4P8QA

Crystal structure of human insulin regulated aminopeptidase with alanine in active site
Total Genus 289
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
289
sequence length
867
structure length
860
Chain Sequence
b'KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-cystinyl aminopeptidase
publication title Crystal structure of human insulin-regulated aminopeptidase with specificity for cyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 289
structure length 860
sequence length 867
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4p8qA02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 4p8qA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 4p8qA01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4p8qA03
2HPTA 3CHPA 4XMVA 3EBGA 3PUUA 4FKHA 4J3BA 3KEDA 4XO4A 4XMTA 4FGMA 4KX9A 5LHDA 3B7SA 5C97A 4L2LA 4QMEA 3FUNA 5AENA 4FYQA 4XN4A 4ZQTA 4QUOA 4HOMA 3CHRA 3FH5A 1H19A 4ZW3A 4QIRA 2XPZA 2VJ8A 1GW6A 4XN1A 3T8VA 1HS6A 4FYRA 4FYTA 3FULA 4PJ6A 4ZW6A 3CHSA 5LDSA 3FUDA 4XN9A 4KXDA 4MKTA 4ZW8A 4X2UA 4K5OA 4KX7A 4XO5A 3EBIA 4KXCA 5DYFA 2R59A 3FU3A 2XPYA 3B3BA 3QNFA 2DQ6A 4E36A 4ZX3A 4RSYA 4ZW5A 4NZ8A 2DQMA 2ZXGA 5J6SA 4Z7IA 3FHEA 4K5PA 4R5TA 4XN7A 5DLLA 1Z5HA 3CHOA 4P8QA 4PVBA 4FKEA 4XN8A 3Q44A 3FTSA 1SQMA 4PW4A 3FUJA 4K5LA 3FTVA 3CIAA 5BPPA 5CU5A 4XO3A 3Q43A 5AB0A 4PU2A 3FH7A 4MS6A 4WZ9A 4QHPA 4K5MA 3FUHA 3SE6A 3Q7JA 4ZW7A 3FTWA 4XNAA 4ZX5A 4KX8A 3MDJA 4Q4IA 1Z1WA 4XNBA 3B34A 5J5EA 3FU5A 3FTUA 4XN5A 4ZX6A 4F5CA 3FUEA 4KXBA 3FUFA 3FTXA 3FUKA 4QPEA 4KXAA 4GAAA 3B7RL 3QJXA 4ZX4A 4Q4EA 3FUIA 4XNDA 4XN2A 3U9WA 4FKKA 3B7UX 5LG6A 4RVBA 4JBSA 4XMXA 4R5XA 4OU3A 4FYSA 3B7TA 3CHQA 4XMZA 4XMWA 3B2XA 4R5VA 5AB2A 4R7LA 3EBHA 2YD0A 4DPRA 5FWQA 3FTZA 5K1VA 3FU0A 4XMUA 2HPOA 2GTQA 3RJOA 2XQ0A 3B2PA 3FH8A 3FTYA 3FU6A 3FUMA 3B37A 4NAQA 4K5NA
chains in the Genus database with same CATH superfamily
5HHPA 3K91A 5C6TL 2VLJB 1XL6A 3VQ2C 1KJMB 3LKSB 5C0BA 1HZLA 1Z9PA 3Q3GB 3RZCC 3JZYA 2AEQH 2Y7OA 1NSNL 3TYGL 1UT2A 1J05B 4JFED 5GZNA 1PX8A 5HHXH 2BSSB 2VLRA 1MCIA 5CJQH 3DRTA 43C9A 3MA7B 3QDMD 1AGBA 3P7WE 4QCIA 5I1KH 1GGIL 4HKZB 4RCAA 4B9KC 3HEIB 3GUTA 3EGSA 4A2FA 3G5XB 3SQBA 2DQUL 5IFAL 4TSBH 3U9PH 1G7JA 5IB1B 1AFVH 4X7EC 2JKJA 1AO7D 2E7LA 2NY0B 4BM7A 3G5YB 3MJ9A 5J56B 4P5KA 3FQWA 3BUYB 5BVJA 1M2VA 2NLJA 2WLHA 1X9LA 3BOVA 3FCGA 3NG5A 4GP8B 3M1OA 3AC0A 3U1QA 2BFGA 2MNUA 4Z3IA 1PFCA 2Z35B 1HS6A 3QGVA 4Q6KA 4IHQA 3EKCA 3MUY1 3HE7D 3MRGB 3OMNB 1T22A 5LJYH 4XBMA 2HRPH 1BAFL 2X38A 4K8RH 4QJ5B 3MN8A 1QNZH 2X44D 1Z32X 2UXGA 1VJSA 2EICA 5HHNB 3QRFM 2KZWA 2FYYB 4APQC 4IGBD 1CICD 5F1KC 4O2FB 3VRLF 1JZ8A 2EEBA 5CGYD 2R1XB 1LL1A 5JO5A 3QJSB 2IPTL 1WBXB 3O9WB 4PJGE 2X9XA 1KB3A 2NNAB 2Z31A 1I85A 5D9SA 4LSVH 3E6HB 3STZA 4E2OA 3LKQB 3EO0B 3JWNC 2ZP8A 4WTZG 2CSPA 5AVTB 3WKYA 4HHGA 5EEVA 4WDIA 4M7ZB 5HD8C 3LSOB 1PNDA 5AW8B 3E6FB 4NKIL 1UB6A 3H2PA 1SJEA 2CKBH 3ETBF 1O7DC 4NRXB 4MQTB 4AVJA 3P7VE 4KTEH 1AD9A 5BZDB 5IHHA 3GI8H 1QABA 3ARSA 4QYAA 1TZHB 1UH4A 4K89A 4U6YB 4BUQA 1PQZB 3JTSA 1I1AD 2LLGA 3L9RA 1CU4H 5GGUB 3HG4A 4XT1C 2UVFA 1T1ZA 1W8EA 3AQDA 2GT9A 1N5YL 1AZZC 1I9JL 3GBLA 1U8CA 4QF1B 3EO1A 3EUUA 3DPBA 4OI7A 4G2AA 2FJGB 2V8LA 2AITA 2EEDA 3BVNB 1WWBX 1N26A 3BEWB 4J1UB 2BOLA 3RI5F 4I3GA 3K6SA 3EJUA 4TSAH 4OZGE 1JGUH 1WSST 2VAJA 3L45A 1F90H 3VXRA 1RIHL 5EU5A 3FHQA 4JRWA 4S0TD 2FGWH 1INQA 3TIDB 5L88L 1KV7A 2J4WH 2KPWA 3BZ5A 2VDRB 4NAJA 5DVNA 2IH1A 4M5SA 3FFCD 3WE1A 1EVTC 3TFKC 3GSWB 5K7TA 4WI4A 8FABB 2OMVA 4ZQTA 1OAKL 3KE0A 3SE3A 3LRKA 2WWMC 3L3OB 2ZF8A 3NRQA 4Z76A 1X3DA 5FYKE 2H0FA 2Y07H 1JPTL 5TE4H 3VFSB 1SJHA 1PZ5B 4ELKB 5F9OH 4MXVF 1PZUB 2Q8BH 1MCEA 3MRHB 5CSBA 1BEYH 2ZXBA 3NIDB 1PBYA 5CINL 3T8XB 4U1IB 5L7XH 5KS9B 1KBBA 2QMKA 1S7XB 5K9QI 3L6FB 4RA3A 3HLAB 3OM3B 3Q6GL 4S11A 2I5YH 1UZGA 2WXOA 4FFZA 4JFYB 4V1DB 4ZQKA 3SGKA 4LZKA 4X5QA 3O8XB 1DVFB 3DUSA 2JB5L 2X0VA 1YMHA 3GHEL 3OX8A 3WUWB 1NFDE 1SMOA 4IRJB 1CCZA 4Q2ZB 4IRZH 4HJGA 4LASL 3EGXB 5D1ZC 3RZWA 4Z7NE 5AEAA 5BXFB 2EC8A 4JGNA 3C87A 4YDIL 2VN6A 4ZNEA 1MFAL 1KNOA 1G7QA 4B60A 5IV2B 5E9DE 5JW3L 4TTGA 3DROB 3T6XA 2EDMA 3II3A 3CLFL 2PCFB 2C9XA 1QD0A 1FGVL 3W37A 4PRHB 1YY9C 1IFHH 3IDXH 3TJHC 4J3OC 4PW9A 1QFOA 1J1OL 3LXAA 2X1OA 2XRAL 2WTOA 2WXGA 4GO8A 3S3CB 5I16B 3QYMA 1TVBB 2IGFH 1ZWIB 2YPLD 1I9RH 3K6IA 4J6RH 2B59B 1MWAB 4FQQA 1BD2D 3I02B 3TYFA 1UXMA 4F8NA 3CDZB 3ZR6A 3BD5A 1EJ8A 3ARDA 4RMQA 4B6ZA 1D6EA 4U49A 3WS3A 2AQ3A 3I2CL 3UJJL 5E2WL 3BQUC 1EMTL 3MCG1 1DQVA 4B9CA 5J0BA 2BDNH 3F84A 4NWUL 3FU7A 3QCUL 4L48A 4UDTB 2BP8B 5F7EH 2MNWA 2O5NA 1RJCA 3PDOA 5CCHE 4PJ7A 2HUEA 3C5SA 3EBHA 2HRGA 1ODAA 2QPUA 2F7IA 3ECBA 3UG4A 4XWOC 3AY4C 5FYJE 1X5AA 3TC9A 7FABL 4PPTA 5DZLA 4NP4L 2OI9C 1RUKL 1KXHA 2D3VA 1YEDB 3S37L 3JV4B 4PLOB 4AW4A 3RG1C 4AZ8B 2AVGA 4WFFE 2GG1A 4E41B 3EH2A 3WY1A 4QRPE 5IB5A 3O3DB 1OCWH 3RDTD 3NQXA 3U9UA 1EIBA 3ZOAA 4R4NC 1KXTB 1NC2A 3DURB 1T4WA 2NX5B 3IBOA 4RDQG 3FKUS 3SKJH 5CEXB 3CFCL 2VE6B 3D18A 5AG9A 1QLEL 4GKNA 3MV9E 4IRSD 1QSFE 3EYQD 3B5HA 5SWQA 5K69A 2E8ZA 5DR5L 2IPKB 2OPCA 2Q0ZX 4BGLA 3VWJB 5C0GA 1TTRA 2JQAA 5DQDL 2YXWA 5GS0C 5D2LF 1K8DA 1TZIA 2H9GB 3JYBA 4GQ9H 3MOAL 1WTLA 3R18A 2O61B 2DIEA 5TQ0L 3D85A 2AQNA 2ROXA 4CSZA 3A67L 1Z9OA 2NUPB 2DL2A 1VZHA 2ADIB 4MB3A 3S5YA 4K9EH 5ISZB 3L5HA 5ADPH 1BVOA 1JV2A 1S2EA 1B4JL 1OT2A 3WNPA 1TNNA 4N0FA 5GJSL 4J3WA 1UKTA 2QVIA 4JW3A 4ZXBD 3CMGA 4JL1A 3H4FA 1MWAH 4ODSL 5D7IE 4FQXB 4L1HA 2ZAGA 2FB4L 1KLFA 1OTTD 1YNKH 2H2SC 2WQSA 4UM8A 4YHKL 3HVDA 4TUUA 3QW9A 1CFQA 5BMFL 5I1IH 3MBWB 1KYFA 3JWDH 1F4WL 3ATDA 2UY7B 3QXUA 4L4VD 2P24A 4BQBA 2BMKB 2O26U 4JM2C 3TM6A 1ZHBA 5KYXA 2BSRB 2D31A 5LWYH 5DHVA 2WHZA 5DTFB 3WHXA 1UZ6F 3T0AA 1AZRA 2VDRL 1ZGLB 2NSQA 4YPJA 1OE2A 5GGQH 2F68X 3IPEA 1G7LA 4ZUTB 1TTBA 3TXAA 4HIJB 1KEIA 1H3TA 4XNDA 2JKRM 2WB1A 1RSYA 4HHAB 1HT6A 5EZIH 5ICXB 5L8KB 1IGYA 2H2PD 2C7FA 2D3LA 2X1WL 3SDXA 3O3AB 1AR1D 2B1HH 4IU3A 3KNBB 4ZOAA 3JWNE 1PLAA 5D5MF 3AAZA 5F1NB 2HLAA 3VXSA 4PV8B 3EH1A 3QXAB 1KR6A 3F7VA 3SYAA 3W1ZA 1REIA 3E7JA 1F58H 3FFOA 3MRLB 4HZAA 1F8TL 4JB9H 1RK1A 2P5EB 2R0LH 4OFDA 4DZBB 1O7DE 2QR0B 1ZE3C 3H55A 4NBZB 3C75A 1IIKA 1NPNA 4J23A 3MSNA 1KZYA 1P4IH 1PZDA 1FJ1B 1U8QB 1U3HD 3GIZL 2MQ3A 4PGBB 4B0MM 5F96H 5CWSA 1X5ZA 2OMWB 2EO7A 2O5YH 1GSKA 3HI1A 2DLEA 3MUHL 1UWEH 5D6DA 1UEYA 3UP1A 1HCZA 5FX3A 1BQRA 1IAIM 3TURA 1J87A 2IWKA 3DO4A 4LF3B 4W93A 1IEHA 2PNDA 1R3KB 4UQ3A 3CFJB 1EXUB 4KKAC 4LB8A 3UMNA 5GGTA 3TBVA 4ETQA 1N2RA 4CKQA 4LSPH 3LYRA 4F3FA 4X2UA 1FFNA 3IRPX 2CO1A 5KSAB 3BIKB 4OM1L 3VB8A 4KROB 4PJAA 1VFBA 3HBPA 2HFTA 4XX1G 5TDPA 3TCLA 2XZZA 3L95B 4NSKB 4CVWA 3V52L 2V3DA 1JRHI 2NR6D 4XC1H 4J3XA 2RB8A 3QQDB 4NQED 3VFWB 3B2MA 4P3CH 1HILA 1PZCA 1IM3A 1S7QB 3BAIA 1RZ8B 4LLYB 2IG2H 2HTLC 4KKPA 5CEZE 1RZFH 3VI3B 3ZQWA 4A55A 4JRYD 4M4RA 3SZ6A 5E5MB 3QR1A 4G59C 2BIPA 2VJXA 2DKUA 5GGSB 25C8H 2NY6B 4NENB 1YEGL 2EABA 4HWBL 4U1GC 4AC4A 2VN7A 5D2NE 5ESAA 5I73C 5TPWH 5E6SB 2CUIA 3BJLA 3HB3B 3MXVH 3NT0A 1CL7I 5CO1A 4WO0A 4UAHA 3AWGA 4KJWD 4Y16A 1KTKE 3U83A 4CMHB 3IGFA 1ZHLB 1ZDQA 1DQLL 5JIKA 5FYJH 1XH3A 2MOGA 2N1TE 4QRBA 2BZ7A 4JM0A 3L2LA 1NZRA 4NQQA 4U1SA 3ZE1B 1QSZA 5DQ9B 3OKKB 3TS8A 3EFFB 2D4DA 5KG9A 3KPRD 4XBPB 4YIQB 3OXSB 3LQAL 5KVMC 1NCTA 1NLDL 1T7WA 2J5WA 2OTUA 5FUOL 1D7BA 5ADOH 2IDSA 1LE5A 1G6RH 2HJFB 1KIQB 2TSAA 2JQMA 3CFEA 1PVHA 3OL2A 1NANH 1QRND 1NCCL 4TUJB 1S7UB 1HOEA 2LVEA 2OR9L 4YR6A 2CO3A 4X7SL 4AIEA 4JRLA 4RFNB 2CKBA 1B2WL 4K5NA 3NRFA 3WLWC 1N12A 3QIWA 1MXGA 1NDGB 4ZPVB 1IAMA 3WHE1 1SXBA 3AXHA 5TK2A 1GS6X 2X4QB 3EH3B 3VH8A 3MX0B 4YS4A 2RD0A 5BW7C 2F53D 3EG9B 2EEXA 4OLEA 5T1LB 1OLZA 1QPXA 1ZSHA 4IEFA 3HNVH 2YAOA 2CCLA 4WUKL 2HH0L 2XWJB 1W0VA 1QBAA 4QHMA 2UWEB 5D71L 3TJEL 1FG9C 1U4FA 1Z5LB 4LPXA 4B9IA 5CJOH 4JHAL 3T2JE 1F6FB 1UA6H 3MRBB 3KBHE 4AMXA 3DNZA 1BQLH 3BVVA 2CIKA 1MNNA 2APFA 3VMPA 4JRXA 1CICC 4ZO9A 3Q9QA 2AEWA 3C5ZB 2I24N 1D7CA 5I6XB 5E23A 4HWNA 1IZJA 4GSUA 2IH9A 1C5BH 5IBTL 2VMCA 4KJYB 4WFHD 1U8LA 1NGYB 4Z7IA 1JFHA 2IFFL 4BH7B 4FTVD 1EAJA 1OPGL 3CSGA 3X3GH 4OD1H 4F27A 3FRPB 4JUSA 5FAAA 3CVCA 1UZ8B 2OCFD 1OAZH 1IBYA 2EUVA 3FCUB 4M61B 1U8JA 5H37G 5LXVA 3GBNL 4LLDB 5GRWA 4AC2A 2E9JA 5I6KA 2P5WD 2FX8L 2KDYA 3VG0H 5MEPB 2CR6A 3LZLA 2WLKA 4ZAKC 1VFUA 4PI0A 4JO1H 5HSFA 1DL7L 1TVHA 2JWYA 5DVOA 2OQJA 1I1AC 3BQVA 3OHXC 5AB9A 2G5BA 1QBML 5AFAA 1IGIH 2WSKA 3C6SA 4JFDE 2IFGA 1O75A 3CFBA 4I2XA 5GS2H 3WFEH 4PJDF 4IRZA 3TT1L 1X5IA 2EYSA 3KAAA 5LCVH 3H42H 4D9LH 1KPRB 3ZTEA 3X14B 2FO1A 4B97A 1MF2L 3NSYA 3FO1B 3BDXA 3VD5A 5DK0B 1FL3B 5T33L 3MRJA 3IDIB 4TNWK 4HJJL 3MLYH 5AOKA 1Y6NR 5EN3A 2DWTA 4X7CC 5B3SB 4WCYH 4JG1L 2EEFA 2Z1KA 5DLMH 3R06B 4Z7VF 3EDKA 1BSIA 3TO4B 2VDNL 1CI3M 5I1CL 5LDUA 3CZSA 4R96B 1JDAA 3DV6B 2FNBA 3I75A 1QQDA 3RNKA 2CHDA 2R2HB 3QJZA 4PD4J 3WCYA 4CU7A 5GZOA 2MCPH 2XWCA 1A22B 1JK8A 2GCYB 1B0IA 4OJDH 1XZWA 1NCDL 1KTDA 2DRUA 4NBYB 3L08A 3H9HA 3KEDA 4XHQA 1AH1A 4L18A 5DO8A 3PP3H 1S7VA 1JJUA 1T04B 2BVQB 2HJLA 3EJYD 4IW4C 4MJ5B 2R4RH 1MJ7L 4OZHF 4DVRH 3VI4E 1CYWA 2VKWA 2YMOA 4XOCA 2OCCB 1L9MA 2ID5A 3DETD 4EEEA 2OZ4L 1PG7L 4C56E 1OY3B 4JZOA 5TDOB 2O1AA 3GMNA 1MRCH 5C9JB 3GJFB 3NFNB 4PJCB 1UASA 4WK2B 2A9CA 1XB8A 2AJ3A 2F19L 1BM7A 1ZVNA 4Y2DD 5K33A 3L1OL 1F4XH 5CJXA 3FW6A 1KCVL 1CT8A 2K1MA 5C7XL 1FPTL 3FB5B 4RFEA 2A6JB 1CG9A 3HRZA 5I8OH 3HG3A 3POHA 2IDUA 3FU3A 1T2QL 4K3JL 1G7MB 3QZWB 4K94H 1AZCA 1ETB1 2J55A 2PO6B 3F58L 5GRYA 4IIQB 3IGLA 5ESVB 1AIZA 4PJIE 4GUCA 3QIUD 4M03A 3HC0A 4OM0L 4D8PA 3X12B 1QFUL 3FSWA 3GEWB 4PRAA 3NN8A 2JJTA 1S9XA 3D48R 4HGMA 2XXGA 5A16B 1FZMB 1LWHA 1ZLVH 1KGCE 1IAOB 3OHMB 5KVEE 3FN3A 1ZT4A 3OLDA 4L3EE 5JUEH 2ZCKH 2PKDA 4PJGA 3SO3B 3P69A 4WU5B 4XCYB 3P0GB 1BBDH 3T4AC 3NJIA 4GUOA 5EA0H 5LGKA 2R69H 5MI0C 4NM8L 1NMCB 1PY9A 1XGPB 2YMXH 3R8BB 1JHLL 5FECB 1U93B 2V4LA 1P5UC 4W4OC 2PP8A 3DV4B 4WWKA 3QFDB 3VM7A 4ES8A 3FB8B 2B9BA 2C7UB 3UTPE 4PCTA 4D2NA 2F6AA 1AC6A 4WVRA 4IOIA 1KCBA 4LCUB 3HR6A 4L4TE 2J1WA 3DJZA 1S3KH 1LO4L 1QI5A 3GQFA 1WFMA 2OMUB 2WANA 1KXVC 5HGDA 1AY1H 3QCTH 1OSPH 1RPQA 4MQSB 3FQUA 3DJ9A 1F4YH 2Y7LA 3IMTA 1JPGB 1DE4B 4Q6YA 4Y4KB 1P4UA 3Q2VA 4P4KA 4UOW1 3HMXA 1WEJL 3B4NA 3RJOA 4LIQH 3D3VB 4NJAH 3VXOA 4D0CA 6PAZA 3QWRA 4QGTA 1JZ3A 4AEHL 4RBPK 5G4MA 4BWWA 5LVEA 3EYQC 3P0VH 3TVMC 4BGDA 5FGCE 1JXJA 4JANB 3FOLA 3VRLE 3IDGA 1Y1UA 1KJ2H 1FNSL 3DJRA 4PTTB 2DQHH 4XO4A 2EXWD 5ENWB 1BZ7A 3FONB 3WXVL 3KLAA 5DUBB 4N8VA 4DZ8B 2Z4QB 2Y4SA 5SWZB 1KROA 3IM1A 3RP1A 5HGHB 1M1XA 4OZGA 3HS0C 2X05A 1H5BC 5JHDE 3U6RA 3S5LA 5FW6A 3OPZL 4CMMA 3CDGB 4YAQA 3TN0D 2HZHA 5ALCL 4ELDA 3PFUA 1MCHA 4FN0A 3S4SA 2WXHA 3L3IA 3M7FB 3C6LD 5AAPA 3LNEA 4HSQA 4ZTPH 3FT3B 5IUCA 1A6VH 1WWWX 2AQ1A 2JLPA 2EE2A 4ZXBC 3K80A 5C09E 3E9TA 5DJCA 2YEZA 2KERA 3APFA 2K6WA 2J7LA 1WP6A 1NMBL 4K3GA 4MQ7B 4OSUL 3MRIB 3NJLA 1QFWM 2MKLC 3ZDZB 4ZZKA 1PD6A 3S2AA 1BQBA 2XICA 2DM4A 3AABA 3V9EA 1VFMA 1HE7A 3SBRA 2HX9A 1H8NA 2NUTB 5I2IA 3HIZA 3MOBH 3Q44A 3IDJB 4IKKA 4O02B 5EC1B 1MCNA 3T2NL 1FFOB 4KKCD 5PAZA 3A4EA 1MAML 1U3NA 2ADGA 2H0PA 2WXJA 4YNYB 5SWSE 4AEIH 2N56A 1BZ8A 4KVNL 5B39A 1NFDA 3RWGB 2R8SL 3EHBD 1BX2B 5I76B 2CBOA 1OWRM 4DFIA 1KWGA 4M6MH 5F7FA 2H2PC 1M2VB 1YEFH 3F65A 5HDLA 2J43A 5E9DA 1TJGH 3QPXL 1DFBL 1M53A 5JQHC 2B4CL 4DP8X 2I60H 3QYCA 1BJ8A 1I8MA 1I8AA 2YPKB 3BGMB 3I84A 4JHZA 2A6KA 5FW7A 3SE9H 3AS3A 5JA9A 1Y6MR 3QEQD 2ATPB 4YEFA 2ZUTA 4GW4A 3LJ3A 5K9OA 5LG6A 1BZOA 1OZTG 2QPSA 4MXVE 3U4AA 4CC4C 1ED3B 5GSRB 5J1SC 5HY9A 1KEML 3KXFD 2HVKB 2V5SA 4RRPA 1U3HC 2BZCA 2R0ZH 5I6NA 3QWOA 4UOJA 5JO5B 5K9QG 4DGUA 3WTSA 1TIUA 3WMQA 3UTSB 2BW5A 3KPOA 3PPEA 1OARL 1ODUA 1KTOA 1MLCA 1RZIB 2A4ZA 2XWXA 4OJAA 4ONFL 3CFDB 4FS0A 3UZEC 1IGJA 2EDJA 2I69A 1RUQH 1LNUA 4O00A 4J3BA 2CO7B 4F2MB 1UM4L 1V7ML 3ZO0A 2ZD0A 4FGMA 1ZE3H 1PSKH 1QMUA 1X5XA 3GTNA 4UF7C 3W2DH 5FGSA 2CGZA 4W81A 3EDJA 4QRPA 1ZHKB 4BSWB 2A3TA 4XXDA 2JXMB 1CGUA 3PGCA 2ZQKA 3V0WH 1G6RA 3ARED 4RFOL 2Q20A 3SY6A 3FFCE 1OM3L 3OXRA 4PRDB 1EEYA 4UT7H 3NJXA 1AOHA 4RZKA 2C3VA 2ORBH 1JGDA 2EH8L 3EJCA 2H32A 2YBRA 5EPMA 3UZQB 1B6DA 3MV9A 3SCMA 1QSFA 2MPAL 4ESKA 2V7NB 3ZKXB 5J13C 4KXDA 5ITBH 2WINA 4I3SH 5INDB 3C2AL 3ESVF 3ABKB 4Q14A 3WMPA 3S8FB 1E3FA 2BNUB 1IJNA 1GIGL 2WZ0A 2UZIL 4POYA 5KVEH 2A9BA 4X6EB 4AYBA 3MUGA 3WO4C 2FTAA 1X5KA 2G3NA 5I26A 4KI5C 5CBEB 3GS4A 4JPWL 3GPEA 1XTMA 3CZEA 3ILPB 4ZYKA 1F11A 1AQKL 1MQ8A 2A77L 5K39A 2WVVB 4QYOA 4WHDA 1BFTA 5EOTB 5HJBA 3WJLC 4PG2C 4OCYL 3AU1A 2QQKH 1NAKH 4R26L 1MJJA 1JYWA 4KJWC 3MODH 4XI5D 3TZVC 4EQ2A 3FC8A 1JPST 2UZYA 3N50A 4FFTA 4NZUL 1UJ3B 5C07E 2D03H 4MS6A 1WZ1H 4PGCA 1P6WA 2WLNA 4G9DA 3QJRB 1CFNA 3IFOB 1W2KT 4KY2A 3ZK0A 1GZQB 4HJ0D 5D7IA 2OJZH 2XTSA 1QHQA 3AUWB 4YSQA 2FHCA 3LH2L 2WN2A 2NT0A 3OD3A 4CW1A 2FIKA 3PXHA 4O2CB 1UKSA 4FG6D 2DQIL 1OF0A 1EGJH 1KL6A 1FZOA 4TVPD 2RFXB 4AX3A 4ZO6A 1A8ZA 4XCFH 3P7SE 5DT1L 3D25A 2NY1B 4AT6A 4C83B 3OZ9L 2ADFL 4JFZL 4YHMH 2VSDA 1J48A 1RERA 5C8JA 1U4GA 3QCVH 4BBWA 1HESA 3CHQA 1RJZB 1USQA 2CK0L 1QSVA 2YD8A 4PJFB 4I1NB 5KBKA 3CE1A 2GY5A 3OKLA 1ORSA 3JVFC 3ZO9A 3DX6A 4JDEA 2VUYA 1J8KA 1ET8A 2XETA 4FXLA 4LQFH 5FM4A 2HFGL 4KQ3H 4G8IA 1CVSC 1MCWW 3RVTD 4RSVA 2YRBA 3HN8A 4GBXA 4M48H 4N8CL 4FXTA 4PGZA 3UC2A 2DMGA 5HHQB 4O4YL 5ALBH 3P9LB 3NIFB 1U30A 1X9RA 5GRVL 2X4UA 3MZGB 2RHEA 1MHCA 2Q6WB 4FNTA 4KO7A 1CD0A 2NY4C 1RIVL 2J88H 4WI2A 4LLVB 4M8QA 3MKKA 4JFUA 4QTIH 4O02L 3GSXB 4QO1B 5BRZD 3UACA 5J11B 3VFMA 1CLOL 1MKFA 2MHAA 2MIZA 4KVCL 4OFYD 3U4EB 5KYYA 4HVBA 2GJPA 4LOUD 1NBCA 4UIMA 3MHZA 4D0BA 3MA9L 1B2YA 1AR2A 3CH1A 2WZ6A 4OLVH 5I5IA 4Z7WB 4MAUL 5FCSH 4OGXL 3KPPA 2BLFA 2QQNH 4U6XB 3MJ9L 4QIRA 3NSXA 5J8OA 6TMNE 5H94B 2W0LA 3NIGF 3U0WL 4KRMB 4ZO7A 3ZQ9A 3ULSB 2WQAA 2X2IA 5FDWA 4MNHB 4HUVA 5DZ9A 1Z9MA 2FHFA 3BWSA 4G8GA 5ELIA 2W94A 5MEND 1URIA 4NN5C 3CLEL 4HK3J 3O6LL 2FWOB 1K3IA 3B56A 2CNZA 2YUVA 1BMZA 4NQCB 4KUCD 2Y2YA 3P02A 1SFHA 2FUQA 1FL5A 7TLNA 2B16A 4Z8FL 3THML 1W8NA 2ICWJ 1ECZA 3O0RL 2NW3A 3LRSA 1XF2B 3T1FB 4NUQA 1M4KA 3ENEA 3HC4H 3MNVB 5BPPA 1ZK9A 5T3ZE 1BVLB 3D51A 4XMKL 3BKCL 3MZTA 4POUB 2OJEA 1AE6L 1DDHB 4WWOA 3WJMA 5KSVA 4JMNA 3QZOA 5CP7B 1N8ZB 2DIBA 2DWEB 2IPUK 5HI4D 2AC0A 5KYNA 3QJVB 4F15C 3KLLA 4C8XA 1FLRL 1A6WL 4FRWA 4TULH 3B34A 2D7QA 2DYPB 1UCBL 2HAZA 1P84J 3AM8C 4L1DA 5EO1A 3UBFA 5AAWC 1IC5L 4Z78A 4YHNB 3MLXH 5D2NA 4YXHH 4G3YL 2VLMD 2APXA 3V0DA 1PF3A 1U8IA 3SQOL 2DQDL 1QBBA 4ODHH 5DHMC 4D3CH 4Z5RA 3VXPA 5ACLA 2H1PL 5T3XH 1R3IH 3LDBC 1KJVB 2G3XA 4NHUA 4LCWD 5D1ZA 3SIKA 4HOWA 4CSPA 5L0QC 4ONGH 1S46A 4P0DA 4NNPH 1SNRA 4X6FA 5HYJD 3OB0H 4R90L 2NCEA 4LU5H 1FNAA 1CXKA 2E56A 4N8PA 1LEKA 1ZIAA 4KUCF 3EJYC 1T0MB 1IC7H 1ZHNB 2NRDA 3FUMA 2E9WA 1CGXA 3KWWA 3QWQB 4L8DA 5HHOE 1W80A 2V5TA 1IBBA 4P4RA 3DETC 3WELA 2WBJB 5HHMB 4EI5D 2IALB 3MO1B 5FA3A 3CZKA 5ID1B 3AZUA 4W9ZA 3T4YA 3DI3B 1KC5L 1ZVSB 1FSKB 1AHWB 4KY1L 3D0VB 2G30A 5J4MA 5FF6B 3U30B 2LTQC 1VEMA 4H5SA 2OTPA 43CAA 2APSA 1LK3L 1Q72H 1OGTB 2IMMA 3CSYB 3BQUA 1I8UA 4L8BA 2WLLB 4TMPA 3IDMB 2XFGB 1ZT1A 3F12B 1I4FA 4QHUA 5IQ9A 1FRGL 3SDXB 2DQGH 3T0XA 1IEBB 3O3EB 1QUNA 3IEAA 5BS0E 3AY4A 2NYYD 3FBKA 4MA8H 4PLKC 1OVZA 4JR9H 5CCJA 5H4YA 1F3JB 1KJ2A 1D6VL 2BIQA 2J2ZA 2A73A 2ROYA 4XCEB 3LNGA 5D7KD 4FP8H 5F44A 1YEHH 3LS4H 2C1PB 4PGJA 1GY2A 4PJXE 1AMYA 3KYOA 4UANA 1RU9H 4PAZA 4HA1A 1WITA 4BK8A 3RB7A 3T3PE 4RGOL 3U79A 3K6DA 4HAGA 4EF3A 4ZFFB 2BVPA 4UT9H 1EHNA 2RCSL 4GRMB 5ANME 3C2SA 2DDQL 4L1BA 4TRPH 1E4JA 1LP9E 4TVSa 4G6MH 1OAUH 5IM7B 3ARTA 4M1DH 3HPLA 2WWKT 1TZGL 2XJLA 1TETL 3ATAA 1NFIA 3DBSA 1MFEH 4Y5YA 2JB6B 3V4PB 1JCVA 5C0AE 1PLGH 3AW5A 4JHWH 4K7FB 1PPIA 3F64A 1UTDA 2YD7A 1DBJL 1I9EA 2ODHA 2VN5A 5ICYA 4TPRH 1OM9A 4GP5B 5LUMA 2V2XA 1QSEB 3L4TA 4I5BA 1JI2A 4KI5E 2IV8A 4HCRL 1TLPE 1M7DA 2OXHA 3LKNA 5CZRA 4CNIB 3UTTD 3BZEB 4PYGA 1UFUA 2YAFA 4IDJL 3RWFA 4UTAH 3BP6A 3Q1SL 2WW8A 4G7YL 2I85A 3HZMB 1BVKA 2DM7A 2XN9E 3EYUL 3PWNA 4JFDA 5A43C 4BFBD 2DLTA 3R1GL 2KT6A 1DUYB 2IWFA 2R83A 2J8HA 2FQEA 2XXMB 2EXWC 3ARXA 4LKCB 5I82A 1E28B 4JQXC 4LO9A 5SX4H 2EVHA 3ZTDC 1LO0H 1MQKH 1UJTA 5KVGL 1PGRB 1G7IA 4P5TB 5BOPA 1J8HE 1T20A 1UB5B 4FXGC 4LEXH 5IJBC 3PNWA 4BDVA 4U6HB 1H0DB 3VQMA 4I0CC 3KEHA 4H25B 5KTEH 2VDPB 4JM2A 3G6DL 4ALAL 1E40A 1CD8A 1MUJB 1LD9A 4LEEA 1XR8B 1R9FA 1C08B 1CD1A 4LVEA 3D0LA 4NWTH 3RGVD 1D9KC 4MYPA 2ERJB 4Z7UE 3SKOB 2XZAL 5BRPA 1ETJA 3ROLB 1RQ5A 1MIML 5AB1A 3ISRA 3RWIB 1CE6A 3U46B 1JF6A 3DARA 2B7DT 1H19A 4Y2OB 5F6HJ 3BMWA 4LESA 3VI4A 4ZRGA 5KN5A 2VMJA 4LCIL 5E6ID 1B90A 1RUPL 1SHXA 4LARL 4X7TB 3LRLA 5IF0A 2FQDA 2X89A 5I8EB 1R3HA 4XBEL 4KKCC 5DUML 5T3ZH 2A38A 1LDPL 5CJ8A 5E8PA 4NQVA 2LLLA 3GI9L 4OI9A 1G9NL 1XWVA 2CZNA 3EHBC 2MCG1 3V4PH 3CUPA 3TNNB 3VCLB 3WFCH 5EO9A 4LSSH 4NDMB 4OFPA 2X6BA 4IJTA 1S7WA 3PQYB 1L7TH 3UJIL 4UZGA 5E0FA 3TIEB 1A7NL 5C71A 1ILUA 4I4WB 3APDA 2VCOA 2Z93A 4R7DA 2FWLB 3NCJH 4A68A 3DMMB 2D2OA 4PJIA 2GSGA 4IK6A 2CRZA 4MJIE 5EBLB 4RAVA 1F5WA 4MJ4A 5C0IA 5C0JA 5EEZA 1FVDB 2BFVH 4GG8A 1UUSA 4G82A 2FHBA 3O6KH 4QRTB 1KPVB 5JLZA 3PP3K 4RWHA 3EFOA 3M17B 2WYTA 3KJ6L 3TL5A 4L3EA 1Q0YL 3UYRL 3F7LA 4YLCA 4HQQL 4W9LC 1AZUA 3C12A 3GSRB 3QJHB 1AXSA 1C5CH 1V55B 1Z0NA 3O2WH 1AVAA 4RAUA 3MS3A 4FLOA 4XN2A 1G9MC 4KQ4L 3NFPA 2IQ9L 4R0LC 2ZWZA 2IQAB 4PJ5B 1L7IL 4PR5A 2PXYB 3M46A 5FKPA 2V9UA 2X4SA 1BOGB 1A6UH 5DC2A 4EKXA 2VDPH 4DGYH 2ESVE 4IS6B 4U1JA 5DWUL 4LNVA 1FNEA 2XN1A 2W88A 1JN6B 1MLBA 1QLFA 1RJYA 4L4TA 5D8JH 3N42F 3FQRA 2H4EA 5LGHL 3D6GA 4YHLH 2DBLL 3ZDYF 3OAZH 3IE9A 1DJZA 4FABH 2A74C 4I0PD 1P4BL 4QDGA 3VFGH 2M8XA 3AREC 3CHPA 3H56A 4PW3A 2W81C 1EGJA 4KNSA 5B1AB 3WDHA 3I6SA 1RK7A 5IGXH 5IR1A 1O5DT 1NGQL 1BMGA 2XA3A 3UERA 4G7VH 5CMAB 4HS8H 3ARGD 4R8WL 3J27A 1SEQL 1XCQB 3EZJB 5E1HB 1ZLVK 5DMKB 2YD2A 1EFXB 1ASOA 4PB0H 1NIBA 1YNLL 4FULA 2BSDA 1WE5A 3CV5A 2O6CA 2G60L 4X4YA 1TJMA 4FNRA 4AI7A 5DZPA 4MGXA 2LT9A 4NQDE 3UYPB 4JFFE 4XO9A 4WNQB 5EN2B 3RUGF 2WWNA 1WC7B 1EEZB 2WVSA 4K55A 2X2UA 4LHQB 4C4KT 3CFKB 2XTJD 1KENH 1DSWA 4KBPA 5JHDA 1YMME 5GGTL 3WY3A 5E99L 5TE6H 5H37H 3L2MA 3SKMB 3VW3H 2EDFA 1QF2A 3NMEA 4PRPD 1XH1A 5EORH 2Q8AL 5JORA 2BP0A 4OLXL 1W0WB 3FBOA 3WFBL 3T09A 1CGSH 4UQCA 4XI5C 4H26A 4E36A 1L6ZA 2O5XH 3I75B 4ZFZA 5SV4A 3SEPA 2J56A 1PKQE 2QVFB 2YEVB 3EZ8A 3RTQC 3FOMA 2IANB 4OGYH 1RZJL 2W60A 3DK2A 4JO8A 4Z77B 4F92B 1A9BB 5IEKB 4S1SH 5C09A 3PABB 4HJ0C 2JCCB 1TQCC 3RWCB 1NBVH 4FC3E 5BW7A 3K1DA 2OMZA 3QFJE 3VA6A 4PP1D 5AUMA 5IFHL 1I1CA 3G7TA 1WFOA 4DGVH 1MCKA 2VDOH 2EZ0C 3F01A 3OGCA 5E4EB 4FG6C 5IVOA 4Z3FA 5KBDA 3W0WE 3FT2A 3UO1H 4CVXA 2Z7UA 4MJ6B 3GBEA 2L7QA 3FTWA 2K8MA 1NCWL 4HAKA 1TKWB 4M5YH 5IBLC 3UTQA 5SWSA 1HHKA 1EZSA 1TQBC 1NCJA 3WY4A 2V17H 3OR6A 2J5LB 3LTVA 3CXDL 1JGEA 2OP4L 4BXSV 3HG1D 4RGND 5EC2B 1BM3H 1K4DA 1HH6B 4P05A 3W5NA 1YSOA 3RVTC 3KYKH 3N06B 3QORA 4U1NB 1R5VA 3WNMA 4KO6A 4BEIA 5F3BA 3QUXC 4NGHL 4KTGA 4R5XA 4X6BB 1MI5E 2AXGA 5AB2A 3WTWA 5F2FA 4DN3H 3SY0A 1SHMA 1CBVH 3ET9F 2J1YA 4MVBD 4OUOA 3HPJB 5CD5D 1SDDA 2WQVA 4ELMF 3DXAB 1CR9L 1ZTXL 3WKPA 4YC2C 1TMNE 3QZLA 3QNXA 1ICTA 4WY7L 5MERB 5B7EA 4LOUC 1B9KA 4ZTOH 3OAUL 4M7KH 2FX7H 1DBKL 2BSBA 4OI8A 4Y5VC 4ZAKA 5C86A 4KTEL 4H40A 3MROA 4H1LB 2PWHA 2XXFA 1I1AA 4XMTA 3OHXA 2ZIDA 4JO3L 5E2JA 3MRRB 4N24A 3KLQA 2WNGA 4L29B 4DSYA 4U05A 1D5MB 3MJ7A 4YHIA 2ZWSA 3UIYA 5I71C 5EIIG 3PFQA 2XA8H 3D1MC 3HRPA 5IW1B 2JIXA 3RIFK 4DGWC 1I8KA 4FQ1H 5FCUH 2WKGA 2M83A 3EYOB 2XV6B 3FXIC 5JR1L 4F91B 3G6JB 2HT2D 3HE6B 1V5JA 3CU1A 1RJLB 1C5DA 5B38G 2FH6A 4NUGH 4QR7A 4N4EE 1JPFB 5E4AA 4YXLH 2NTSP 3FFCA 3QUKB 3VFRB 4LRNH 3W9EA 3EW3B 3LN5A 3IJEB 3SE4C 2DLFL 3VG9C 4OLUL 2VXTL 2EKSB 1H3XA 1E4XL 3FOLB 2MQCA 3O3UN 1DO6A 1MEXH 1UVQB 1SXNA 1XQ4A 2W80C 3F7YA 3SDYL 3ZRCC 4HX1A 4F8PA 2V2TB 5F89B 1UOWA 2XIBA 3QG6A 5TMNE 2BC4A 4AENA 2Y07L 3IVKA 1A3RH 1EPFA 1HHGB 3PJSB 2WJ5A 4JN2A 1KTCA 2DKSA 4WV1C 3GNMH 1BWMA 4P06A 3ZL4H 3VWKC 2KZBA 1N8OE 2BJMH 3IFPB 1Z3GH 2UX6A 3GMLA 3FO0L 1OTUC 2WTRB 2EDWA 3GMPA 1E6OH 1MCCA 5L7XL 2AK1L 2VABA 5AW1B 1WIUA 4GMTH 4NO5B 1YN6B 2X7LA 3VXUE 2VXSH 3AXLB 1BGXH 1DEEA 1I7ZB 3C60C 5DRNB 3KWTA 4PREB 5C07A 2OYPA 3I9PA 4RQQA 2I5YL 1F97A 1UA3A 3H9SB 4QPEA 3ARVA 1T6VN 4U6VH 3BP7A 3NAAH 2W8CA 3EO9H 2H3NB 3L1EA 4P5SA 4QOKD 4HGWA 2QQQA 1XR9B 2VZTA 3JWOL 3PGFH 4UT9A 5I1DB 1OF2A 3ARFB 4HDIB 2Z92A 2FJFA 2FH8A 2V37A 1PLCA 1OCOB 3L5WB 3KCPA 4UCFA 5JIMA 2O5ZL 5I74B 1IFRA 5I15L 1IAIL 1TTCA 5IROD 3VYNA 2X4RB 1ILSA 3B2XA 4YHOL 2RMNA 3WNLA 1EBPA 3LEVL 4LNRB 3NJFA 5EF2A 1HAUA 1MVUA 2X6VA 2BSCA 1S7SB 5H35A 4DWHA 5EU6B 2XQBH 4PMEA 4A6YH 3TEWA 1UOKA 1GY1A 1PJWA 2GFBA 4NN6B 2E75C 3SPIA 3MNMA 3KXFE 5AW6B 3EDFA 5HJGA 3B9KD 4J3TA 5DD6A 4AL8H 1R0AH 1YNTB 4FAAB 2CGRH 1WGOA 2D4FA 2X1QA 4PGDA 3BSZA 5DURD 3G9VA 4Y4HB 3W39B 2NPLX 4KAQH 3V6ZA 4UTAA 3T4AA 3WENA 4H8VA 1GA2A 1SXSA 1CS6A 4XP5H 4YHYB 1NOFA 5DFVC 5HYQA 1FH5H 2VSMB 2NYYC 2TRHA 2LOEA 2Z91A 2GJ6D 3GK8L 3MGAA 1BQ5A 4W4OA 2YPVH 4HXBH 5DJ2B 5DCCA 1E27A 1TQTA 5HJDA 5DJDA 4POZD 1QWUA 1KXVA 4M65A 3O6FB 1KELL 1KGJA 2VLKD 2F74A 1XL4A 4P2QD 3LIZH 1KTLB 1HIMH 1KN4H 2Z7ZA 3DRQB 1KFAL 1XGRB 1ROWA 1T0PB 3H2QA 3FQ2A 4EPSA 1SZNA 4F7EA 3KS0H 2TLXA 5DA0B 3TVMA 4A2HA 1J5OH 2NY5H 3HI5L 4XPHH 1R3JA 1JHTB 1KCRL 4NO2B 4YBHA 3QPQD 4LGSB 4W9KC 1R3LB 4LSTL 3US9A 5IVXF 3VUAA 1AXTH 2B1OA 4CU6A 4GAGL 4YE4H 1GS7A 3HS0A 4HWUA 4RNRA 1H5BA 2GYSA 3MUUA 3BIBX 4DFHA 4MYWB 2GEQA 5GGSY 2E5EA 1I1FA 4YSCA 3QRGL 3N55A 4JZNB 3SD5A 3HUJB 2W9EL 3QRBA 2B5IB 4HZLA 3TGXA 3UBXG 5C08E 3D87B 3OAWA 3S34H 2YN5A 4NN7B 4IU2B 3UG5A 5HYIA 1OB1B 1Q9OB 2PWDA 1T21A 1YVLA 3BPOC 3MJ8B 4HFWA 4EOWH 4F9PC 2DLIA 3MRFB 3GXFA 5LBGA 4JREB 2EADA 5D7LD 2X3BA 1ACCA 2P80A 4LLAA 4M9OA 4MXWH 4G6KH 1FDLH 3BW9A 3S96B 3IN0A 3OR7A 4KK9C 4UQBA 1H9VA 5CSZA 3BGFC 1BMWA 4P2OD 1E8YA 4YFEA 3NA4A 2HJKB 3PP4H 1BAGA 4CKVX 3I3BA 1QRKA 4LVNB 2ZAIA 1AGEB 4N2MA 1RULH 3SPJA 2VW4A 1M6OA 3S88L 5BO1H 5F0MB 2GJRA 3ULVC 5FM8A 5I1IL 1ZMYA 5E6YA 2HMID 3MGTA 4EVNB 3R0NA 2JI2A 5ICZA 3FF8A 2LHAA 2CDGB 2CLVB 5K59E 3ZTNL 3HMXL 5I1LB 3DX4A 4PV1C 4F7PA 4FHJA 3ESUF 1JZ5A 3A0OA 1T3FA 4FHKA 2B1AH 1KCSL 4WNSA 3U4BH 1N18A 3K6NA 5F88B 1NBYA 4Z6AT 4OJFH 3D50A 3NZHH 3ILQD 3HR5A 4N0UE 2QSQA 1CWVA 5HHOA 1LNDE 4DUWA 4Y1AB 3FCSB 2H6OA 4GI9A 4D9RD 2VR7A 3P11H 4K71C 4P57B 4EZJA 5EOCH 5E6IC 3CFMA 1FC1A 1P7KA 4WO4D 4HPOL 3D25B 2YAQA 3E1F1 3ZMNA 3DOHA 1BLNA 4CC4A 3EJTA 4XXCC 3GKWH 4F80A 4APQB 3EF7A 4HUXA 2AXFA 4JB9L 2R0LL 4KKQA 3WEXA 3B3IB 3HG0A 4NKMB 2GPZA 3DX6B 1UWFA 4ISVA 4FYRA 4QT5A 4NO0A 5HDBB 4L5FE 5DU7A 1DLFH 5FYKL 3BPCB 4OCMC 1V8HA 1YEKH 3WFHA 1OIOA 1E5CA 2JH2A 1T89A 1AYOA 4R83A 4LPVA 1N6UA 3UZEA 5BS0A 1NGPH 5CD3B 2DWSA 2CJUH 4M93B 5E94A 4KNQA 2VDQB 4M1CD 4YXKH 5B7FA 1UM5H 4GRWE 2YGVA 3B83A 3FQXA 4B9PA 4NPJA 1HX0A 1T6WA 2W9DL 3NCFB 4LCCC 4UT6L 2HKFH 4PJXA 1CIDA 5TD4A 3REVA 3IAGC 5L2KD 2V5YA 5LKNA 1HTYA 1R33A 1KBGH 1RP8A 2E7HA 4KMTL 2QMJA 4QXWA 4MA7L 3CBRA 4FQIH 3RAJL 3ASNB 4N2DA 5GGVH 5H37A 3F28A 5ANMA 3MPCA 3KPPB 4F33B 1KB5H 1LP9A 4KPHL 3U7WL 4ZX5A 1FAIH 3MFFA 1EWHA 3UADA 1DJYA 4P5MB 1M56B 1M9SA 4FLSA 1CFMA 1QF0A 3LVTA 4Z1PA 3T73A 4GG6E 1ZTMA 2XWBB 3HZ3A 4QRRE 4IK7A 5C0AA 2PPCA 1OCRB 4G8GB 4KZ0A 2E6PA 4WI9A 4PRIB 5A2IH 5D7JB 4DTGL 4RLDA 2J73A 1WPCA 1VKXA 2W65A 4P2RB 2JI1A 3I9GL 4X6CE 3DTXB 1ZRUA 2ALWA 2P3YA 3ARBC 4UBDC 2WIIA 2ZP9A 1T1WB 3QJQB 1UACL 4I0PC 1F4HA 4XVTL 2PCPB 4PJHF 5E9NA 4EJ1C 4DAGH 3HAEG 4PG2A 1IVLA 4NC1C 4R7LA 3VGAC 1A7RH 1O7SA 1KDJA 2R1WA 5IWLC 5LBSA 2ZX9A 4QWWC 5HI3D 1FGNL 3FQ4A 4GEJA 1WJ3A 1FC2D 3L2NA 3TZVA 3FU8A 4LOVA 4KKZA 4LFHD 4YDKH 2XN9A 4HGKC 4JGUA 3EJZD 1A6TB 2N3JA 1E4HA 3CIQA 3BRFA 3IF1A 3FTYA 1U42A 2IADA 2ICEC 2PWEA 2IO5A 3WJMB 3JV6A 2OZNA 4DETA 3QS3A 2FL5B 5FYJL 15C8L 1WZKA 1D5XA 1SEBB 3R19A 2Q86B 4BCXA 4ODVL 1J8HA 1YJDC 4WFEE 1UWGH 2COQA 1I7RA 3Q13A 1JAEA 3BHBA 3LOWA 2XTJC 1ES0A 5D7SL 1CFVL 1QFHA 1N4XL 2UY6B 4IBZA 4IOSD 1OTSD 2CQVA 2X2HA 3FYEB 4OTXH 1U33A 4UYPA 4I48B 5ADOL 1KIUB 4H8HA 4EKJA 1KIRA 3PV6A 2VQUA 3RE0A 4N1HB 5JOPD 4Z7UA 4JQIL 3IMUA 3P9MB 3ZSSA 2VDQH 4Z7AA 1HWGB 3S3PA 4WEUD 4MDJB 1FYTE 2CMRH 2FR4B 5DMGD 2CIIB 2LU3A 1KLGA 2ZZUT 3L3HA 1X9UA 4MAZA 1D5ZA 4FNUA 3KPTA 1XGUB 1ZKAA 3ZE0E 1PS3A 1ZJBA 3RY5A 5J57B 5IK3A 3O11B 5FUZL 5EF3A 3BZ4B 4NZTL 3DTUB 2CHXA 3L3GB 1J9SA 4V33A 4PJ8C 3DSFH 1HH9B 4Y9GA 2E7BA 4TOYL 3DIVA 3CVHB 1S9VA 1I8IA 5CJOL 4WJ5B 5C0BD 4ES9A 1F2XK 4GKSA 2R29H 3B2DC 3FN0L 3VQ1C 1CFTB 5GZND 4RGNC 2E9IA 1LNCE 2VLRD 3BUTA 4ZW7A 1WF5A 2I07A 3OSVA 4Y2NA 3WL9A 5KSUB 1IE4A 4XP9H 3FU5A 3CAFA 1C5BL 4MJIA 4Z7OE 2FSEB 3P4OB 1UD8A 3D69B 1UATA 1ADQH 4JG0H 1IBFA 2QVTA 3IWVA 3UXFA 4LEOA 3A5VA 5CD5C 5DK2B 2X4PB 5ERWB 4PRNB 5AKTA 1IM9A 3U9WA 1M57B 4OT1H 4KRPB 1OD7A 5KYUB 3OAYK 5ID0A 5JPNC 1JSYA 4R9HA 1PD0A 4FTDA 3FT4B 1YA5A 2ENJA 2YXMA 4HWZB 4L05A 2R4SH 4ODWB 5E2TH 3VG0L 2RA1A 4BELD 1G7PB 2Y7NA 2QBWA 2OMYA 3P40A 1SM3H 2XV2A 1WD8A 5FHBH 3GBML 3IWUA 4LLWB 4LCYB 1MG2C 2YK1L 2ESVA 2J44A 4LHUA 4P46C 3RU8H 3IDYC 4K0OA 3REWB 3OKOA 3DYMA 3E3QE 5J9PB 5HDQH 3M1CA 4GAJH 2R0KL 2C34A 3NACH 5IHZA 2WGNB 1QFWL 5DJ0B 2Z31D 2FWSA 5T1JA 3AM8A 1CD9B 5I66A 1RXLA 4PVLA 4AYID 3IU3B 5AAWA 2HT2C 4NNXA 3H7BA 3NEOA 4L5FH 4IBUA 4YSRA 4FHBD 2J57A 3H6JA 4NM4L 4UTBH 4P2CG 5DD0L 1I3GH 3DX9A 3ULVE 4HF5L 4FQJH 1IO4C 3GYRA 3IPBA 4A6YA 3LKPA 3LY6A 5D1XB 1XF5B 4URTB 1SUJA 3CXHJ 1KMGA 3P3SA 1YEEH 4DP7X 4UV4L 4GRWH 1DANT 4OZFA 1ZEAH 4W68A 5D4HA 2JJUA 4GLRI 4CAGA 1VEPA 2MJWA 4HKXA 1UWXH 3VXQB 3N9GL 4ABWA 2AV7A 4NQDA 4JFFA 4IMKC 4B96A 1E9OA 2QPEB 3CVHH 5I0YA 4GJTB 2ADJB 2F54B 1N7MH 2ZOLB 1D5IL 3SJVE 3VDAA 5IMOB 2X87A 5CN1A 3U25A 1U2YA 3QUZB 2CHWA 1YMMA 4R5TA 2VQ1A 3DK0A 2ZP0T 4Q52A 1PAMA 1FCCA 2H41A 3BH9B 4M7JH 2X4OA 4PW4A 1MRDH 3WUZA 4H88L 3OKMA 5GGRA 4H13C 1PKQA 1JRHL 1TQVA 4C55A 3OAZK 1FG2B 5L41E 4MAYB 3BKMH 3QDGB 3R7QA 3TCTA 3VXRD 2TRYA 5F0PB 2FZ3A 2G4EA 4M7LL 2FAUA 5CJBA 3RLSA 3BAEH 3RIAK 5LGYA 1GPOH 2HG0A 3LIZA 1RHHB 3QFJA 4ODTH 4PLJC 2VDML 3NGBB 1HZKA 1IMHC 3GSQB 5F1SA 4EZKA 3P77A 4X0KA 4N9GA 4ANKA 5CEZL 1O9WA 5JOFA 3GMOA 2XZQH 3PWPB 4QGYA 4N2HA 1LO5A 3W0WA 1F02I 1TT6A 2LAAA 4LLUA 1NA8A 1ECYA 3VFVB 4OI5E 3VGHA 4JO4L 5IJVB 5JIDA 5EUOE 1CL7L 1IC1A 4DCQB 1SOKA 1NJ9B 1BA9A 1N6QL 3MU3A 5MHSE 1PZBA 2N1KA 2B2XL 4HIEB 4GAYB 1JTOA 2G3ZA 1RK0B 3H54A 1HHHA 3DX7B 1XF1A 2EXTA 3RWJA 4OF8A 5F8QC 4UB0L 3UTZA 1B0GA 4RMVA 2VM4A 4LP8A 4Z3JA 4E5XG 3SGDI 1KPUB 3F5WA 4YX2L 2HX7A 3LZPA 4NO3A 3WSQH 1A4BA 5C0IB 4OCRH 1MI5A 1Z9NA 3NFSH 2HRLA 1MCQA 2AAAA 4H8WC 1EXHA 1GTFA 3IXTB 3MLRL 5G5DB 4R2GD 4QKTA 2R15A 3JV0A 3E1ZA 3MRNA 4PS4H 4UNIA 4BFIB 4GXVH 4NOFA 1AQ8A 3K8KA 4LSRL 1A1MA 5TE7L 4BZ2L 4ZUWB 4BV1A 1SVZA 4ZS7H 5B1KA 4LPTA 3LB6D 5IEHB 4Z7QB 1Q0XL 3OBAA 5FXNA 1OSPL 2ZPKH 4UYQA 1H15B 1KBPA 4BJLA 2YXVA 1XGZA 1MCOH 1YEIH 4LL9A 5FKPB 3RVVD 3ARDD 4Q9RL 3MYZA 4NJAL 4ORGB 4AYGA 2APBA 4MNQD 2K7QA 1P6FA 3O4LE 4OLZL 4PY7A 1T0NB 4N2KA 3FFDA 2HUHA 3QPQC 1SLXA 1T03H 4HMDA 3VFUB 4PJ9A 4ZW8A 4JQXA 2MNJB 1SOSA 1MJUL 1P6AB 3FB6B 1FZJA 4FXGA 4ZODA 4ADIA 1ZLUK 3MRMB 2QLYA 2FLMA 4ILDA 4HD9A 4Q6IB 4ANVA 4JPKH 5HDOA 3LHPL 1AS8A 3T74A 4HHWA 1XF4B 4GMSH 2AJUH 4AM0B 2EE9A 3CCHA 1G1OA 5DFAA 3FTSA 4J8RB 1GGCL 3BAXA 2JK5A 5FKAB 5B21A 3WGVB 3PUCA 2J8UE 4ELME 1D9KA 2HCZX 3E0GA 1U95A 1NTDA 2CUHA 2DH3A 3WIFA 4OLYH 3ZL2A 2R23B 2EECA 4G5ZL 2BNRB 2VZUA 4WZ9A 3EOTL 3SOBH 1A3ZA 4AQ8A 2XG4B 5DJ8B 1UYWL 5BJTA 3PHQA 1PYWB 2HLFC 1KYOJ 1JGVL 1A6VL 1GHFH 3QA3A 4S2SA 4G1MA 4NFDA 4NPYA 3V4LA 3WE6A 4G80B 4AYDC 2HFEA 2GITA 5GS0L 3ES6B 4KMQA 4JFEB 4W70A 1AYRA 1P2CA 1JK9B 1FORL 2VH5L 4OAWA 5CP3H 1EAOA 5DJXB 3IN2A 4DP5X 2HMIC 4JJ5B 3QDMB 1QF1A 3VXUA 4N22A 2Y6SC 2NYKA 1MSPA 3MJGX 1RZKH 4J7RA 4CVZB 2HFFA 5E8OB 3UPCA 1YYLH 4AYMC 3MBXH 3D85D 1AO7B 4JKWA 1DQML 4OZ4A 5EDXA 4AIZA 1A6ZB 1SJXA 1NDTA 4PJ7F 3AACA 3FAWA 3LQMA 3Q6FB 1KB5A 3RYMA 4F57H 4H2AA 3HHSA 4NYLB 3C8KA 2PLTA 1ACYL 2YLKA 4ZSOB 2OSLA 3HE7B 1I1YA 4HKBB 4MCNA 3H0TA 1AOZA 5CLTA 3WBDA 1E9PA 3SYPA 1IGFH 5LXGH 2FJHB 1QFPA 3QDAA 2N01B 1D5RA 3RVXD 3U2JA 3CN2A 1RHFA 3LMJL 5CFHA 2ZCLL 1A0QL 1K2DA 2ALAA 3AGWA 4IGBB 1CICB 1A14L 3L5XL 4HFUH 3KXFA 5DJYB 1T5XA 3TBSA 1BQUA 4Y1TA 5EIIB 1OT1A 3DIDA 3LQZB 3EDDA 2AEPL 1YECL 1L5GB 4N85A 1DUZB 3ARYA 4R0LA 5I19L 2ZSWA 4MCYA 3LEYL 4ATTA 5L2JB 3PAZA 5J7CC 4PJEE 5B38B 4UILL 3FMGL 4GRLC 2EYRB 3HMWL 1SY6H 3LN4A 3UIZA 5EEYA 2DQEH 2WOBA 3VXME 2XIIA 5J1AA 4GXFA 5EBMA 4NRYB 4I9WE 4S0SD 2IBBA 1M71B 1S9YB 1A6AB 5T1DH 4H8PA 5I8CA 4K5OA 5C0CE 4TSCL 3T2QA 2CA4A 3RA7L 2A74A 2G5UA 5I75C 1PSKL 1MCWM 1OCZB 3AREA 1NBZB 3VXSD 5DD3L 1OAQH 2BOBB 5EBWA 4YHPB 1AI1H 1U0QA 3VXNB 4UIKH 5FYLL 3Q06A 2PYEE 1SQMA 4OZIE 3GIVA 1O6SA 3HS9A 5F7YC 4ZMVA 1K8IB 3QIBC 3W11D 3TA3C 1E43A 1FFTB 4PIBA 2WK2A 4ZD3L 1T1XA 3BKJH 4LKXA 3P3YA 2ZONA 4A66A 4G9FE 1CFSB 4UQIM 3KWVA 3KWXA 3ULUE 2VZOA 4P3WA 3SGEH 1RI8A 4DK3A 1MH5A 2IXQA 4I3SL 3LNFA 4Q4IA 4N2EA 5C0EB 4QY8B 1WV7T 3QDJE 4IMLA 2CO6A 3IT8D 3NJVA 1P53A 5C08A 1U2CA 4OCLC 5CILL 4XOBA 1AQDA 2IVFC 4Q4EA 2ARJA 3WIIH 4WEBH 1FO0B 4EI0A 1AZNA 35C8L 3B7UX 3SE8H 3FT9A 1M2OA 4I89A 3RTQA 1LK2B 1K4CA 1KCLA 4QRUB 2FQGA 5DRZA 2E8YA 3DUUA 1QTPA 3EAKA 3MTXA 2R29A 4JY4A 4OKVA 4E9VA 4HX1B 3UMTA 2NXYD 3NPSC 3RWHA 4DKEL 2HTKC 5MP6H 4AEEA 5KBMA 9CGTA 3TBCA 2XWTA 4FEMA 2QADD 3X1NA 2Z0UA 3IFLL 1IM3D 3IRZA 2A6IB 4XNZB 1OTSC 4M8RA 4MD4B 3WKNA 2P48B 2DQCH 5E5LA 4C54A 1JI1A 2P8PB 1ADQA 4E9WA 4XP4H 4R97B 3WNKA 4QNPF 3LD8C 5CCKH 2YQ2A 3EGDA 3SDAC 4XMLH 2WLIB 3ZKNC 4KX9A 2Y69B 1S9WB 1LEGB 3RFZB 5E2VL 1XF3A 3LS5H 3QCVL 3BPLC 4HS6A 4P3DB 3T6VA 4KJPD 1CLZH 2ENPA 1ZA6B 3MLUH 2GAZA 3P0YH 4P9HC 4Y16D 3HA0A 4N0UA 3PF2A 1IC4L 3J7HA 3QUXA 2X4NB 4WKXA 4OFVA 4QHNA 2XPZA 3UOAB 1J9RA 4XNUH 2YPLB 5DD5L 1CZ8H 5LAPA 3O2DH 1BD2B 3CJJA 1DQJB 2XY2A 3QUMB 1G1YA 1YAZA 4XNYH 4QXTA 4XO5A 4HS3B 4OFYA 1OGAE 3DDFA 4XPAH 5D2LB 5HYFA 4JAMB 2VLKE 4U1LA 3BN9D 2PCXA 4PBDA 4PJAF 1BFVH 4KXZI 2WTPA 3P4LA 2K8QA 4Y5VA 5TGBA 8CGTA 2R2EB 2G2NA 5A3IC 4JO2H 1BQHA 1JGLH 5A2JH 4UTBA 3EXJA 3DBKA 1QW9A 1U91A 5MI0B 2HKHL 1J9QA 4GW5B 3LN9A 3CIAA 1LO3H 2FX9H 2R7EA 3QIWD 3FO9B 4I3RL 1P5UB 4G8FB 2E7LC 4OW3A 4Y19E 1DSFH 3MV8E 3AMKA 5JMOC 1ESPA 3KPSE 1QHPA 2Y1VA 3RDTB 3V9FA 1H3PH 3EYSL 2QSTA 4U7SA 3U7YH 4JLRA 4GERA 4Y4FA 4FQHB 3ZE2F 2GUYA 4W9EC 5EOQL 3HZVB 4YQXH 1M05B 4BYHA 5LIFE 2IGLA 4YSAA 3L16A 3MRDA 3SE4A 1U3JA 1Y18A 4LE8A 4F9LC 1A3LL 4JRXD 4IRSB 4GG6A 3P4MA 4U7MA 3RPBA 4QRRA 2BIHA 1GYAA 3P9WB 5K9KB 5KJRH 5IHUH 2D0HA 5GS3A 2NY0D 4N68A 1MFDL 3GKZA 7TAAA 4WW2C 4YJZL 3ULAB 3DYPA 4HISA 4MD0A 4X6CA 4AVHA 5E7FA 5TF1L 4OF7A 2ZICA 4WV1A 3VWKA 4UUJA 3SQRA 5D5MB 3TV8A 1SPDA 1JZIA 2WKLA 3S8GB 3EBGA 3GXIA 3IJYA 3C60A 2CXKA 4FKHA 2Y5TB 4FI8A 3ZIYA 2QQLL 3KGSA 4JPIA 4E42A 1YQVL 3P1VA 4KI1A 3MLTA 2Q9OA 3T2LA 2WZAA 2D8KA 4AGMA 2WM0A 1KT2B 5FFOA 5AVSB 4ZXBB 4CGUB 2R2BB 3MCKA 3ZKQD 3CN1A 2IAMC 1O5PA 5ES4B 3QNZB 5DUPL 1PIGA 1HL5A 2VB5A 4FXKB 3C09C 1A4KB 4L3CB 2QL1A 1OO2A 1F86A 3HZKB 1YPZE 1HWHB 1BYPA 1U8OB 3MBEC 4L4VB 3LZRA 1P1ZA 1PZ2A 3GMQB 1KS7A 4HUCA 3MNDA 1WBYA 4K7PL 2IC2A 3I6GA 1IGMH 4PRBA 3GSOA 1JCKA 3MVSA 4I88A 4OV6F 1GCFA 1U6AL 1KYDA 1RY7B 2OFQA 3APNA 4OH2A 4RMRA 2W0FA 4HD5A 1HQ4A 1FO0L 2NXZC 2XDHA 2DF3A 2OULB 2ATAA 1MIEL 3ULUH 2SEBA 3C5JB 5EO0B 4P9MH 1SHSA 1FYTA 3DSNA 1IQDB 1Q72L 2DI8A 4NUMA 1AR1B 1X7SA 5TTRA 4TQIA 3A24A 4BZ1L 3MYJB 3SE3C 3V79C 2I9LB 5GZOD 5F6HI 4OF6A 2D7TL 4XPBL 5JIHA 2DKMA 4U1HB 2AJZB 3HKZA 2NW2A 1MFCL 5F3HA 5A6IA 1L9TA 4ZBJA 4XVJH 4MA8L 1OAXH 4N0YL 4XCCL 1OZUA 1F42A 3D4CA 1YY8A 2KLTA 4RGMB 1K6QL 1U3HB 2CLRA 1FIGL 4EZLA 2DTML 3K3QA 3APCA 3FUEA 3IS1X 4JFQB 4Z3HA 1KJ3L 4O5LH 4PV9B 3PY9A 3VJ6B 5I5RA 2VQ4A 4OD3L 3NZ8B 4EIUA 1NCOA 1FJQA 4EIZC 3H6AA 2VXUH 3VFPB 3K71A 3GRWA 3HAEB 4KDTC 3FSZA 3CFIC 1FFRA 3ZXAC 1NAMB 2VAAB 1NIAA 1HHJB 2C9AA 4XMWA 2OSXA 2G0LA 2NQ3A 4PB9H 1XX9C 4R2GC 5TLIA 1GKEA 3FT0A 3U36B 3QQNA 1EHLH 1ZANH 3GMRB 3QUML 5ETUA 1D5BB 4XPFH 1F18A 1XSKA 4LSDA 2B0SH 4PSPA 4APXA 4QTFA 2AI0H 1ANUA 3LB6C 2VT0A 3DHUA 5IB3B 5CP3A 1S8DB 4AMKH 1GZPB 4R3SA 3LKOB 3BSZL 4ODXA 4V1DD 1VGKB 2EIDA 2X70B 4NQEB 1XBDA 3ARDC 5LB1A 4KZCA 4H8WH 4R4BA 4F20A 4EXKA 5INCA 4LP4A 2C3HA 1EVUA 3UC0H 2HT3C 5EU4A 1EAPA 2IBZX 1RUMH 1G1KA 1TYEB 4JVWA 4JRYB 1L9NA 2B20A 3K6OA 4JDZB 2P4AB 3K4DA 3UBHA 3WO4B 5DDHA 3AQZA 3D09A 3WXWL 1HZHH 4HP5A 3Q5OA 3O41B 1GW6A 2ICES 1AC0A 4PCKA 3G04A 3M1BA 3CHSA 5CZKA 2H8PA 3UL4A 3F85A 1M9WA 3GLEA 2ED8A 1TTUA 5JDSA 1JZJA 4OIIH 2ADYA 2WSPA 1OXYA 4JZJC 2PF6A 1HSAA 2X4TA 3CK0H 3QARA 1BQKA 1CLYL 1KN2L 3N6YA 1N0XL 4K3DH 4MJJA 3S48A 3KPRB 4O2EB 5I1JH 5JQ6H 4P4KD 1U58B 4RWYH 4PJBE 5EWIH 1BBJA 1S6NA 2BSEA 4X98A 3QWRD 4Q0XH 2GK0A 2DN7A 3QG7H 3QI9C 3LPWA 1FBIH 3SJVA 1KCUL 4JFHE 2ODIA 3UAJC 1A5FL 2A6DB 3QEUA 4JFSA 2HA1A 1QRNB 1SY6A 3QQ4A 3IU4H 2AK4E 2WMPA 3V0VA 4NIYE 3V0HA 1FV1B 1XIWD 3QT2A 4XXCA 3Q7JA 1RCYA 4GH7B 2BRRL 3HAEH 4GP4B 1JWUA 3B8YA 3GGWA 4PJGF 1RVFL 5T3ZL 4TV3A 3K2UL 3ZYOA 4E0RA 3T8MA 1SYVB 4MBOA 3TFBA 1XCTA 4JCLA 1EHXA 2F53B 2H6PB 3GO1H 1DBAH 3LKRA 2APTA 2ZOKA 5FDYA 5L4IA 4Z0XB 1P4LB 4PP2A 5BQ7B 3IB4A 2WV3A 2ZSVB 3MFGB 1L7TL 5DRWA 3SD2A 5KSBE 5KZCD 3NUKA 1THLA 2Y24A 1I1RA 1E50A 1NGXA 1F6AB 2EXYD 3QWNA 4NRZA 2X88A 4H20H 4PJDB 1ID5I 1UWXK 4LPCA 4CBPA 4DKTA 3NPZB 1UT9A 5EUOA 2EVIA 3BKYL 3L5JA 4HPYL 2GW5A 4MB1A 3U0TA 5AVUB 4JY6A 3ELQA 3G5VA 3EADA 3UPRB 2PABA 1RMFH 1H9DA 5ILTH 4OCNC 1UOVA 4JGMA 4JFVA 2CHZA 4N2IA 4XZUA 3AGVA 1JD9A 4PN6A 4G5AA 4FERA 4Z7VB 1GCYA 4AXWA 2YBGA 4FTVB 3HTLX 1SDAB 4ZG1A 2C9RA 1IT9L 4FZ8H 3EXLA 1DQQB 2Y7QB 3EOBB 1MCPH 4HAFA 4HJTA 3RBGA 3CMOL 1T5WB 3FUNA 1HWWA 2OXGA 4OV5A 4OZGF 5E9DD 1E90A 1E9QA 3B1TA 4DGYL 2P5WB 2OMTB 4R4FH 4WK4B 1UH3A 3ARBA 4GOSA 4OZHB 3PE9A 1YN7A 4HUKB 3WUWG 1VADA 3FAXA 2OL3H 5FYKU 5IG7B 1OQOA 3CTTA 5IWLA 1K5NB 1INEL 3BP5A 1PG7W 3BEVB 3IJ9A 1QVOA 3EYVA 3P2BA 4A63A 5HYSB 4PWEA 1HINH 4G11A 3KM2A 3X3FL 5BVPL 2ICEA 1MJ8L 3HFML 1ITCA 5DJZA 3D9AL 3M8OL 3O4LA 4CC0A 3NSCA 3S7GA 3ZVVA 4JY5H 4F15B 1VZGA 3CX5J 5FHAL 4B5EA 1HSBB 1NAML 1RZQA 3MMEB 2ZCHH 4LHJB 3CSBA 4M6OL 2CCWA 5EEUA 3CZFA 4K5LA 1LXMA 2OR8A 5HPOA 3MLZH 1P0SE 3KYMA 5FYJD 3D34A 4D9QE 1VGEL 1SOQA 2VXVL 1U2HA 4WRLA 3LV3B 2G2PA 4QHLB 2OX5A 3D4ZA 3HC3L 4O9HH 5I1GH 3HHMA 1KZQA 1NFDF 2ZNXA 3IXAB 3O2DA 1A1NA 4WFFD 4Z7NF 4ZFOA 3LDBB 4HALA 1IBDA 3FTGA 2J8UA 5E4IA 2VGLM 4ELMA 4QRPD 1QA9A 1AJ7H 2E59A 2PTVA 4N6RA 1P7BA 3AG3B 4YDJB 4CJ1A 2A9NL 4HBCH 4WIQA 2NXYC 5C2BL 1FZKA 1MNUH 1URLA 4KZDL 3RY4A 1E30A 1XGTA 3KDMA 4S1SL 2YC1A 3KPQA 2BY0A 1WA1X 4MHHI 4FZEH 3PL6C 5F8RC 1YHPA 2QADC 3L3JA 3MV9D 3SCMD 3TBBA 2WJ7A 1FNLA 3L3DA 4JGJA 1AIFB 3FO2B 1E4WH 3UAAA 2F15A 3WNIA 4PJ8A 5FSJA 4BD4A 3PWUB 2FECL 1LILA 2YKLL 3I9AA 4Y2DB 3UO1L 3V5HA 1WFJA 2M2DA 2LTQB 1WCBA 5LBSL 1CYGA 1ULVA 3LH9A 2L8AA 3RL2A 2Z7YA 3QNYA 3RX5A 4IHBA 3H9ZA 4A2GA 1NPJA 1KTRL 2ZKXA 4BHUA 4AGOA 1ITBB 5FYJU 1HJCA 5DRXB 5IW3A 1BV8A 4ZPTB 4K8RC 3WIHH 3KLSA 4H57A 3I74A 3PWVA 4WHTA 2Q7YB 1FAKT 1GOGA 2BS71 3GUFA 2C9VA 3MRKB 3QIUB 3S36H 4ERSH 1JWSA 5KUMA 1IEAB 5IP4A 1LQBC 1FNGB 2BVOA 2K6YA 1SN0A 3U1PA 3MRPB 3K5SA 4G43A 4QAWA 3M6DA 4OJCA 4X4XB 3RQ3A 4FF9A 2CG9X 3O6MH 2WAHA 2ILLA 3OKYA 3BAWA 2WPGA 4KKLD 4MMZC 4TKWA 5CIPB 3P3UA 3RWEA 3L7FB 4HIIB 2GJJA 4P9HH 4HWEH 2GBUA 2Z1PA 1E4KC 5FOBA 4FYTA 2IV9A 4IKJA 5CU9A 1JNHB 3OC8A 3ZDXE 1ACZA 5I18H 3SDCC 4KXCA 4PJEA 5DWPA 2PPDA 4MNQE 1QR1B 4XVOA 2F18A 3VXMA 2BINA 4P46A 4XNQB 5DD1H 3BWAB 3KYNA 3FHEA 4NKOA 4G6JH 5F9WB 2Y23A 2KQMA 3RPIB 4JDTL 3SDDB 4RESB 2JMRA 4XBGA 5C0CA 1DLHA 2R2CA 1XB6A 2Y3AA 2ZWKA 4GBXD 1WS8A 2JKSA 3KL0A 5GS2D 3CGTA 4D0DA 2OMXA 3WGUB 2V5RA 1MHPH 2WNWA 4P23A 4LBEB 5FM5O 2P8LA 5MEQA 3ZZSA 2QSCH 1WS7A 3BI9X 3BO8B 3N1PC 1CVRA 3WN5B 2PYEA 4PTUB 5FO8A 4OZIA 4UNTA 1AGFB 5I17A 3VXTA 3TV3H 3PWJA 3V0IA 3Q5YA 2A1WL 3QHZL 1ZOXA 1G4RA 3Q0HA 3K6FA 1QKZL 2UYLA 3UBXA 1NGWB 5D7IF 2K4WA 3F7QA 3FQTA 1HEHC 3SOTA 4TXVB 1I3RB 2NY0C 5KVFE 2DLGA 4G9FA 1GXWA 4IMKA 5JPMB 2ZKHL 1DBBH 2J6EA 3B7RL 1GKOA 3FT1A 4HV8A 1GAFL 4ANWA 4MDIB 1N3NB 1Q90A 3SKNA 1QZ1A 2Y36H 4EUPB 4MZRA 2Y1AA 2F1BA 3QDJA 2Y3NA 5KUKA 3ECUA 2E7CA 1OP4A 2ICWA 3TN0B 3D39E 3E8VA 4TM9A 1UM6L 3MLVL 3ME0A 4NQSB 1XTLA 4LVOB 4X6DE 3QZNA 1U8NA 3C6LB 2R0WL 5IMKA 2GJZB 5EFIB 5IQMA 4OGZA 2EDTA 2VXSL 1IGTB 3ZJAA 1ZD6A 1ZLDA 4PGEB 5D4IA 5EEXA 3FUKA 1R24A 3FGDA 2QFRA 4XMVA 1O9VA 4QXVA 3TFKD 1PFOA 3NAAL 2EIZB 3OKEB 2WWMD 2JTDA 2Z8SA 4BSVB 4MJHA 4Y2LA 4NKDA 3ZN6A 2ZJSH 1W6WA 1KJOA 1JXKA 3QUGA 4M7ZC 5C9KA 1OAYL 5AG8A 5JHAA 2X6MA 2WUCH 3VE0A 2FUTA 1JZ6A 3G5ZA 3EOAA 4YWGH 3MUZ1 3EHBB 1ET5A 4KH9A 5B4MD 4MX7B 1W72B 1CXHA 5E1IA 3T2IE 2GBVA 2GTZA 1KG0A 3QJFB 1QO3A 5ABDE 5C0DB 5B8CB 4XH2B 2XKUA 3X11B 1QAWA 4A2DA 5GRUL 5I9QC 1VCAA 4AEFA 3RGHA 4BCZA 2UZXB 1ETZA 2BHUA 4EDWL 5GZOC 5D1ZD 5LNEA 1X7QB 3I6KB 1MPAH 4X5WB 3QEQB 4D7PA 4GPVA 5DSCA 4HUWA 4PUBH 1G84A 4XHJD 2KL6A 4UQ2A 1DYZA 2NZ9C 3CDYA 3D08A 3KXFB 1OGAA 2EH7H 3V6FA 1ONQA 3ZRFC 4M43L 3OKDB 4K15A 4TUOB 2VLKA 1YY9D 3TJHD 5FUCC 2CA3A 3O3BA 1C16A 4A38A 2CR3A 5HQDA 1JGIA 4DQOL 3CDFA 4N0CC 4JO5A 1NCAL 1NDMB 1BZ9B 3HI6H 4KHTH 4K2UL 3PHAA 2XTLA 4DESA 5CN2A 4OB5L 5DPEE 5CJXC 4NUPA 1Q0EA 3L3OC 1CO1A 3Q2LA 3MV7E 4WFGE 4OLWL 3BQUD 5AZ2L 1UC6A 3ML8A 4AM0Q 4YUEL 3HRZC 4Y19A 1SYSA 3MV8A 3KPSA 1BXUA 4RZCB 3FQNB 3V0AC 4NLAA 5IOPB 1P5VA 5ICUA 4LMQI 4FFYL 3RPKA 5IT2L 1IE5A 2V7HB 1A25A 2DQFB 1OGPA 3CQQA 2YGOA 3AREB 2DB8A 3D0AA 1XCWA 5F7DB 2TMNE 5GRJL 1W0YT 2VR8A 5D1QB 1U8MA 3Q2NA 1B88A 1MVYA 5CZVL 4MSWA 4X9HA 1AGDA 1HE8A 3GD1C 3BDBA 4DPAX 1DVFC 1FJUA 3CVDA 1DANU 2QKIA 1OPOA 1R5IA 4IRJC 4FQCH 2XVKA 3MGOA 5FO7A 1MREL 4R4ND 2C26A 2CKNA 3KPLB 1DVUA 3O2VH 4D8OA 3A22A 1SBSH 3V4VB 2HPTA 2FD6L 5EIQA 1FDLL 1JV5B 4Y5XB 2XPGA 2YAEA 3T65B 2DMKA 4XVSH 1DJHA 2XT1B 4JE0A 4NEHB 3KPNB 3OQ3B 1RZGA 3PREA 1OLLA 1Q9LB 4NHCH 2R9HC 1CDIA 1NKGA 4YBLC 3QXVA 1GYUA 2VDLB 3VRIA 1Y7VA 3PHOB 4KK8C 1HQRA 5AL0A 1NCUA 2D7NA 3CZJA 3DOSA 2AQTA 5BV7B 2YD4A 5DEGB 5FO2A 5F71A 3WV0A 1RIUL 4GY4A 1TQCB 4AGQA 1A9EB 2HWZL 4MD5B 5CJ5A 2B15A 2EP6A 4N2AA 2VWEC 2X2JA 4FADA 1C12B 1MRFH 2HVJA 2WUBH 1QEWA 1R5WB 2RQEA 1CDJA 4M6NH 5AOZA 2Y06H 1YPZA 1A2YA 3HNSH 3NIGB 4UU9A 3BZDA 1MAJA 2WVUA 5MEOB 1DEDA 4QXUL 4RIRB 4X0NA 3EFDH 5I1EL 1XIWC 5DFTA 2WCGA 1E42A 1HOCB 5IKCA 1NC4A 1IKFH 1B4TA 2JJWA 5AVZB 4EZMA 2JQZA 3MNZA 1RZ7H 1JHKH 3VSUA 4F8OA 3H2WA 4BRJA 3N1QC 5KVFH 1VFAB 4LDCA 4I77L 4YFDB 1PE5A 4HC1A 5EZLA 5C2UB 4JM2D 3VD2A 2OL3A 3QZBA 3DHMA 2PETA 3CVIH 4M1GH 4BFKA 1XMWA 4WHYG 4FMFA 4JQVC 3KH3A 3AB0B 1QBLL 4GRLA 2MSPA 2WXRA 4KK6C 5JXAH 4TQEH 4HLZG 1P7QA 2ITDB 4UQ9A 5HVHB 4Q97A 4PBXA 4HMEA 1WZMA 3VWJC 1T1YA 4L37B 4DHLA 5DS8B 5BRZB 4RISH 3EYFB 4YPGB 2QTEA 2E9GA 2VLJE 2NY3B 3KR3H 1OALA 2CDFB 4DP0X 4C56D 2IOMA 1CN4A 1HHIA 1OQXA 2X89D 1J8SA 1JZ2A 1TCRB 2VR4A 2H5UA 4NCDA 3S98A 3ZKSD 3KHOA 1LE9B 5GHWL 1TOXA 2AEIT 1J5IA 3QIBA 4A37A 3TA3A 1KY7A 2H1XA 3LRGA 4U0RB 1KB5L 4JM4L 1FAIL 5C6TH 4R6UA 3FU6A 5MENB 3RIFF 1Q9KB 2XZCL 4FQXC 1F3DH 3TYGH 1NSNH 3WLBB 4C58B 4YSOA 1Q9WB 3RFRA 3MXWL 4R7NA 1GC1L 2BO0A 3ABLB 3PWLA 1UQSB 4BIKA 1U8HA 2A83A 4JM2F 1GGIH 3BT2L 3HZYA 2HYMA 5J6HB 1T7YA 4JPVL 3IETA 3NEXA 2DQUH 5IFAH 5IMMA 4BKSC 3F04A 4DW2H 1AGCA 4EQ3A 5E4OA 1XD1A 5DEJA 3NABL 5IVZB 1G9ML 1KGCD 1A7RL 4IHOB 2XG5B 4ZMQA 2P7TB 2NT1A 1C1EH 4L3ED 2VW6A 3BYTA 3QULB 2V9TA 2ITCA 4W9CC 4WUUB 3VI4F 2GTWA 3BD3A 2R56L 5L8PE 3WIHA 3QDHA 4ZW6A 2JTYA 1BAFH 4XN9A 2V9RA 4KNTA 3QQXA 3RNQA 4ZUSA 4PCYA 1P84K 3K0YA 4YFLF 4JFOA 2DQTL 1MCBA 4MA1C 5SX5K 3VFTA 2HLEB 4IOFC 1KF9B 2EIBA 3IKCB 2WP3T 4JS7A 4E9XA 5DJ6B 5EULV 5GIRB 1FJWA 3UTPD 3PGDB 3N85L 4W1TA 4XP6L 4XB8A 3SDAA 3OLGA 4DEWA 4JK0D 2IPTH 4L4TD 4UINL 4R84A 4LCWB 1ZLSL 3K2MC 1PW3A 3QRLA 1MW3A 4YO0B 4QLRA 3BWUC 4JFXA 5HYJB 3AU0A 3GM0A 1RURL 5CEYA 1S5HA 2GIYA 1O9ZA 3NN7A 2AFNA 4QRSB 4PJBA 1QATA 3AXIA 5A1AA 3N41F 4S1QL 4PJIF 3CHXA 4P59L 3RB5A 1HU8A 1YUHB 4NKIH 5IREA 3ERXA 3V4VL 1U8PB 4EI5B 2H26B 3A21A 3AG1B 2AK4A 3QE5A 1V7NH 2AQPA 2O72A 1NMAH 4F58L 5IB4A 5LN4A 4HEPA 2XWRA 4Q58C 2G9HA 5D6CA 4J2QA 4WWPA 1X5JA 1QACA 2LV4A 2EC9T 4X83A 5FUCE 2VDLL 5JHDD 2PWFA 4YSTA 4CSTA 3DVNB 5KSAC 5BV7L 4XGZB 1A4AA 2VISA 4GEIA 4KROC 4M4PA 1I9JH 2COVD 2PW2B 1DVSA 4FOMA 1N5YH 3ROOA 1NGZB 1UXSB 1EANA 2H0EA 3WLWD 1D7FA 5KSBA 4AQAA 1GJIA 5HGAA 3OG6B 5C09D 4E5XA 4TVPL 3ZZQA 3U7AA 4JVPA 1RIHH 4ONHA 4YGVA 1B3IA 4E9SA 3NIDE 5L88H 2EKJA 1IARB 4DVBA 3ESOA 5KS9E 2YIHA 4PG9A 4EDXA 1A1OA 2XYBA 4KKLC 3VMNA 4P04A 2NY6C 1OHZA 3BP4A 5C6PB 1LWRA 1OAKH 2BS9A 4OCWL 4TYUA 3HCVA 1PDKB 3SSBA 2ZG2A 4AJWA 3D2UA 3U1SL 3V5KA 4V1DE 5HGBA 1JPTH 5SWSD 5T1KA 5HJ3A 3KW7A 4CMHC 4JDVA 4KUZL 1AMXA 4F9LA 5JNYB 4PEEA 3QO0A 1IC0A 1JUFA 4WI8A 5F9JB 3PIQA 2Q3AA 4AY0A 1IVTA 3BXNB 3MUJA 5CINH 2P46B 3WEMA 3GSNA 2QTVA 3F8UB 1ET7A 3GB7A 3L7EB 4TUKL 3Q48A 3OJMB 5CHNA 4DERA 5I30L 4ODUA 1QLEB 5L8JB 1SRDA 5T1MB 3QORD 4WW2A 1PE7A 5E00A 1KBVA 2P49B 4GBXC 5E8NB 5C3LD 1JF1B 1I31A 3Q6GH 6PCYA 2EDOA 4XAWL 3DVGA 3UTTB 4PRHE 3WKML 4NUJA 3HKFA 2JB5H 4LDEB 5EUKA 3VFOB 1YRKA 4LASH 4UNUA 2ISDA 1N59A 4MCZB 5H2BA 5JMRA 3VRJA 1TLXA 4WNJA 4RFNC 5CUSL 1WVZA 4YDIH 12E8L 4GKZA 5EU3B 3TNMA 4CN1A 1MFAH 4YHZL 2EDEA 1TU2B 2DYSB 1MFUA 5JW3H 3DBXB 3CLFH 2IAMA 5KYWA 1N64L 3ZLQC 2VWEE 1FGVH 4ZAKD 2KUTA 2VIRA 4MLIA 3BGFB 1VLXA 2D3JA 2AQRA 3SYOA 1J1OH 1NH6A 2ZX5A 4N5EC 2XRAH 3C5XA 2EE6A 1LEIA 2BNQD 2EDXA 4F7TA 2P43B 2GK2A 3MBEA 3DO1A 1OK8A 2DMCA 2BH0A 2K3HA 5E8DL 2ATKB 3ISWA