3NQYB

Crystal structure of the autoprocessed complex of vibriolysin mcp-02 with a single point mutation e346a
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
307
structure length
307
Chain Sequence
ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGTSGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQLQMRVHYSSNYENAFWDGSAMTFGDGQNTFYPLVSLDVSAHAVSHGFTEQNSGLIYNGKPGGLNEAFSDMAGEAAEFYMKGSNDWLVGKDIFKGNGALRYMNNPTQDGRSIDNQSNYYSGMDVHYSSGVYNKAFYNLATTPGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACDLNYDPNDVKAALAAVGVNSNLSSGSDCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted metalloprotease Mcp02
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 117
structure length 307
sequence length 307
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
B PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3nqyB02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3nqyB01
3T74A 1QF1A 3FU0A 3T8CA 5DYFA 2ZXGA 4OI5E 1GXWA 3FUIA 1KEIA 3CHSA 1U4GA 4MS6A 3FXSA 1PE7A 4MZNE 1BQBA 4QPEA 4QHPA 3B2PA 1ESPA 4MTWE 4XN2A 3NQXA 1QF2A 4PU2A 4RVBA 3P7SE 4N5PE 4X2UA 4GAAA 4XO4A 1THLA 4R5VA 5JVIE 1TLIA 4R7LA 3F28A 4ZW7A 4ZX6A 1FJOA 4XNBA 4ZW6A 1TMNE 1HYTA 3EBIA 2GTQA 3FV4A 4XO5A 4XNDA 5L3UE 4XNAA 5AENA 1FJ3A 3FXPA 4K90A 5FSPA 5HQDA 3FB0A 3FCQA 4K5PA 3MSNA 3FVPA 3FUEA 4PVBA 6TMNE 3F2PA 4OW3A 4TLNA 3EBHA 3P7PE 3FTUA 2XPZA 3FHEA 4XN7A 5TLNA 3FUHA 3P7RE 4ZW5A 3T87A 3NQZB 3FU3A 4J3BA 4K5NA 3P7UE 4QIRA 1HS6A 3DO2A 3Q44A 3TLIA 1SQMA 1FJVA 4XO3A 3FU6A 5JSSE 1FJWA 5DPFE 4K5LA 3DBKA 3B7RL 2TLIA 3FTWA 1LNAE 3Q43A 4XN8A 3FUDA 5FSJA 1KJPA 1TLPE 3B7SA 3P7WE 3ZI6A 2WHZA 3DO1A 5JT9E 1OS0A 4ZQTA 1EZMA 3FUJA 1FJTA 1KROA 3TMNE 4B52A 4D9WA 4TLIA 5TLIA 3FH7A 4TMNE 3MS3A 4MWPE 1LNCE 4K89A 4RSYA 4ZX5A 1KKKA 2HPTA 4XN1A 5DLHA 3FTXA 1LNFE 2R59A 3FLFA 3B7TA 3T2HE 4R5XA 2XQ0A 4K5OA 5BPPA 1LNEE 4ZX3A 5LIFE 5JS3E 3FUFA 2DQ6A 7TLNA 3P7QE 3U9WA 1KS7A 3P7VE 5L41E 3FH5A 4TNLA 5TMNE 4ZW8A 4N4EE 4D91A 3PUUA 1PE5A 3FUKA 6TLIA 8TLNE 3KEDA 1TRLA 4MXJE 4QMEA 3DO0A 4XMXA 1FJUA 3CHOA 3CHRA 3T2IE 3FUNA 5A3YA 4PW4A 4ZX4A 4XMTA 1LNDE 3FTVA 3B34A 5FXNA 3EBGA 2DQMA 2WI0A 3FU5A 2TLXA 1KL6A 1Y3GE 4GERA 1FJQA 3T2JE 3MSFA 2XPYA 1ZDPE 5K7TA 4XMWA 3SSBA 4XN4A 3DNZA 3LS7A 5LWDE 3NQYB 2TMNE 3EIMA 4XN9A 3QGOA 5DLLA 3CHPA 4MKTA 1GW6A 2G4ZA 1KR6A 5FWQA 4R5TA 4XMVA 3T8HA 1LNBE 3FBOA 4L2LA 4XMZA 8TLIA 1KTOA 3B37A 4M65A 5DPEE 3FORA 1TLXA 3FGDA 3CHQA 4H57A 3B2XA 3T73A 4N66E 4Q4IA 3QH5A 1PE8A 4K5MA 4QUOA 5JXNE 3B3BA 5L8PE 4Q4EA 3T8FA 3FULA 3T8DA 7TLIA 3FTYA 3FTZA 3FH8A 3T8VA 4XN5A 4XMUA 2A7GE 3FTSA 3MSAA 1H19A 2VJ8A 3NN7A 2VQXA 1KJOA 3P7TE 3FUMA 1QF0A 3QH1A 3T8GA 3B7UX 3N21A 3QJXA 5FSSA 4ZW3A 1L3FE 1NPCA 1Z9GE 3CIAA 4DPRA 2HPOA
chains in the Genus database with same CATH superfamily
4WZ9A 4QHPA 1BQBA 3B2PA 4MTWE 4GAAA 4R5VA 1TLIA 1FJOA 3EBIA 3QNFA 4XNDA 1LMLA 5AENA 3FXPA 5FSPA 3FCQA 3FVPA 3F2PA 5TLNA 4J3BA 4AR9A 1SQMA 4XO3A 4P8QA 1FJWA 3B7SA 3ZI6A 5JT9E 4B52A 3FH7A 1KKKA 2HPTA 3FTXA 4K5OA 5LIFE 2DQ6A 3P7QE 2YD0A 5TMNE 4ZW8A 4HOMA 3PUUA 3KEDA 4QMEA 3DO0A 1FJUA 3CHRA 5A3YA 4PW4A 3FTVA 5FXNA 5C97A 4FYQA 3FU5A 1Y3GE 5K7TA 4XMWA 3NQYB 2TMNE 5DLLA 1GW6A 3T8HA 1KTOA 4M65A 3FORA 3B2XA 4QUOA 5CU5A 7TLIA 3FTZA 3T8VA 4XN5A 4XMUA 4R5XA 3MSAA 3NN7A 3QH1A 1KJOA 3B7UX 3N21A 5FSSA 4ZW3A 1L3FE 3T74A 3T8CA 4OI5E 1U4GA 4MS6A 3FXSA 4FKKA 5AB0A 4XN2A 1QF2A 4PU2A 4N5PE 5LG6A 1THLA 1TMNE 1HYTA 2GTQA 3FV4A 4PVBA 3EBHA 3FTUA 3FU3A 4KX7A 3FTWA 3Q43A 3Q7JA 4FYTA 5FSJA 1TLPE 1OS0A 5J6SA 1FJTA 5TLIA 4K89A 4ZX5A 1LNFE 3T2HE 4ZX3A 5L41E 4TNLA 1PE5A 3FUKA 6TLIA 8TLNE 1TRLA 4MXJE 4PJ6A 4KX9A 4ZX4A 4FKEA 1LNDE 4NAQA 3EBGA 1KL6A 3MSFA 3SSBA 5LWDE 3EIMA 3QGOA 4MKTA 2G4ZA 1KR6A 1LNBE 4L2LA 4XMZA 4II7A 5JXNE 5L8PE 4Q4EA 3FTYA 3FH8A 2A7GE 3FTSA 1H19A 3FUMA 1Z9GE 4DPRA 1QF1A 1GXWA 3FUIA 1KEIA 4MZNE 4QPEA 1ESPA 5AB2A 3P7SE 4XO4A 4R7LA 3F28A 4XNBA 4ZW6A 5L3UE 3FB0A 4K5PA 3MSNA 4KX8A 4OW3A 2XPZA 4XN7A 3FUHA 3P7RE 4KXDA 4K5NA 1HS6A 3TLIA 5JSSE 4AR1A 3DBKA 4KXBA 2TLIA 4JBSA 1Z1WA 1KJPA 2WHZA 4E36A 4ARFA 1KROA 4TLIA 4TMNE 1LNCE 4RSYA 4XN1A 5DLHA 3B7TA 5BPPA 5JS3E 3FUFA 7TLNA 3U9WA 1KS7A 4N4EE 4XMXA 3T2IE 4XMTA 3FUNA 3B34A 3T2JE 2XPYA 1ZDPE 4F5CA 4XN4A 3LS7A 4FCAA 3CHPA 3FBOA 8TLIA 1TLXA 3CHQA 3T73A 4FYSA 3SE6A 3T8FA 5LDSA 3P7TE 3T8GA 2VJ8A 4ZX6A 4FYRA 4FKHA 4IHQA 2HPOA 3FU0A 5DYFA 2ZXGA 1Z5HA 3CHSA 4OU3A 1PE7A 4KXAA 3NQXA 4X2UA 4RVBA 5JVIE 4ZW7A 3MDJA 4XO5A 4XNAA 1FJ3A 4K90A 5HQDA 6TMNE 3FUEA 4TLNA 3P7PE 3FHEA 4ZW5A 4NZ8A 3T87A 3NQZB 3P7UE 4QIRA 3DO2A 3Q44A 4KXCA 1FJVA 3FU6A 4Z7IA 5DPFE 4K5LA 3B7RL 1LNAE 4XN8A 5K1VA 3FUDA 3P7WE 3DO1A 4ZQTA 1EZMA 3FUJA 3TMNE 4D9WA 3MS3A 5LHDA 4MWPE 2R59A 3FLFA 2XQ0A 1LNEE 3P7VE 3FH5A 4D91A 3CHOA 2DQMA 2WI0A 2TLXA 4GERA 1FJQA 3DNZA 4XN9A 4AR8A 5FWQA 4R5TA 4XMVA 4FGMA 3B37A 5DPEE 3FGDA 4H57A 4N66E 4Q4IA 3QH5A 1PE8A 4K5MA 3B3BA 3FULA 3T8DA 5EV7A 2VQXA 1QF0A 3QJXA 1NPCA 3CIAA
chains in the Genus database with same CATH topology
3T74A 1QF1A 3FU0A 3T8CA 5DYFA 2ZXGA 4OI5E 1GXWA 3FUIA 1KEIA 3CHSA 1U4GA 4MS6A 3FXSA 1PE7A 4MZNE 1BQBA 4QPEA 4QHPA 3B2PA 1ESPA 4MTWE 4XN2A 3NQXA 1QF2A 4PU2A 4RVBA 3P7SE 4N5PE 4X2UA 4GAAA 4XO4A 1THLA 4R5VA 5JVIE 1TLIA 4R7LA 3F28A 4ZW7A 4ZX6A 1FJOA 4XNBA 4ZW6A 1TMNE 1HYTA 3EBIA 2GTQA 3FV4A 4XO5A 4XNDA 5L3UE 1LMLA 4XNAA 5AENA 1FJ3A 3FXPA 4K90A 5FSPA 5HQDA 3FB0A 3FCQA 4K5PA 3MSNA 3FVPA 3FUEA 4PVBA 6TMNE 3F2PA 4OW3A 4TLNA 3EBHA 3P7PE 3FTUA 2XPZA 3FHEA 4XN7A 5TLNA 3FUHA 3P7RE 4ZW5A 3T87A 3NQZB 3FU3A 4J3BA 4K5NA 3P7UE 4QIRA 1HS6A 3DO2A 3Q44A 3TLIA 1SQMA 1FJVA 4XO3A 3FU6A 5JSSE 1FJWA 5DPFE 4K5LA 3DBKA 3B7RL 2TLIA 3FTWA 1LNAE 3Q43A 4XN8A 3FUDA 5FSJA 1KJPA 1TLPE 3B7SA 3P7WE 3ZI6A 2WHZA 3DO1A 5JT9E 1OS0A 4ZQTA 1EZMA 3FUJA 1FJTA 1KROA 3TMNE 4B52A 4D9WA 4TLIA 5TLIA 3FH7A 4TMNE 3MS3A 4MWPE 1LNCE 4K89A 4RSYA 4ZX5A 1KKKA 2HPTA 4XN1A 5DLHA 3FTXA 1LNFE 2R59A 3FLFA 3B7TA 3T2HE 4R5XA 2XQ0A 4K5OA 5BPPA 1LNEE 4ZX3A 5LIFE 5JS3E 3FUFA 2DQ6A 7TLNA 3P7QE 3U9WA 1KS7A 3P7VE 5L41E 3FH5A 4TNLA 5TMNE 4ZW8A 4N4EE 4D91A 3PUUA 1PE5A 3FUKA 6TLIA 8TLNE 3KEDA 1TRLA 4MXJE 4QMEA 3DO0A 4XMXA 1FJUA 3CHOA 3CHRA 3T2IE 3FUNA 5A3YA 4PW4A 4ZX4A 4XMTA 1LNDE 3FTVA 3B34A 5FXNA 3EBGA 2DQMA 2WI0A 3FU5A 2TLXA 1KL6A 1Y3GE 4GERA 1FJQA 3T2JE 3MSFA 2XPYA 1ZDPE 5K7TA 4XMWA 3SSBA 4XN4A 3DNZA 3LS7A 5LWDE 3NQYB 2TMNE 3EIMA 4XN9A 3QGOA 5DLLA 3CHPA 4MKTA 1GW6A 2G4ZA 1KR6A 5FWQA 4R5TA 4XMVA 3T8HA 1LNBE 3FBOA 4L2LA 4XMZA 8TLIA 1KTOA 3B37A 4M65A 5DPEE 3FORA 1TLXA 3FGDA 3CHQA 4H57A 3B2XA 3T73A 4N66E 4Q4IA 3QH5A 1PE8A 4K5MA 4QUOA 5JXNE 3B3BA 5L8PE 4Q4EA 3T8FA 3FULA 3T8DA 7TLIA 3FTYA 3FTZA 3FH8A 3T8VA 4XN5A 4XMUA 2A7GE 3FTSA 3MSAA 1H19A 2VJ8A 3NN7A 2VQXA 1KJOA 3P7TE 3FUMA 1QF0A 3QH1A 3T8GA 3B7UX 3N21A 3QJXA 5FSSA 4ZW3A 1L3FE 1NPCA 1Z9GE 3CIAA 4DPRA 2HPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T74 A;  1QF1 A;  3FU0 A;  3T8C A;  5DYF A;  2ZXG A;  4OI5 E;  1GXW A;  3FUI A;  1KEI A;  3CHS A;  1U4G A;  4MS6 A;  3FXS A;  1PE7 A;  4MZN E;  1BQB A;  4QPE A;  4QHP A;  3B2P A;  1ESP A;  4MTW E;  4XN2 A;  3NQX A;  1QF2 A;  4PU2 A;  4RVB A;  3P7S E;  4N5P E;  4X2U A;  4GAA A;  4XO4 A;  1THL A;  4R5V A;  5JVI E;  1TLI A;  4R7L A;  3F28 A;  4ZW7 A;  4ZX6 A;  1FJO A;  4XNB A;  4ZW6 A;  1TMN E;  1HYT A;  3EBI A;  2GTQ A;  3FV4 A;  4XO5 A;  4XND A;  5L3U E;  4XNA A;  5AEN A;  1FJ3 A;  3FXP A;  4K90 A;  5FSP A;  5HQD A;  3FB0 A;  3FCQ A;  4K5P A;  3MSN A;  3FVP A;  3FUE A;  4PVB A;  6TMN E;  3F2P A;  4OW3 A;  4TLN A;  3EBH A;  3P7P E;  3FTU A;  2XPZ A;  3FHE A;  4XN7 A;  5TLN A;  3FUH A;  3P7R E;  4ZW5 A;  3T87 A;  3NQZ B;  3FU3 A;  4J3B A;  4K5N A;  3P7U E;  4QIR A;  1HS6 A;  3DO2 A;  3Q44 A;  3TLI A;  1SQM A;  1FJV A;  4XO3 A;  3FU6 A;  5JSS E;  1FJW A;  5DPF E;  4K5L A;  3DBK A;  3B7R L;  2TLI A;  3FTW A;  1LNA E;  3Q43 A;  4XN8 A;  3FUD A;  5FSJ A;  1KJP A;  1TLP E;  3B7S A;  3P7W E;  3ZI6 A;  2WHZ A;  3DO1 A;  5JT9 E;  1OS0 A;  4ZQT A;  1EZM A;  3FUJ A;  1FJT A;  1KRO A;  3TMN E;  4B52 A;  4D9W A;  4TLI A;  5TLI A;  3FH7 A;  4TMN E;  3MS3 A;  4MWP E;  1LNC E;  4K89 A;  4RSY A;  4ZX5 A;  1KKK A;  2HPT A;  4XN1 A;  5DLH A;  3FTX A;  1LNF E;  2R59 A;  3FLF A;  3B7T A;  3T2H E;  4R5X A;  2XQ0 A;  4K5O A;  5BPP A;  1LNE E;  4ZX3 A;  5LIF E;  5JS3 E;  3FUF A;  2DQ6 A;  7TLN A;  3P7Q E;  3U9W A;  1KS7 A;  3P7V E;  5L41 E;  3FH5 A;  4TNL A;  5TMN E;  4ZW8 A;  4N4E E;  4D91 A;  3PUU A;  1PE5 A;  3FUK A;  6TLI A;  8TLN E;  3KED A;  1TRL A;  4MXJ E;  4QME A;  3DO0 A;  4XMX A;  1FJU A;  3CHO A;  3CHR A;  3T2I E;  3FUN A;  5A3Y A;  4PW4 A;  4ZX4 A;  4XMT A;  1LND E;  3FTV A;  3B34 A;  5FXN A;  3EBG A;  2DQM A;  2WI0 A;  3FU5 A;  2TLX A;  1KL6 A;  1Y3G E;  4GER A;  1FJQ A;  3T2J E;  3MSF A;  2XPY A;  1ZDP E;  5K7T A;  4XMW A;  3SSB A;  4XN4 A;  3DNZ A;  3LS7 A;  5LWD E;  3NQY B;  2TMN E;  3EIM A;  4XN9 A;  3QGO A;  5DLL A;  3CHP A;  4MKT A;  1GW6 A;  2G4Z A;  1KR6 A;  5FWQ A;  4R5T A;  4XMV A;  3T8H A;  1LNB E;  3FBO A;  4L2L A;  4XMZ A;  8TLI A;  1KTO A;  3B37 A;  4M65 A;  5DPE E;  3FOR A;  1TLX A;  3FGD A;  3CHQ A;  4H57 A;  3B2X A;  3T73 A;  4N66 E;  4Q4I A;  3QH5 A;  1PE8 A;  4K5M A;  4QUO A;  5JXN E;  3B3B A;  5L8P E;  4Q4E A;  3T8F A;  3FUL A;  3T8D A;  7TLI A;  3FTY A;  3FTZ A;  3FH8 A;  3T8V A;  4XN5 A;  4XMU A;  2A7G E;  3FTS A;  3MSA A;  1H19 A;  2VJ8 A;  3NN7 A;  2VQX A;  1KJO A;  3P7T E;  3FUM A;  1QF0 A;  3QH1 A;  3T8G A;  3B7U X;  3N21 A;  3QJX A;  5FSS A;  4ZW3 A;  1L3F E;  1NPC A;  1Z9G E;  3CIA A;  4DPR A;  2HPO A; 
#chains in the Genus database with same CATH topology
 4WZ9 A;  4QHP A;  1BQB A;  3B2P A;  4MTW E;  4GAA A;  4R5V A;  1TLI A;  1FJO A;  3EBI A;  3QNF A;  4XND A;  1LML A;  5AEN A;  3FXP A;  5FSP A;  3FCQ A;  3FVP A;  3F2P A;  5TLN A;  4J3B A;  4AR9 A;  1SQM A;  4XO3 A;  4P8Q A;  1FJW A;  3B7S A;  3ZI6 A;  5JT9 E;  4B52 A;  3FH7 A;  1KKK A;  2HPT A;  3FTX A;  4K5O A;  5LIF E;  2DQ6 A;  3P7Q E;  2YD0 A;  5TMN E;  4ZW8 A;  4HOM A;  3PUU A;  3KED A;  4QME A;  3DO0 A;  1FJU A;  3CHR A;  5A3Y A;  4PW4 A;  3FTV A;  5FXN A;  5C97 A;  4FYQ A;  3FU5 A;  1Y3G E;  5K7T A;  4XMW A;  3NQY B;  2TMN E;  5DLL A;  1GW6 A;  3T8H A;  1KTO A;  4M65 A;  3FOR A;  3B2X A;  4QUO A;  5CU5 A;  7TLI A;  3FTZ A;  3T8V A;  4XN5 A;  4XMU A;  4R5X A;  3MSA A;  3NN7 A;  3QH1 A;  1KJO A;  3B7U X;  3N21 A;  5FSS A;  4ZW3 A;  1L3F E;  3T74 A;  3T8C A;  4OI5 E;  1U4G A;  4MS6 A;  3FXS A;  4FKK A;  5AB0 A;  4XN2 A;  1QF2 A;  4PU2 A;  4N5P E;  5LG6 A;  1THL A;  1TMN E;  1HYT A;  2GTQ A;  3FV4 A;  4PVB A;  3EBH A;  3FTU A;  3FU3 A;  4KX7 A;  3FTW A;  3Q43 A;  3Q7J A;  4FYT A;  5FSJ A;  1TLP E;  1OS0 A;  5J6S A;  1FJT A;  5TLI A;  4K89 A;  4ZX5 A;  1LNF E;  3T2H E;  4ZX3 A;  5L41 E;  4TNL A;  1PE5 A;  3FUK A;  6TLI A;  8TLN E;  1TRL A;  4MXJ E;  4PJ6 A;  4KX9 A;  4ZX4 A;  4FKE A;  1LND E;  4NAQ A;  3EBG A;  1KL6 A;  3MSF A;  3SSB A;  5LWD E;  3EIM A;  3QGO A;  4MKT A;  2G4Z A;  1KR6 A;  1LNB E;  4L2L A;  4XMZ A;  4II7 A;  5JXN E;  5L8P E;  4Q4E A;  3FTY A;  3FH8 A;  2A7G E;  3FTS A;  1H19 A;  3FUM A;  1Z9G E;  4DPR A;  1QF1 A;  1GXW A;  3FUI A;  1KEI A;  4MZN E;  4QPE A;  1ESP A;  5AB2 A;  3P7S E;  4XO4 A;  4R7L A;  3F28 A;  4XNB A;  4ZW6 A;  5L3U E;  3FB0 A;  4K5P A;  3MSN A;  4KX8 A;  4OW3 A;  2XPZ A;  4XN7 A;  3FUH A;  3P7R E;  4KXD A;  4K5N A;  1HS6 A;  3TLI A;  5JSS E;  4AR1 A;  3DBK A;  4KXB A;  2TLI A;  4JBS A;  1Z1W A;  1KJP A;  2WHZ A;  4E36 A;  4ARF A;  1KRO A;  4TLI A;  4TMN E;  1LNC E;  4RSY A;  4XN1 A;  5DLH A;  3B7T A;  5BPP A;  5JS3 E;  3FUF A;  7TLN A;  3U9W A;  1KS7 A;  4N4E E;  4XMX A;  3T2I E;  4XMT A;  3FUN A;  3B34 A;  3T2J E;  2XPY A;  1ZDP E;  4F5C A;  4XN4 A;  3LS7 A;  4FCA A;  3CHP A;  3FBO A;  8TLI A;  1TLX A;  3CHQ A;  3T73 A;  4FYS A;  3SE6 A;  3T8F A;  5LDS A;  3P7T E;  3T8G A;  2VJ8 A;  4ZX6 A;  4FYR A;  4FKH A;  4IHQ A;  2HPO A;  3FU0 A;  5DYF A;  2ZXG A;  1Z5H A;  3CHS A;  4OU3 A;  1PE7 A;  4KXA A;  3NQX A;  4X2U A;  4RVB A;  5JVI E;  4ZW7 A;  3MDJ A;  4XO5 A;  4XNA A;  1FJ3 A;  4K90 A;  5HQD A;  6TMN E;  3FUE A;  4TLN A;  3P7P E;  3FHE A;  4ZW5 A;  4NZ8 A;  3T87 A;  3NQZ B;  3P7U E;  4QIR A;  3DO2 A;  3Q44 A;  4KXC A;  1FJV A;  3FU6 A;  4Z7I A;  5DPF E;  4K5L A;  3B7R L;  1LNA E;  4XN8 A;  5K1V A;  3FUD A;  3P7W E;  3DO1 A;  4ZQT A;  1EZM A;  3FUJ A;  3TMN E;  4D9W A;  3MS3 A;  5LHD A;  4MWP E;  2R59 A;  3FLF A;  2XQ0 A;  1LNE E;  3P7V E;  3FH5 A;  4D91 A;  3CHO A;  2DQM A;  2WI0 A;  2TLX A;  4GER A;  1FJQ A;  3DNZ A;  4XN9 A;  4AR8 A;  5FWQ A;  4R5T A;  4XMV A;  4FGM A;  3B37 A;  5DPE E;  3FGD A;  4H57 A;  4N66 E;  4Q4I A;  3QH5 A;  1PE8 A;  4K5M A;  3B3B A;  3FUL A;  3T8D A;  5EV7 A;  2VQX A;  1QF0 A;  3QJX A;  1NPC A;  3CIA A; 
#chains in the Genus database with same CATH homology
 3T74 A;  1QF1 A;  3FU0 A;  3T8C A;  5DYF A;  2ZXG A;  4OI5 E;  1GXW A;  3FUI A;  1KEI A;  3CHS A;  1U4G A;  4MS6 A;  3FXS A;  1PE7 A;  4MZN E;  1BQB A;  4QPE A;  4QHP A;  3B2P A;  1ESP A;  4MTW E;  4XN2 A;  3NQX A;  1QF2 A;  4PU2 A;  4RVB A;  3P7S E;  4N5P E;  4X2U A;  4GAA A;  4XO4 A;  1THL A;  4R5V A;  5JVI E;  1TLI A;  4R7L A;  3F28 A;  4ZW7 A;  4ZX6 A;  1FJO A;  4XNB A;  4ZW6 A;  1TMN E;  1HYT A;  3EBI A;  2GTQ A;  3FV4 A;  4XO5 A;  4XND A;  5L3U E;  1LML A;  4XNA A;  5AEN A;  1FJ3 A;  3FXP A;  4K90 A;  5FSP A;  5HQD A;  3FB0 A;  3FCQ A;  4K5P A;  3MSN A;  3FVP A;  3FUE A;  4PVB A;  6TMN E;  3F2P A;  4OW3 A;  4TLN A;  3EBH A;  3P7P E;  3FTU A;  2XPZ A;  3FHE A;  4XN7 A;  5TLN A;  3FUH A;  3P7R E;  4ZW5 A;  3T87 A;  3NQZ B;  3FU3 A;  4J3B A;  4K5N A;  3P7U E;  4QIR A;  1HS6 A;  3DO2 A;  3Q44 A;  3TLI A;  1SQM A;  1FJV A;  4XO3 A;  3FU6 A;  5JSS E;  1FJW A;  5DPF E;  4K5L A;  3DBK A;  3B7R L;  2TLI A;  3FTW A;  1LNA E;  3Q43 A;  4XN8 A;  3FUD A;  5FSJ A;  1KJP A;  1TLP E;  3B7S A;  3P7W E;  3ZI6 A;  2WHZ A;  3DO1 A;  5JT9 E;  1OS0 A;  4ZQT A;  1EZM A;  3FUJ A;  1FJT A;  1KRO A;  3TMN E;  4B52 A;  4D9W A;  4TLI A;  5TLI A;  3FH7 A;  4TMN E;  3MS3 A;  4MWP E;  1LNC E;  4K89 A;  4RSY A;  4ZX5 A;  1KKK A;  2HPT A;  4XN1 A;  5DLH A;  3FTX A;  1LNF E;  2R59 A;  3FLF A;  3B7T A;  3T2H E;  4R5X A;  2XQ0 A;  4K5O A;  5BPP A;  1LNE E;  4ZX3 A;  5LIF E;  5JS3 E;  3FUF A;  2DQ6 A;  7TLN A;  3P7Q E;  3U9W A;  1KS7 A;  3P7V E;  5L41 E;  3FH5 A;  4TNL A;  5TMN E;  4ZW8 A;  4N4E E;  4D91 A;  3PUU A;  1PE5 A;  3FUK A;  6TLI A;  8TLN E;  3KED A;  1TRL A;  4MXJ E;  4QME A;  3DO0 A;  4XMX A;  1FJU A;  3CHO A;  3CHR A;  3T2I E;  3FUN A;  5A3Y A;  4PW4 A;  4ZX4 A;  4XMT A;  1LND E;  3FTV A;  3B34 A;  5FXN A;  3EBG A;  2DQM A;  2WI0 A;  3FU5 A;  2TLX A;  1KL6 A;  1Y3G E;  4GER A;  1FJQ A;  3T2J E;  3MSF A;  2XPY A;  1ZDP E;  5K7T A;  4XMW A;  3SSB A;  4XN4 A;  3DNZ A;  3LS7 A;  5LWD E;  3NQY B;  2TMN E;  3EIM A;  4XN9 A;  3QGO A;  5DLL A;  3CHP A;  4MKT A;  1GW6 A;  2G4Z A;  1KR6 A;  5FWQ A;  4R5T A;  4XMV A;  3T8H A;  1LNB E;  3FBO A;  4L2L A;  4XMZ A;  8TLI A;  1KTO A;  3B37 A;  4M65 A;  5DPE E;  3FOR A;  1TLX A;  3FGD A;  3CHQ A;  4H57 A;  3B2X A;  3T73 A;  4N66 E;  4Q4I A;  3QH5 A;  1PE8 A;  4K5M A;  4QUO A;  5JXN E;  3B3B A;  5L8P E;  4Q4E A;  3T8F A;  3FUL A;  3T8D A;  7TLI A;  3FTY A;  3FTZ A;  3FH8 A;  3T8V A;  4XN5 A;  4XMU A;  2A7G E;  3FTS A;  3MSA A;  1H19 A;  2VJ8 A;  3NN7 A;  2VQX A;  1KJO A;  3P7T E;  3FUM A;  1QF0 A;  3QH1 A;  3T8G A;  3B7U X;  3N21 A;  3QJX A;  5FSS A;  4ZW3 A;  1L3F E;  1NPC A;  1Z9G E;  3CIA A;  4DPR A;  2HPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...