WD5H 4GW4B 3QUXD 1HILA 4R97C 4RNRB 5GHWH 3PHOB 1INQB 5AKVA 5GRZA 4FL4C 5HJBA 3UGEA 5HHQA 4RBPK 2JKRM 4K8RH 2NNAA 2XSKA 4NM8L 5F1NB 3ULVD 1CC3A 2V4LA 5J6HB 1TPXB 5ADPH 3T3ME 4CRPA 2WLKA 3EJQA 5IMOB 5FHAH 1BBJA 3K5SA 4TMNE 3O3AB 5AW0B 5KYXB 3CHSA 3DECA 3X14A 1DHKA 3QUMB 1XB6A 1W0WA 1GSKA 3FYEB 2QQNH 5E5MA 2P5WD 3O8XC 3RHWK 3T87A 2DEXX 2XWDA 3AQXA 3M8OL 5I8OL 1T21A 2OFQA 1HWHB 1AZRA 1JS4A 2HLFD 4M8UA 3SGKC 3TO2A 5FLVA 5L6YH 5B38G 2EKSA 5EIQA 2PO6C 3GI8L 4ZD3H 4YBLC 4ZMZA 2WQRA 2BW4A 3C5SB 2UXGA 4F2FA 2DLFH 3T8XA 1YMHB 4PB0H 3FONA 1YNKL 3BN9C 2RB8A 4L8BA 2HLFC 1FNFA 1KBBA 4PP2B 1YC8A 2XBZA 1UOLA 3L5WA 4UDUB 4XO4A 4AT6B 3VMPA 4A7UA 4UQAA 3QA3B 3PL6B 1TLMA 7FABH 1S9VB 3VI4B 2K70A 1XR8A 4EPSA 3MLVH 5DRXA 2FJFB 3LNDA 5DVPA 4ZUVA 2ZKHL 4JPWH 5DC0A 2O61A 4GAYB 4YVNA 1QTYT 3LQAC 1M7IA 2VIRA 3QDAA 1FNAA 5L7XL 3N1MC 4R90L 4BCXA 5SWZB 1FIGL 1TKWA 4YDKL 2R2HB 2VXQL 4FNLH 3ISYA 5AOZA 1NCTA 1ZJBA 4TLNA 5DUBB 2P43B 3RWHA 4W4OC 1H9DA 4JRYA 3KR3H 3T6XA 1MI5B 2P1YA 5FM8A 1KIUB 1DL7L 4AJVA 2EYRB 1TTCA 4NXSA 4U7KA 1T83A 3QH3A 4OFQA 4JVPA 1XVSA 1EXUB 3UAJC 4JQIA 3GZQA 3T73A 1IGMH 3MOBL 4Y16D 4U6VH 4LGSB 4YLBA 3MLUL 3FFDA 1N0XH 1WBYB 3RWDB 4Z3JA 4HCRA 4P2RE 1T20B 2J43A 3SPCA 4APQB 5A7EA 1I1AA 4WUUE 1WJ3A 2YPVH 4MNQD 5F7NC 1O7VA 4KI5F 1CK0L 3NYKA 5EU5A 1J8HB 5I0YA 2ROXA 3MV9B 1NUDA 4OCWL 5HVWA 1K5WA 3BFWA 3QWQB 4UT9L 3VGGA 5DUML 2J8UB 1QRNA 4X99B 3VRJB 1AZVA 4ZTOL 2WQAA 1AXSB 2C9UA 3OKNB 2WBJD 1NCCH 1RUPL 3IU3A 3TA3C 1BREA 4Z7WB 3PWPA 9PCYA 1GSMA 1C5DA 1D2OA 3O2WL 3UZEA 1XAKA 1I7ZB 4UMGA 1LE5A 3B7TA 4HZLA 5E1AB 3S98A 3DOSB 3O41A 5LN4A 1EJ6A 4N2KA 5T1LB 4B3VA 2J6EH 4YXLL 4TULL 2W1NA 3QJTB 3T2HE 3H0TB 1OCWL 4A2FA 5D1XC 5EWIH 4QY8B 3ZGHA 1Q9OB 2DQFB 2XX1A 3MRKB 3P3TA 3QWRD 1F6FB 5EN2B 5BS0D 5KVDE 5FA3A 1FFPB 2YIHA 3U30B 1OPOA 2H3KA 2NY6B 4G7VH 1FO0H 1T7ZA 1A2YB 4UV4L 3M1BB 3IVKB 4NKMB 2OL3A 3N06B 2VNCA 1I1FB 1KB5H 5C0IA 1BPVA 2AK4A 3V9CA 4JO1H 2VDRH 1UZGA 3MNZA 4AH2A 3PWNB 1RZJL 3W57A 4B0MB 1QI4A 4ANXA 1OSPL 1MFBH 3S3BB 4Y7MA 1HINL 4GKZB 5BJTB 4RGMB 4P23A 3WLBA 3ZZSA 3DLQR 4V2CB 5AD0B 3B37A 3I75A 4FQIH 4OLYL 4TNWK 4BQ8A 3MRNB 1VEPA 1OW0A 2CLZA 4AIEA 3H1ZA 4Q56A 1KXTA 4LT7A 3O6ML 2CCLA 1ZLVH 4DKAA 5D4HA 4HWNA 4GP8B 4GQ9L 3OKLB 3NAAL 1YEFH 3RGVA 1BFVL 3QUZD 2WTRA 3MLSL 3X13A 9CGTA 2BSSA 3G08A 4IBYA 5IQ9A 1DLFH 4LEOA 3V0WL 4I2XB 5EU3A 4LO9A 3FT3A 1ETZA 4EI6A 3O4LA 1CYXA 2VW4A 3U4BH 3ZKMC 4JRYE 1NUFA 4JFXA 3T09A 1JI2A 4QMEA 3KYKL 3IDJB 2GCYB 2NT0A 2AQ3A 4B9ZA 1YEIL 2DQHL 1ZVNA 5CHNA 4S1DC 4F8OA 2ZUWA 4QO1B 2XNAA 2P52A 5FLUA 4J6RL 2BC4A 4PJ9C 1ZANL 5HYJB 2F8XC 5JOFA 2H1LM 2V8LA 3VD1A 1AZUA 5D70H 3MRLB 3X14B 4MTMA 3RA7H 1L6PA 1L9SA 3EF4A 3WGUB 3ILQC 4HG4J 4CN6A 4A37A 1KIQA 3SGEI 3Q3GA 3WFEH 1L9TA 4LLQA 3VTAA 3HZ3A 1I8IB 2IIJA 4N6RA 1NCAL 2NNCA 4BZ1H 4AC4A 1H0DB 5KVDL 4GMTH 4R7NA 3UBGA 1UWGL 5TPWL 4OI7A 1R24A 2E27H 1MCOH 5E23A 3BI9X 4YHOL 4AGLA 3P4MA 1UJ3B 3BHBB 1DDTA 1QQDB 3JTTA 4LVNB 1QF1A 2B0SL 5DJDA 1XCQB 3MRJA 3MUHL 2IMNA 2V33A 5ILTL 4WWID 4RAVA 1A1OA 3B8SA 5D1QA 4M5ZL 1OAQL 1OF2A 2Q7AA 2OJ1A 1NAKH 1UD5A 3GLDA 1UWEL 2HFEA 3HMXA 1OSEA 2ICES 3L4CA 5IVXF 2V2WB 2A9CA 1QNZL 1PX4A 4MXWH 3SE8L 2V9TA 1OAXL 3NJIA 2JF1A 4GAAA 5FW7A 3C9NB 2EXWD 5FUZL 3GSWA 2AJUL 1MXGA 2AKRB 5C08B 4XN7A 3DI3B 3ZRSA 1C12B 2Y4SA 3B1TA 4MKMA 3FRPG 2MEJB 4PUBH 3WFHB 5EU6A 2DQEL 1B2WL 2AXHA 3HNSL 3DYMA 1OTUD 3OR6A 5E8EB 3ZHNA 1ZT1B 1OGTA 2BVYA 2EDTA 4HX1B 1LNBE 3N04A 3KPLA 1CDCA 4HALA 4JFFE 4WO0A 2NR6C 5E00A 3D85D 1LEKB 3F84A 3MBEB 1J0JA 4UTCA 5IESL 1F4XH 3IXAA 4HJEA 2ITFA 4JHBA 4R5TA 2BH0A 2BNQE 5GISH 3T4AA 5FSPA 3VD9A 1CFQB 3SJVB 4O00A 4YLQT 4HFUL 1JJUA 2XOTA 2IPUK 3HI1B 4TVPH 4ZNCD 1YMMD 3ARZA 2EEAA 2F8OA 3CZSA 3OAZH 4DVBB 2EXSA 4RIRA 5I71B 4WO4A 4BINA 2B5IB 3IJSA 4FXLA 4PJAB 4QHLA 4G6FD 5KVFE 3PWUB 4X6BA 4EI5C 4G7YL 1EHNA 2DIJA 5DK2B 3SDAA 3CFKB 2IBZY 4P9HH 5DLML 4YUEH 2FX7H 3CVHL 5A2CA 2EICA 1UH4A 1FGVH 1FE8H 3HPJA 4Q74A 1QFWI 3MODH 2VZ1A 4J3OH 3K71B 3GMRB 5IJKC 2V7HB 2E7LA 1WLHA 4LESA 1P6AB 3QXDB 2YWZA 1VZIA 4XP4H 1SLVA 4QUOA 6TLIA 3BSGA 4ZFGH 5BZZA 4NO0D 5CWSA 5GRVL 4GKOA 5LBVA 1LO4L 1MCPH 2VXTH 5H37A 1P4UA 3FJTA 1V7NL 4UBDD 4HUVA 2ZF8A 2JQZA 2BP8B 4YSDA 1QR1B 1OD7A 2NY3C 2XRAH 2PXYB 3VXSB 4B7LA 1IO4C 4QRSB 3GSOB 5JORB 1CE6B 3H56A 4BK5C 4OCYL 3FQRB 3IJ8A 4O58H 5TQ2H 1TZIA 3UTPE 1AZBA 2BPBA 2ENYA 2XN9D 3RUGA 3RVXD 5G2NA 1AGDA 4KUZL 8FABB 4GP5B 4L3FA 1WFUA 4IBLT 3ZBMA 2APWA 3OXRB 1M56B 3V4UL 1X5YA 3DURA 4LPYA 1N5YH 3LSOB 3JT2A 5B38B 2IQAB 4H8WC 1F97A 5LXGL 1P4BL 1XX9C 1AE6L 1XGYL 4BH8A 4HMDA 2UWEE 5C92A 3BKYL 2WZ0A 1S5HB 5EZLA 4OI5E 3DJSA 3KWVA 4X9IA 2P46B 2V7NB 4A1RA 4WO4C 4D8PB 2F7IA 5KVEE 1CFVH 2EZ0C 4S1RL 4FTVA 2Y06H 4DVRH 2BS71 4U1GB 3KPRE 4K23H 1AZCA 2GI0A 4AVKA 5DUPH 3HE6B 3E3QC 2JJVA 1JHLL 1EBPA 3NA9H 3VXUE 3BOVA 1BHGA 5MP6H 5CBAA 2F5AH 5FKAB 1SEBA 1HQRA 1JTPA 1ETB1 2IFFH 3C08H 3J27A 3NZSA 1C8PA 4WEMB 4TUJA 1T0NB 3SOBL 4Q6KA 3RGVC 1YEKL 5ICYB 4IIZA 3S7GA 3TN0C 2WUBL 5FGCB 1E7UA 3WEOA 4N2EA 2EJ1A 4FHKA 4HPHA 3SE6A 2QVIA 2O6EA 4L23A 4BFKA 1IC1A 3QIUC 1A2YA 3BN9D 3IVKA 5KBKA 4LSVH 3TOPA 3VFPA 1EHXA 4NERA 3UYRL 3OKMA 2QQLL 4WEBL 4A2HA 3NSYA 3QK0A 3NP4A 5HI5D 2XV3A 4LVHB 4P23C 2W07B 4YJZL 2YBRA 4L4VB 4HKZB 4IDJL 3QUYD 1U8JB 3RI5K 1UATA 4GXFA 4XBMA 3T3MF 4C57C 3FN9A 3TVMA 1FJ1B 1ZA6B 2XKUA 3OAWA 1VLXA 4X7FC 5DZNA 5LWDE 1T1YA 1U36A 4PGDA 4X8JB 2ADIA 4A7SA 4X9YA 1CPUA 4JO4H 5L4IA 5C7ZA 1IBHA 2HLAA 4X9FA 3ZSSA 4EBQH 5LBGA 4RFNC 1JZGA 4JG0L 1GOFA 4MBRA 1T7WA 2QSCL 2B9AA 1C5DB 4QRTB 2I26N 5C71A 1P5UA 2IBGA 3LIZL 1QFWL 5EO9B 2EXYC 2NW2A 4FYSA 2ZXQA 1HS6A 4KO9A 1HI6A 2VLLA 4HLZG 3SDXA 3BDBA 5ABDE 2VABB 4XAKD 5AYUH 2Z8WC 3C8KA 1I1YA 2EQDA 3WJJC 1UXSB 3HFFA 5AVZB 2L7JA 3K6OA 4DFHA 1USQA 5D71H 2P8MA 4IGBC 4G8EB 1ZHBA 1D9KB 1GMEA 3I9PA 1V7MH 2BNQD 5I16A 3ZTDC 3QDME 3IKCB 1U8MB 4Q9QL 3DV4A 3TYGL 3G5VB 3WN6A 4ABWA 4L1TA 4N2MA 3FYIB 4OBRA 4N8VG 3GD1C 4HK3N 4LBEA 4OU3A 4DFIA 4J28A 3P7VE 4X98A 3B9DA 1I9RL 1ZAGA 3PNRB 3QPQD 4MXJE 3RNQA 6PCYA 1XGPA 3WTUA 1KXVA 5EOCL 1XV8A 4AJWA 5HGHA 1Q0XL 4MMZB 4Z3IA 2E3VA 4OCXL 4Z7UF 5BZWA 4DKDC 4DT2A 3TT1L 1JV5A 3QW9A 3IJ7A 4E9SA 1LK3H 4CSSA 4NN7B 1NL0L 1GHFL 1ZTXE 5K9OA 4Z7OF 3WL9B 1C16B 3O6KL 2V5RA 1Q8MA 2VZSA 5JMRA 1BYNA 4S0TD 4AL8L 1MOEA 3GMNA 5GS0D 4U6XA 4QHLB 3FDWA 5CJ5A 3MNVA 4GXUN 3UCRA 2E7BA 3NCXA 3OXSB 5C0EA 5I1DB 5HJGA 1NIDA 3BO8B 4XHQA 1M9WA 2FECI 3FU6A 3FQNB 3VG9C 5I18H 3H6JA 4M1GH 2F19H 1QFWM 3SIKA 2X9YA 2VXUH 4M93B 3EF7A 2OTPA 3ULSA 4G43A 2YRPA 3TFKD 4PJDA 3FXPA 1F13A 2LABA 3N9GL 1KB5A 3SDAD 4ZFOA 3FO0H 2G4GA 4Q6IC 4XN8A 3HE6D 4NQEA 2BNRA 1T4KB 2DQUL 1MIEH 4Z18A 2VGLM 2CGZA 1JPFB 1IC7H 2O30A 4JUSA 4HH9A 1TVBA 3W39B 2VWEE 1KSRA 2GK0A 4P3CH 3L2NA 5ESQA 3BEVA 1N4XL 3AITA 1K8DB 2GAZA 1U3JA 2MOQA 5E94A 3DVNB 4PWJA 1JF6A 1E5ZA 3PUUA 4HWBA 4GY4A 5TH2A 3V4VH 5MERA 4DEUA 2JK5B 5AW7B 1H3XA 1RULH 5A2AA 2W07A 2C4XA 2E8YA 3PREA 3S36X 2OCFD 4PEEA 5CCHE 4FEMA 3L2LA 3CN3A 3V7AE 2DQTH 4TOYH 4JQXA 5J8OA 4FZEL 4UUJA 1GZPB 4OFIA 3RE0A 5AOJA 1SOQA 4AQ1C 2X9WA 1JZEA 1MJ8H 5A1AA 3MDJA 4MJID 2R23A 5E6YA 1I8UA 1YAZA 3CLWA 1FFOB 4GI8A 3SODB 2RTTA 5F3BA 2FBJL 3IB4A 2FJGB 3F3HA 1UGKA 5IREA 4TLIA 1GHFH 5AVYB 3UC0H 3T0DA 1PLGL 1ZWIB 3NACH 2Q3ZA 2CA3A 2AABL 4R4BA 4PRPB 2AJSH 4OJFL 3TT1H 1AOHA 2LV4A 2BNRD 2J72A 1JWSB 3CLFH 4JFDB 2A77L 4K7PH 3CFMA 5H4YA 3N42F 3CG8A 2Y7LA 1GRWA 2EKSB 4NQSA 3QH5A 2C9AA 1K4CA 3F7LA 2J71A 3MV7B 4U0RB 4N5PE 1LWHA 4PBXA 3BISA 3KG5A 5DZ9A 3RWCA 5D2NE 4M7LH 1BA9A 2E0PA 2IADB 4NI6A 3BZ5A 2XQBH 5F9OL 4LOUD 5D71L 1R4XA 4X2UA 4LRNH 3QXVA 2VITA 4H8QA 4JM2A 4ZTEA 4YSUA 4MCNA 1UM4H 1VFAB 3U1QA 2X9ZA 5AUMB 4MDIB 4ZMVA 3GJFK 4BYHA 2IDCA 3MYZA 3S0PA 2DJUA 4KJQD 3ARBB 1I8MA 3AG3B 3P4NA 1C16A 4I3GA 4TQEH 4WWKA 3A4FA 2ENSA 3T0EC 1NCWH 5TK2A 1UCBH 2YXMA 3M07A 2WYTA 5AAWA 5B3NA 4IJ3B 1KN4H 5C08D 1OIOA 1FDLL 2ZKYA 3AS0A 2UYLA 2VC2L 4JFUA 5E4OA 3HAEA 3QJFB 2EDQA 5D7IB 1S3KL 3NN8A 5T3ZD 1WIUA 3L3GB 3D1MC 2KH2B 4JCLA 3U1SH 1Y18B 4BH7A 2FT8A 3FB6A 4V1DD 4KRPD 3JVFC 3L5JA 3D0VB 4M02A 3TZVA 3KPSB 3HC2A 5E8NB 1HHGA 4KC3B 1GIGH 1L5GB 4B60A 4GRWH 4UAOB 3WS6A 4TSBH 4WU7A 2EUZA 1RY7B 1FLRH 3ARDD 1VKXB 2NY6C 3BAWA 1W8OA 4XNYH 3HC0B 4CW1A 1IGIH 3OQ3B 1AGEB 5C86A 1EH9A 4X5XB 4K94L 4FTDA 4O2EB 1JF5A 2IFFL 4NSKB 5F6HI 2BIIA 1I7TB 2DIAA 1PMYA 2CLVB 1VENA 3KL0A 4NPYA 1GVIA 4G6JH 4AYSA 4ZMXA 4JFQA 1KBGL 2EDOA 4XVJL 2HFGL 1DVTA 1I7TA 4TSBL 3L3OA 4ZI8A 4NQVA 4FXGC 4F7MA 2K6YA 4MMXA 2L7UA 3PDOB 3TA3B 3CX5J 2YJLA 5C0ND 3KW8A 3QUML 2ZUVA 2LU4A 4XODA 2E4FA 4PJ8B 2PXYC 2K7PA 1P4BH 4HDIA 5K39A 3TP4A 4R3SB 4LOFA 1N5YL 4IS6B 3OKDB 1S3KH 4Y19A 2XTLA 3V4UH 3RVTC 1N12A 1XH2A 4IRZH 1T66D 1U8CB 5DMYA 3HUJE 2B1AL 4BK4A 3RLSA 4OZGE 2BJMH 4XMUA 5DZLA 2O5NA 3NCMA 4WGWB 5BRZA 3H54A 4X6CA 2Y9RT 3C2SA 3CTTA 1KJMA 4IRSB 3REVB 4R4BB 3KPRB 3TH2T 3SKUD 1KXVC 3P7TE 3GBDA 4KZDL 7TLIA 1R3KB 2BS8A 2AXFA 2XG5B 4FFWD 4TQEL 5DS2A 1U92A 5HYFA 2FE0A 3I2CL 4MLSA 2BCMA 3LNHA 1UFGA 2YD7A 4MS8D 4X9BA 3RYMA 3CFBB 3CV5A 1G1CA 3I85A 3MRDA 4PJ5E 1SJHA 4LZKA 3DROB 1S5HA 2OR8A 1EDQA 4WTZG 3DJZA 5KBMA 4XAWL 2VR7A 2X12A 3K2IA 2J6EA 1O9VA 2HT4D 2ZG2A 1XAUA 2UZIH 3AADB 1WZ1H 3K3QA 2PKDA 3FNKA 5BS0B 1MJ7L 5IVZB 1NMAH 2WINB 3RU8H 1LGVA 1FFNB 5DRNB 4C55A 3FUEA 2NT1A 4OF7A 4MQXD 4PJIE 4ODVH 3WO3B 3PAUA 4LIQL 3FB7A 4N2AA 5E8EA 5HDOA 3T2QA 5JORA 3GHEH 4GQZA 4UILL 4RMQA 4Y5VB 1PLGH 3NACL 3DX0A 4ODHH 2OBGA 2K4AA 5CAYB 3ECQA 4TNVF 2DPKA 1MCNA 1DTUA 2A0LC 2P45B 3DV6B 3NIFF 1KJ2H 2JVUA 2Z65C 2ZCZA 4IK7A 2P5WE 2NYYC 3MRGB 1NC2A 2FBJH 3QIWA 4KVPA 1IILE 1P1ZA 5MHSE 2WBJB 4H44C 4XE0A 2A9BA 3BAIA 4KFMA 1M42A 1X5AA 5DLHA 3V6ZA 3S37H 1AD9A 1X5MA 4D9RE 4O2FA 4MD5A 5FYJU 1TQTA 4OIIH 5CIPB 1L5GA 4FZEH 3IDYB 2PCFA 1NANI 4H88L 1R1CA 4PWEA 5ERWA 5DJZA 5AYQA 4KBPA 5KSAB 2WXQA 2P5EB 1BZOA 3RPIA 1A7QL 5CIPH 1OAXH 1E8ZA 4NIKB 2A4EA 3UYPA 5IT2H 5IHUL 3JUZA 2BIMA 3UTSB 5CD3B 3KE0A 4G5ZL 4M7ZB 1UWEH 4UV7L 5H35A 2H5UA 3V4VL 1A66A 3VACA 1SZNA 4UYPA 4A68A 1KG0A 1DVFC 2A6IA 1AMYA 1EDYA 2AQTA 2Y7MA 3D2UA 2OMWB 1N4XH 3B1UA 3EG9A 2NY2C 3IRZA 3T4AC 1P5VB 5E2VH 4A2GA 4DCQB 2A7GE 4JCWA 3WFBL 4KKZA 3TEZA 1XGUB 5IGXL 4OCSH 1K5NB 4ZFZA 4H25B 4H1LH 1QLRA 3KPOB 1U2HA 3GBNL 4ONGL 4PRHA 5FX3A 1ONQA 2XG4A 1CVSC 1UWGH 4P3DA 5C07E 1EGJH 1UD4A 3N9GH 3MBWB 2NLJB 2FO4A 3L7FA 4MXVE 3CNKA 3HRPA 2J88H 3BMWA 4KDVA 5JIDA 1KTDB 4OZFB 3WFEL 3A67L 5HVFB 4Z7VA 2WUCL 3TVMC 1AMXA 4YLCA 1XMEB 1G7PB 3RGHA 1J9SA 1I4FA 1WZLA 2DWSA 2AK1L 4UIMB 5FKPA 5KJ4A 3VWKD 4J3OD 2LAAA 1FN4B 3VGFA 2NY0D 3BGMB 5JR1H 1QBBA 4N2LA 4CADB 4BQ9A 5DFTA 5DJYB 1WZAA 2XFXB 1A3QA 4K5OA 5HYQB 4PWFA 1DQJA 5DI8B 1YEIH 2D3VA 4KQ4L 4F15B 1UOWA 3CZEA 4OZHF 4A63A 1ZE3C 4YDLB 1FC1A 1N7ML 3IGAB 2FUQA 5AAPA 5I1DA 3BVNA 4AQ1B 5DEGB 2AQQA 1O6TA 5A6LA 3SO3B 4HHAA 5JQIB 4ZW5A 1CYWA 3K6IA 1EXUA 4H8PA 4U6XB 3TEUA 3LVEA 4B5EA 2XBDA 3VH8G 3DSNB 1T1ZB 1JNJA 4CVWA 2DM3A 5AOLA 4GQ9H 3NFPB 3HFML 5DHDA 1T89C 4LPTA 3ARBD 3AREC 5DJ0A 3MV8D 4AQZA 1JPGB 5BV7C 3TO4D 3BW9A 2FATH 1LQBC 1Q9LA 1TYJA 4KJPC 4YHLH 4JHVA 2CE6A 3OWRA 1B90A 1AYRA 2NCMA 4OJDH 3U0TB 4KKBC 5HDQL 4IOSD 3KXFB 2G3MA 2JJSC 4L4TE 5C08E 2XV2A 5F9JB 1LEGB 1YQVH 1A6TB 3G6AB 3VWKA 3MSNA 3O4OB 4I4WA 4OIFA 2QPUA 4UOZA 2ESVA 4K3EH 1I7UB 1HHHB 2G5RA 3QRGH 3DOIA 5MERB 5JUEH 1JGDA 1ZSDB 4UV4H 3EJSA 2MCG1 3RJQB 4GXUM 5C0AB 1AD0B 2O1AA 2CO1A 2GG1A 1ETZB 3LDBC 3M46A 4EI6B 4YX2H 4HH9B 1Z0NA 4ZO9A 4ODXB 4Y89A 3IGFA 1XH3A 2OZNA 4BSVA 1OANA 5CF3A 1QR4A 1BVNT 1CQYA 2BIQA 3ASWA 3FRUB 2Q2EB 5JW5A 4V1DA 1J1XL 1B0GA 5DD1L 2F61A 1MHHB 2JLPA 1TLKA 4QHNA 3B2UC 3PFUA 4GAGH 1PAMA 3O2WH 4NOBA 5DGQA 2EH8L 2ZSVB 4N3TA 3ILDA 4NUGL 4DERA 3UYRH 1A6ZB 1CGVA 3VQ1C 2WY3B 1FA4A 3RAJH 1PX3A 5I15L 1BECA 3QUYC 1BX2B 5ICZA 4C4BA 4IRJC 4UT9H 4I0KA 4I3RL 3WAKA 5DJ2B 2F1BA 2ICEB 2D7OA 1YEKH 1AAJA 2ZT9C 3FOLB 3HCVA 2YXWA 4Y9EA 3ROOB 1CFTB 4N8PA 2E4TA 1HILB 4RNRA 1E4JA 5FO2A 4D9LL 4NM4L 4EO5A 1EVTC 3JZYA 1K5NA 4ZFZB 5HHNA 3UO1L 3U0PA 2BVTA 1KBPA 3MLUH 2DKUA 3EJTA 1YNTA 2R0KH 2DI8A 4WGVB 1LD9B 3RWEB 2BZDA 3MLYL 1JHLH 1OGAA 3LEYL 1FG2A 2NQCA 2Y6TE 3NA9L 1B6DA 5E4EB 3K8MA 3QDJB 4PCYA 1GXWA 3KCPA 4FG6C 3EKCA 1TQBC 3NMEA 4QXGH 4ENEC 1TKWB 4WI6A 4L29A 4JFEA 1KCSH 3PV6A 4UBDC 5E2UH 5DSCB 5JA8B 2UXVA 4Y19D 1ZGLM 1JHKL 1THLA 1VIWA 3DXAB 3D6GA 1E6JL 4YSSA 3Q06A 1TRLA 1AE6H 2IEPA 5SX4H 5HD8D 5DMGD 4IGBD 4KH9A 3BRDA 2X2YA 2B20A 5AKSA 1G9HA 2Y23A 3S97C 5GGTL 2PCPA 2GSIB 1S2EA 4KUZH 4YC2C 4PJAA 4XO5A 4WWOA 3GMOA 3ZDXB 4JPWL 3F83A 1BLNA 1CFBA 1QHPA 4FQQB 1J5CA 1C5CL 1BVZA 5IROD 4Z3FA 3W81A 5GJTL 4PCKA 3T0AA 1G94A 3CVHA 1JXJA 4ONHB 4APXA 4GRLA 2XYCA 4GERA 3IT8D 1NICA 3KLSA 3SDCC 5E9AA 3OLIA 1V7NH 3MFFB 4YSQA 5IROC 2CDGA 1BQRA 1NJ9A 3BIKB 4FFYA 2DQGL 3LNGA 2R1YA 1NOFA 2WLZA 4WHCA 5IIEB 4OAWA 4AGOA 1E5AA 3M8OH 1BGXL 2C1OB 4NZJA 4CC4A 1AQHA 3WTTA 4E0RB 4HUMB 3GUTA 1H6EA 1RJZA 4ETYA 1E0OB 2Z0UA 2J56A 1ZVHA 1H6TA 3ULUF 2YRBA 1CLOH 2LTQB 3EZJB 5DLMH 3ZDZF 1LE9B 4Q9BA 1TXKA 4UQIM 4K0OA 1FNSH 1LO3L 4YZFF 2N0KA 3K72A 3SDAC 1WAPA 3BUQA 4U4IA 4PJ7A 4R8WL 3DHJA 3DRTA 1EJOL 3D34A 5I5RA 3P30L 4PS8A 43CAA 1TG8A 4KQ3H 4NZUH 3BJLA 3TWCH 5E03A 5I1IH 3FW6A 3KYMB 4XBPB 2NZ9D 1XB3A 2VLME 5C0BE 5BV7L 1KROA 4HZAA 1ZIBA 4P46C 3CIQA 1X7QB 4LEXL 4X6DB 5D8JH 3MA9H 3JWDH 3W9DB 1FJQA 5B7MA 2JH2A 4IU2A 3CVDA 3GUTB 1ZSHA 4N9GB 4CKQA 1GYCA 2WWOA 3GI9H 32C2B 4FTVB 2R0WH 1PZUB 5EEXA 4LB8A 3SJVE 4RMRA 5TH2B 4OFKA 1VACB 3VGAC 1EPFA 5FSJA 3MXVL 2BP3A 2FYYB 1MAMH 4AV0A 1MRDH 3BYTA 4Z0XA 4PG2C 4PS4H 4YSAA 3BEVB 3Q2CA 2Z7YA 4ECNA 4LMQE 3ZE0E 4HF5L 2V0AA 3FHEA 4QO1A 3CU1A 1ZVSA 1JYVA 3RVUC 3QUYB 4EEEA 4K5PA 2PCYA 5E1IA 3P7UE 1AOZA 2G75B 3UMTA 5JW4N 1NAKL 4N87A 1RJLB 1WTGT 3STZB 4F92B 2EVIA 4HIEB 1WFIA 1NDGA 2A74A 2FJHA 2K78A 2XT1B 2YZ8A 3FQRA 5HDLA 1R5WA 2J8OA 2JTDA 4EUPA 2PETA 2XI9A 2H41A 4QJ5B 2WZPD 1EAPA 1IC4L 1W2KT 3OJDA 4Y16C 5IVXE 2R8SL 4WCYH 3EADA 4L3AA 1EXGA 4EVNB 3T0WA 5AVVB 3MGTA 1NCAH 4Z3HA 4GI6A 3PWPD 3C6EA 3K6NA 1B9ZA 3VXSE 1NOLA 4B53A 3KYNB 3VXMA 2G2PA 4M65A 3U25A 3TGXA 2YPKB 2X4PA 4CL7A 1MG2C 2Y5EA 1ZANH 4OZHB 3PIQB 4PB9H 3E80A 1U33A 4WHTB 5T33L 4ONFL 3GXMA 1OCRB 3O11A 4YBQD 4MAYD 5AVUB 4LXFA 2DQHH 3V4LA 1QUNB 3ULUC 5I9QB 5TJWK 3HCVB 3R06B 4LU5L 3WXVL 2NXZD 2HJKB 2YD6A 5FDWB 1IB5A 4ATTA 4QTIL 4Q9RL 2XTJB 3V0WH 4CUCA 1IEAB 2AJZA 1WPCA 3FCQA 2DL9A 4JPIA 4ORZC 3VA6A 1ADWA 2ZJSH 1WGVA 3BH9B 1GZHA 3ARBA 1UM6H 2ZOLA 2DJ4A 4X7TB 3FN3A 1JK9A 4Y9BA 1IARB 3ULVF 4MDIA 2PXYD 5KYYB 4N5UA 2IV8A 1P4IL 3AS2A 2CZNA 4NPYB 2BSEA 1EEZB 5DMGC 3Q44A 4DH2A 3IFOB 3CFDA 3FK3A 4OZFG 4UQ3A 2D03L 4M6AA 2GYSA 2W80C 4GPVA 2Q86B 1SFDA 1JOIA 3CXDL 4TNFA 3SKJL 2W0FB 4BSVB 5CEZD 5D7KE 5KG9A 1IL1B 3VW3L 1CF8L 3WIFB 3QUZA 1ZA3A 2VDLH 3ZUCA 4U6HB 5DZOA 4TLTA 1VKXA 2ALAA 1ROCA 4LCUB 2VSMB 1WVZA 3VI3E 2YN5A 1QKZH 4C4KO 1KB5L 4ZFOL 4AIZA 4IGBA 3TVMB 1I1AC 4IKKA 4P5RA 4RGOL 4G7VL 4U1MA 3DMMD 4NNYB 2NUPB 1PQZA 3BQVA 4GT7A 4FLHA 4J3VA 3JWOL 5KVEH 2CDFA 4RSVA 4PFEA 1N8OE 4M93C 1MHPH 3FQUA 5EMYA 1OQXA 1TU2B 1Y0LB 4MQ7A 1ZJAA 2N1KA 4JHWL 4Y88A 5B8CC 3SYOA 1E3FA 2XQYG 5IZ7A 1KPUA 4PRNA 1A4BA 3MRPB 3W3BA 3WS3B 3WY1A 4NO5B 3KHOA 3ZDZB 2VMDA 4DP1X 1IEBB 1G87A 2O5ZH 5KYWB 1KJOA 3SQBA 1HCYA 3QEQB 1S7TA 1SEQH 3DUUB 2QJDA 1FGNL 1LMIA 2HRGA 1UXSA 4HKJA 3C8KB 2OYMA 3F12B 2GY7B 3V10A 3VFSA 5JYLA 3FV4A 5GRUL 2H9GA 1BD2D 1HEHC 3KXFE 4JN2B 4B27A 1LE5B 1Y1DA 4K8RD 1D6VH 1XIWA 2JK5A 4M3JA 5KYUB 1SN2A 3WV0A 3P2TA 4POZC 1MCFA 1U8LB 4UINH 5E1HB 3C2AL 5I0WA 1ID2A 1KUMA 2APSA 5HYQA 4YSRA 4JFYA 2CMRL 5J7CC 3AGWA 3I9AA 5C0JB 1ZHKA 4WKXA 4AEHL 1MPAH 3BYYA 4QXTB 2EIZA 5JPMC 5HYIA 1SM3L 4X4XB 4YHPA 4KO5A 3CXDH 1MG3C 4FFVD 4M62H 5KANI 4WSJA 3BPOB 3WMSA 3B2DC 1CE1L 3BGFB 4AZUA 3EGDB 3F5WB 1A6TA 3G6AA 4KJQC 1RZIB 4NO2A 5JPMB 2GJ6A 4EMZA 4GRMA 3JV4A 3EFFA 4H7VA 1MRFL 1N70A 1M7DA 4FNRA 2VXQH 2D0GA 4FNLL 4JFFD 2X4TB 2NTFA 4IBSA 4R90H 4ALAC 1WUNT 3IF1B 3FPXA 1NEZA 1XSOA 2DQJH 3TC9A 4OZIA 8PAZA 4II7A 1XGTA 2F7PA 1CIDA 5F7UA 2WCGA 1P84K 2DJSA 2HRHA 5HBBA 4LKXB 4OGQC 1UT2A 3HRZA 1RHHB 1RKRA 5HYJD 2FB4H 2MQCA 2YPLB 5E1GA 3K7UA 4W68A 3DI2B 3QR1A 4HULB 4ONFH 1XIWD 3O45B 2X6BA 1ZT7B 4MA3B 4Z23A 1KTOA 1JYWA 1Z5LA 3L17A 2A83B 4UB0L 3Q2WA 5D5MA 2D3JA 2HRPH 2GSGA 1UM5H 1SJEB 2YO3A 4B9IA 4ZMYA 1T03H 2V7NA 4PI0A 4NN6C 1HHIA 1AD9B 4KX7A 2A83A 1SJXA 3KEDA 5D5MB 4A67A 1JFHA 4P5TB 5G5DA 3GLZA 5H8DA 1EHKB 3QUZB 3ES6B 4KKAC 4ODWB 4XPHH 5MEQA 5LGJB 3UG5A 2R8SH 3H9HA 1JE6A 3DV6A 1IC4H 3S4SG 4YS4A 5C2UB 3A23A 4CDGC 5I0XA 2GJ6D 1DQIA 3HRZB 2YQBA 3TFBA 3KGSA 1UWXH 5F44A 1PLAA 3PP3H 3ELQA 1JZIA 5TE7H 1X5JA 4JJ5B 4PS7A 4MDRA 3SDXB 2EYTA 5C0RH 3TTYA 3RDJA 2C1PA 1Q94B 1T04A 3EOAB 4U3XA 5B7FA 3P9MA 3MZTA 4Z7WE 1DVFD 1HXYB 2ZXGA 4X8XA 1U6AH 4LCCB 1XGUA 3BWSA 3MPCA 4Q9CA 5LGJA 2BVUA 2YN3A 5CS7A 4Z7OE 1PY9A 2EP6A 3CFIC 1IEAA 3LIUA 1RAMA 1I9IL 3OVUB 4OR1A 3F7VA 3C6LA 3WUWB 2OMWA 2C9VA 4P5TA 5G5DB 4K3JH 2NY3B 4X7EC 2HT2D 1NPCA 3RFZC 3MXVH 1QHOA 3SBQA 2P44B 2FDBP 1WD9A 2QPDB 3O2DH 1MFUA 3QHTC 3QHZH 5F1SA 2HSIA 1JI1A 1QUNA 3O2DL 4NUMA 2J7LA 4JM4H 2BOBB 4FQJL 1QZ1A 5HVHB 5KBLA 5K9OB 2D31B 2R0ZL 3IDNA 1SXZA 4JKMA 4KAQL 4P07A 2HT2C 4M9OA 3KPPA 2CM5A 1SFHA 2HTLC 4YWGH 1DVYA 3WSQL 4NQXB 2GSMB 1BJ1J 4DHLA 5BV7H 3F7KA 2NXYB 5AWNH 1IAIL 5AENA 3RNQB 5T3XH 2NTSP 1ESPA 3QQ4B 1D7DA 3ERXA 3TNMB 3KPNA 5EORH 4P5SA 3FCTA 3KWXA 1HNYA 2B3RA 3B2MA 1P1ZB 1AZZC 3DV4B 5CLTA 1A7RL 4BZ2H 2BVOA 2GW5A 1KIQB 1T2XA 4HXBH 1LO3H 1EZVY 3MSPA 4JY5L 1BD2B 2Q86A 4G8GA 1J8HD 2I7OA 2DYPB 3GSNL 4RFOH 4X6FA 3L95B 3NEXA 4XPHL 4NZ8A 4H4NA 3AS1A 3X1GA 4CGUB 2YBGA 1P53A 3CN1A 5B1JA 2MTPA 5DD3H 4WTZA 5KSBE 3CWGA 1N8ZA 3QWRA 2YAOA 1UQSB 3N1FC 4WFFE 1WIOA 4F7MB 2VZ3A 5E5LA 4WI4A 1E2WA 3I6LD 5BVPH 2DL2A 5EZLB 3HG4A 1DE4A 4UQEA 2W65A 4YNYA 4I2XA 3IFLH 1RPKA 1B9KA 1RZKH 3SO5A 3EO0B 2YA2A 2OZ4L 3L95A 3OKKA 1U2YA 2J57A 4G6KH 1AGBB 4V2BA 5GIRA 3QIUA 2V2WA 4JRLA 3MRMB 2EO7A 1XTMA 3F64A 1QW8A 4NDMA 3LB6C 4PM1A 5KYUA 1KDIA 4NC1C 1C5CH 1U8PB 3SYQA 4EI5A 2ZZUT 4QD2E 4N9GA 3TBBA 4UMSA 3WIFA 5SWZD 3L3JB 3K5RA 4WU7B 3S5LG 4GSRA 5I8EB 1X5GA 4RRPG 2ZD0A 3PDGA 1F1AA 1U92B 3ATAA 43C9B 4RVBA 3TCTA 1OY3B 2CGRL 1HOCA 3SE9L 4EZKA 1QR1A 4XBPA 3MRBB 4Q6YA 4MXVF 2NUTB 2OJZH 3QXAA 5KJRH 3WCYA 3LQAH 1X5IA 5FCUL 4PJCE 4QT5B 4LCWA 2PYFA 3GBML 5FHBH 5DHYB 4UQ2B 1KCVH 3BD5A 5IHZA 2E75C 4OF5A 2Q3AA 1E9QA 4EUPB 1V3MA 1KENL 3LKNA 1BBDH 3C09C 1GY2A 4LNVA 1U93B 4R83A 2VLMD 5D4JA 4ESKA 4UINL 3TBVB 5DLLA 1K2DA 3V0HA 1HL9A 4HEME 3P9MB 4MDJB 4G6AC 4KJYB 1MAJA 3CVCA 3QJHA 1OT2A 1JGEB 2GHWB 5E8OB 2Y0SA 1EMTL 4L0YA 5I66A 1KJ3L 3B4NA 4Y5YC 1DFXA 4PRID 2VITB 1W72B 3D48R 3MXWH 4DGIL 1BMZA 4EI5D 2WQVA 3V9FA 5DYOA 2WTRB 3ZKND 1EBAA 1JGUL 1H3GA 3O9WC 1ESOA 4NUGH 3MCYA 4BKLB 4CU8A 1LQSR 3WN5A 2YUVA 4URKA 4DEPC 1VZHA 1Q72L 3QUXB 2JQMA 4DAGH 2AJXL 3W9EA 4OM0L 3EJUA 3MJWA 1OP3K 4EKXA 3DTXB 4JHWH 2XIDA 1YVLA 3IGKA 4PRBB 5FA4A 5FOBB 2O5YL 4GIPD 5DTFA 4DP6X 1FO0B 4QEGA 2AJ3A 2WLIA 4LCWD 4PH8A 3GSXA 5DK0A 5KVEL 4N1EA 5E9DB 4A6YB 3UL4A 1Y1UA 1BXUA 3SE4A 2ZYRA 4MNHA 2H32H 5I0ZA 5GZOC 2NY3D 3TJHD 1GYWA 1ZS8A 1ZK9A 3H8NA 2E6PA 4L29B 4YBHA 3QRGL 5JUEL 3II2A 1HVXA 5E2JA 4OTXH 4BV1A 1GS7A 3O11B 4FI7A 5F7BA 1YQVL 4ZQTA 2ITDB 2VDLL 4Z3TA 5T5NG 1INEH 1KC5L 2YSSA 4FRWA 1QASA 2D4DA 3IS0X 3KYOA 3MJ8B 4PRDB 5LDSA 3P77A 5HYSA 5EF1A 3E6HA 3RWGB 4IBTA 1CZ8L 4JKPL 4TLSA 1BM3L 1BQLL 1G4MA 2VT0A 3INUH 5D1ZA 5GRXG 4N3UA 4U1JB 4U6HA 2BNUA 1DVFA 2J5LB 2Y22A 1VFAA 3EYUH 2WZAA 4N0YL 1E65A 5DJ2A 1BMGA 5HVGB 1MY5A 4KY1H 3S35X 3C6LC 3TJEL 3NGBB 1JN6B 1OM9A 2R56H 3LZFH 3NSJA 4O4YL 4P5TD 3CFDB 4PG9B 3F2LA 3WEXB 4UT9A 1M7UA 1YCSA 3FONB 3HC4L 4QTIH 4HOZA 2X3BA 3N50A 2P7TB 4OZGF 1WCBB 2Q87A 1FZMB 2BZ7A 1U21A 1YLBB 4HWZA 3WIIL 1CQKA 1E4KC 4OLVH 4KWUA 4MA1B 3ULUE 4JHAH 4A7TA 3O6LH 5B22A 1MNUL 2IMMA 1BXXA 1JGLL 1QLEB 2VL4A 4U3CA 4AQEA 3D30A 3CU7A 4CMHB 5JXEC 4JNXA 1CYGA 3GT6A 5ADOH 1I82A 1B0WA 2D2OA 3MO1B 4N8VB 4F37K 3IPBA 4HETA 4E9VA 2K9UA 4OCMC 4H8VA 4ZO6A 4D9QE 1BBJB 1KBVA 2A99A 3MRQA 2XJKA 4CGTA 4K7FB 4A55A 2MRYA 4H5SA 4OF0A 5T3ZE 1TEFA 4KMTH 3MACL 2NW3A 1OGSA 4JFFB 4EN3C 1G7JB 1LNDE 3W9DA 3EBGA 1RH8A 5BVJA 1KLGA 4OLXL 1D5ZA 4N0RA 2AXWA 1KTKE 3QCVL 4NQUA 3ETBF 4OCSL 5A2BA 1HNGA 4U2YA 4TSAL 2OMZB 3D0LA 4P9MH 2BFGA 4GKZA 5BJTA 1Z1WA 1RD6A 4M61B 4AWJC 4U1MB 3ELAT 2EVJA 4AH2B 1QATA 2F7QA 3BLPX 4HBCH 3UJJL 4DGUA 5KSAC 3BESR 2WQWA 3L1EA 5CZKA 2XICA 4P05A 2ZSVA 5F7EH 4GIAA 3JV4B 1CFNB 3CH1A 2YGPA 4N0UE 2CH8A 3NJKA 2GK0B 5ESQB 1B0RB 2JI1A 3WHE1 2B14A 1TJXA 2FJUB 4XRCA 2AP2A 3BEWB 4IYKA 2VL5A 2WQXA 5DJ8A 1I3VA 4G82A 3T8DA 3L9RB 1PE5A 2NY4B 3S9DB 1FVCA 4H1LG 2R9HD 5FUOL 2Z64C 3EXJA 2ZWYA 2ICEC 2UZYB 4YHPB 2FX9L 3PWLA 4RFEA 4WI0A 4Y5VA 3FFCB 5K9JH 2DQDH 3NDZE 4LVNC 1VEOA 1P7KA 5JYMA 3PRZA 1UYWH 4N1HB 4OQTA 1SY6A 3JWDL 2HXAA 1R46A 1LMKA 4LEXH 2PTTB 1BQSA 3SBWC 3FQWB 2ZX7A 4HUWA 2IWGA 4YDIL 4ODHL 2KHAA 4LF3B 1VFMA 2G0KA 3CZKA 4KK5C 4UILH 4W81A 1OCZB 3EH5B 1W6LA 4G6AD 4X7DC 4LHUD 5IM7A 3OXSA 3JWNH 5C0EB 1U8IB 1R75A 4KQ3L 2B1OA 4A7GF 3BQUB 4ODUA 2WK2A 3HG5A 3QVAA 3TBYB 2YOCA 4KU1A 5B7EA 2E7CA 2JCCA 4MJIA 5INCA 5F1IB 1BYOA 4B6ZA 5A16A 2UZIL 3JTSA 3NPSB 4AKQA 2W9LA 1XD1A 3TVMD 4S0SD 4KI5D 4XAWH 2AXGB 2B5IC 1MCCA 2VLKB 3UDWA 4HV8A 1QTSA 4U1SB 1BGXH 4AKPA 2LLNA 2LAGB 2KPNA 3CVBA 4ICXA 3SBPA 2X1OA 3MR9B 1U8NB 2P80D 1QVOA 3O2VL 3VFNB 4DUWA 3FCGA 3KCPB 2Z0BA 4PRIA 4S2SA 1DBAH 5GXBB 4ZX6A 1DYZA 2R0LL 4LSUL 4HIIB 1T1XA 4NENA 2GTWB 3VI3F 1MCSA 5C0BA 2ZCKH 3D8MA 5DTFB 4JFOB 1Z9GE 5IFAL 3ASOB 1X4YA 1MVYA 2J4WH 3FBQA 3QPKA 1NGYA 4J2QA 4OZGA 2VERA 3H0TA 4IOIA 4QR7A 5AB1A 1ODUA 4ZTPH 1GL4B 1PDKA 2EECA 2ORBH 2E9GA 2NY1C 3BC9A 4YDNA 4QGYA 5E8PA 4P4KA 1IFHH 2UWEA 4HJTA 4J2XA 1HI6B 2XU9A 5ICZB 5AL0A 3ALPA 3HG3A 4NUQA 3X3GH 3QWNA 25C8L 1JNLL 3VXQB 2R69H 5TE4L 2JV6A 3C6SB 3C5ZB 3LEXA 4WKZA 4GG6B 1CGTA 2NXZB 2PABA 4GBXD 3BGAA 1AGBA 1W0YT 4D0BB 3LS5H 4W9LC 4HSQA 1QTPA 3EH4B 3IMWA 3ZI6A 3FU5A 1G6RA 3HKZA 1QPKA 3OZ9H 5DQ9B 2O6FA 3NABL 3D39D 4XR8C 3ZMRA 5E8OA 2NLJA 1JHTB 4XZUA 2JKTM 5FC9A 4KMLB 3QUMH 4FGMA 1E50A 5LN8A 2QPFA 1JYXA 4EN3B 1EEUA 3D4GA 2IQ9H 4ZAKB 1C9SA 1U95B 2LU3A 1KCBA 3FSVA 3QDJE 3GHBL 5FF6A 2LR4A 3MRHA 3ULAB 4AQ1A 3HMWH 2WHZA 3VXRD 2WYHA 1M4KA 2R4RH 4X5WB 3CBRA 4H8HA 4N2FA 5LB1A 5IUCA 5ICXA 3TIDA 1OCOB 4XNDA 2AV7B 1RIVH 1FLRL 3WKYA 3DIFA 4R2GC 1DBBH 1TQVA 1YY9D 4HJ0C 3VVVA 5E0QA 1HZKA 2ZCHL 3T6ZA 1GIGL 4PYHA 5EBLA 5DEZA 3CFEB 1Q9LB 5DR5L 4NRXA 4JPVH 1CDYA 5DRWB 2VDPH 1ICTA 5IJVA 5EIIB 4K07A 4KVCL 4G8IA 2IDFA 2VSDA 4WNJA 3NPZB 3O4OC 2BLFA 3IDNB 3F28A 3TNNB 3IAQA 1QSEA 3EHBB 3SGKA 4PJCB 3QCTH 3JWNC 2LHAA 4QOKE 2VSKB 4YE4H 1V10A 2VM4A 5HD8C 3PF2A 5DZVA 3BIKA 3VFTB 5TLIA 3IGUA 4M3KB 1E7VA 4OUUA 3MA7B 4U1LA 4L5FE 4MCZA 2XZZA 4CVZA 4NJAH 4PV9B 4CU6A 3IJ9A 3PL6C 1ND0B 2BRRL 4ANUA 5KVGL 2X5PA 5ID0B 3ZLQC 3NK4A 2HVBA 3UTPD 5EBGA 4FG6D 1NPUA 5J3HC 4JFQB 4GW1A 4PJBB 3ZUNC 2AHIA 4O5LH 1JFQL 1L9MA 4RDBA 2OXGB 1A14H 3VFTA 2MMXA 4LRNL 4U1NA 5HDQH 4DKFH 5CCKH 2FR4A 3WJMA 2ZXCA 2KPWA 4AQ8A 4PRHE 2R2BA 2X3CA 1HHHA 1I7UA 4U3SA 5AW6B 4MTWE 1KZYA 2WOBA 2F54A 4M7LL 4Z0BH 1W72H 3EJCA 1MAKA 1JZ7A 3OMZA 4H26B 2RH0A 3HFMH 1JNHA 3SKMB 4YXHH 4Q2ZB 1QACA 2R59A 1QHQA 1QMUA 2JE8A 2F54B 3DRQA 1UD2A 3BKML 4X4YB 3KM2A 3WXWH 3QUKA 2FIKB 4BFJA 3QQDA 4ZMLA 2WBXA 4HD9A 1FAIL 2WN3A 2ADGA 2H2SC 4L1SA 4YPJA 4Y5XC 1FZOB 3GRGA 4HEPG 2AABH 2R1WB 3WKMH 1A1OB 1XTLA 2W59A 4GRLC 3NCJL 3UC0L 3FU3A 1TTBA 4JPSA 5D7JA 4KQ4H 4UTAH 1HK6A 1K8IB 2A6JB 1YJDC 5AVWB 2OMTB 2YD2A 2PPDA 4MD4B 5E8DL 1P2CA 2WXLA 4K9EL 1QRKA 5B21A 3B7SA 3AQDA 5G4NA 3A4AA 5B4MC 5KSAA 2EDWA 1E28A 2YC1B 1LNCE 1QWHA 3QUGA 2VCOA 4DKEH 2D2CC 3DROA 2G5BA 2Q8BL 3PP4L 3OTTA 4Q0XL 4NOFA 2GJZB 1IC5L 4FX5A 4V11A 2ZE0A 1YUKB 3LAFA 3DNKA 3P69A 1EGJA 4PJGA 2E9BA 1UH3A 3BP6B 1FL5A 3BQUA 1ZT1A 1ZY9A 2WLNA 4ODUB 2X70B 1HDMA 4JM2B 3AU1B 4ONGH 4PG2A 5EU7C 1NCJA 5ANMB 5I19H 3IDJA 1K6QL 3ARED 1MLBA 2AKRA 1U30A 2NZ9C 3H4HA 3MVSA 5C08A 1SOKA 3GSWB 3MJGX 5E2VL 1DUZB 3RWCB 1GGTA 2AV7A 2BIHA 2XQYA 2DLHA 3AFLA 3QDJD 4JFYB 2ADJB 4F1ZA 4BHUA 3DYOA 4IRSD 3X1BA 1SJEA 1F58H 3Q5TA 4P49A 2Q6WB 5IEKA 2ILLA 4PJBE 5C0BD 3FO0L 2HPTA 1F0LA 3ARYA 3JBG7 3QEGL 5IT2L 1TSRA 1BWWA 1GKOA 4ABQA 3RZWA 1KG0B 2CXKA 3PCYA 3RG1C 1BAWA 4L1BA 2DWEB 1GYAA 1NMBH 4PJDF 1EA9C 1VA9A 3U7YH 5AFAA 5IOPA 5L41E 5J5EA 3P4MB 1Z3GH 3P3YA 3S37L 4PTUB 1U42A 3BAJA 3P54A 3QDGD 2BDNL 5I26A 2VXQA 3MLWL 3TA3D 4OUUB 4I77L 4N2DA 5BZWB 1A8JH 3TWYA 4Z77A 1KJ2L 4MMZA 5CLYA 3ATDA 4AL8H 1XBRA 3O6KH 3M1BA 5A43C 1LK3L 3LHAA 4X8CA 4JAMB 1TENA 2JKLA 5DWUL 1NKOA 1FNLA 4N85A 5ALBH 1QA9A 3I9IA 5EOCH 3RU8L 1TVHA 4DTGL 5TFSL 4L48A 1RV6X 2DY2A 1KGIA 3EFOB 5F70A 4BFNA 3GO1L 4OB5H 3UEQA 5I1KL 3ARDB 4MX7A 5AZEL 5MEOA 3D12B 4LCUA 2DMHA 1Q38A 4XNMA 5T1LA 1OTTC 1EDHA 4GH7B 2DWTA 3BN3B 3FO1A 4M29A 5B3JF 1LTXA 5LCVA 4PJ8A 3EGXB 4FYQA 2ZUUA 1E90A 3ZK0A 4MX7B 1EUUA 1AC0A 3N41B 4UIMA 4PW4A 4V1DB 4I1PA 1CG9B 1HU8A 3G6DH 5E6RB 3KXFD 4YXKH 4ZJ9A 3VRJA 4HP5A 3NIFB 1PZ5A 3RNKB 1BJ1H 4AW7A 4NP4H 3V0VA 4ZMOA 2D7PA 1Z9NA 2A9AA 2XZCL 2Y5TA 4B9KC 3I2CH 1ORSA 3SDXF 2V5TA 3R1GH 4XCEB 4N2BA 3G04B 4LCYA 1PLBA 1BCIA 2Y5TB 3EBAA 5KAQF 3RL2A 5ID1B 4CW1B 2Q7NA 4WI7A 2E8ZA 5IWLA 2C3HA 1NA8A 5I1JH 4P2QD 3VDCA 3D87B 5GGRY 3X11B 5A7BA 3AMKA 4FQLL 2IOMA 3CXHJ 2HG0A 4JUTA 3FMGH 4W6WB 3A3YB 3CZUB 1GGIL 3QULB 3T5WA 5DJ0B 2BCKB 1L3NA 5ENWB 2N1TE 1CD8A 2H3XC 1BD2E 2RALA 4LSVL 1T0NA 5CU5A 5CJ8A 1Q9WB 4AM0B 4BHUI 1AS8A 3LD8C 2NY0B 1UKQA 2X41A 1J9RA 5LGYA 3HG1E 3RIFK 1JYNA 4K71C 1KBGH 2YAQA 5DFVD 2J1ZA 3L4YA 2WUBH 3HLAB 3NPSC 4HLEA 3V5KB 4Q7DA 1DN0B 5D1XA 2CK2A 1OM3H 3SOBH 2H32A 4OZ4A 3GJEB 2BNRB 4JFDD 3PGFH 4FKHA 2JIXD 1XH1A 5FYJL 5IK3B 5I71C 1F4WL 2X70A 3GRWH 1K4DB 3K2MC 1A1MA 1Q9KB 1R5WB 3ME0A 4N0FB 4U1SA 2CQVA 2E86A 2IALA 2Y06L 3O3BA 1RHFA 3CFJA 1EHLL 1OEZW 3N85H 4LSPH 4OBSA 5M95B 2CBQA 4D9RD 4B9FA 4P0DA 3F00A 4MJIB 5A16B 3BT2L 1KV7A 2IADA 1T0PB 4KHTL 3FO2B 2VLJB 4P2QA 3NRPA 5LXGH 3P7QE 3ECBB 3SD5A 1NGXA 5HGBA 5E5MB 3UTSD 3P4OB 2RMNA 3RFRA 4K90A 4IOIB 1MREH 4PJIF 1NGYB 3US1A 3COOA 3D9AH 1OO2A 1PCXA 4KXBA 2XN2A 2ZWZA 5ESVB 5E08H 2AEIT 4HK0A 5C0BB 5TQ2L 3D39E 4I0CC 1OSZB 2DIEA 4PGBB 4WHTA 2Y36L 3HC3H 1AR1D 4PJFA 3DX2A 4S2SB 2NNAB 3T0EE 2A6IB 2J5LC 5I6KA 4ZW6A 1NLBL 2FQFA 3UPCA 2ZG1A 3R1GL 4X4YA 5GRYA 4IRSC 4GLRH 4M6ML 1A8ZA 1ZHLA 3B3IA 2R29L 5HYSG 5TDPB 3TBCA 4OF8A 3BP6A 1IKNA 3ZSTA 1UZ8B 3D3VA 1KEIA 3VMNA 1EANA 4Z5RB 3EYVA 3PAVA 2ATKB 2FGWL 1Z32X 5DK2A 3SDAB 4FC3E 1IKFH 5GS3A 4AIXA 4ELMA 3IJYB 4WUUD 5CJXA 3DTXA 5H94B 3T2LA 3EOBA 2X4UA 3STBA 3RVVC 3IAGC 1R34A 3MODL 1K72A 1J18A 2J25A 1EO7A 2PPEA 3TN0B 3EIMA 3P1VA 2BP5M 5I1KH 1QFOA 5FYJE 5BW7C 3UYOD 1P9MC 1PIGA 4IBQA 3KAAA 1P5UB 1NCOA 4LSRH 3N0PB 5ALBL 1KMGA 2A77H 3CZNA 2ZWKA 4OJFH 2EC9T 3W39A 1UA3A 5CZRA 1GGCH 3NQKA 4R4NC 5AW1B 5CU9A 3QDGA 4F7KA 3MRQB 2FNBA 2HN7A 4A2LA 5IESH 3O81A 5JHAA 5AZ2L 2CO7B 2FVNA 3JYCA 5LLIC 4RMWA 2E56A 3VXQA 4P48A 1OAZL 1JERA 5F1KC 3M1OA 1H3WM 2BDNH 2QPSA 3G5VA 3GF8A 1DN2A 2BFVH 4O51B 2APXA 1B2WH 3HNSH 1MJ8L 4YSEA 1R9FA 3L3HB 4HQQH 4TVSa 2QDVA 3N42B 4PJ9B 5EA0L 5IMMB 2OMUA 4AY0A 3SDDB 4UT7L 1Y7VA 2VLJE 3KYMA 4Z3GA 4CNIA 4LDEB 3NFNB 2WLHA 3VFRA 1F6AA 5EZIH 4CA4A 4JFVA 1QNZH 4B96A 1DUYB 1IBGL 1MW3A 4F3FB 3NSFA 3FT4A 5LGKA 1A6AB 1LDSA 1GJWA 3MI6A 4OM1L 4X6DF 4DO6A 1VZGA 2WNKA 3GMRA 4PV9A 2QL1A 4JKNA 2VERN 3FCUB 4JZJA 5AVXB 4M4PA 3B34A 1OGAB 1MFVA 3GIZH 4NC1E 1IC7L 3PWJB 4K5MA 3HS9A 5MHSD 2XZAL 3U46B 2VDNH 4JDEA 1JDDA 2HVKB 4H20H 4ZXBC 2JCCB 2ATPB 5INCB 2JXMA 3HHMA 3MJ8A 4LGPB 3QUZC 4HAGA 3H6AA 2BP0B 2FD6L 3BZEA 2YBRB 1BAFH 3ECVA 1M1XB 5IHWA 3VSQA 1N3NA 3UDWC 4JR9H 1B88A 4IHBA 5ITFA 1MN4A 3RA7L 1O6SA 1VFBB 4GKNB 1BG1A 1TJHH 3FH7A 2BW5A 3O3BB 4PLJD 4JQVC 1K3ZA 1BLNB 1BM7A 3KPSD 1R3IL 3MLXL 4Y2DC 3FXSA 2NUTA 2Y1YA 5DS8B 4YHYC 4GAFB 2MKWA 1UT9A 1JZJA 3NZHL 2XWBB 2RAMA 1NL0H 4NPJA 1SYVA 3MBEC 4KDWA 5JOPE 2HYMA 4FQ1H 5D1XB 3T1FA 3WIAA 4LVEA 5B1KA 3RGVD