3NQYB

Crystal structure of the autoprocessed complex of vibriolysin mcp-02 with a single point mutation e346a
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
307
structure length
307
Chain Sequence
b'ANATGPGGNLKTGKYLYGTDFDSLDVSQSGNTCSMNNANVRTINLNGGTSGSSAYSFTCPENTFKEINGAYSPLNDAHFFGNVIFNMYNDWLGTAPLSFQLQMRVHYSSNYENAFWDGSAMTFGDGQNTFYPLVSLDVSAHAVSHGFTEQNSGLIYNGKPGGLNEAFSDMAGEAAEFYMKGSNDWLVGKDIFKGNGALRYMNNPTQDGRSIDNQSNYYSGMDVHYSSGVYNKAFYNLATTPGWDTQKAFIVMARANQLYWSAGVGWDLAGNGVMDAACDLNYDPNDVKAALAAVGVNSNLSSGSDCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted metalloprotease Mcp02
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 117
structure length 307
sequence length 307
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
B PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3nqyB02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3nqyB01
1TLXA 3B37A 3FUKA 3FCQA 1PE8A 4B52A 4OI5E 1HS6A 1FJ3A 4ZW5A 4Q4IA 5JSSE 5L8PE 3FTUA 1NPCA 5TLIA 7TLNA 1THLA 3T2HE 4ZX6A 3MSNA 3P7WE 3B7RL 3FTVA 3PUUA 5JVIE 3T8FA 3B2XA 1H19A 4MWPE 3Q44A 1PE7A 4PU2A 3FB0A 4DPRA 3FU3A 5A3YA 4XN4A 3F2PA 4XO4A 3DO2A 1KTOA 1KJPA 3FVPA 3NQYB 4R5VA 3Q43A 3T8GA 3P7VE 8TLNE 2VJ8A 4PW4A 4RSYA 3DBKA 2DQMA 3B34A 1TLPE 4XN5A 4XN2A 3B2PA 3NQZB 4MZNE 1Y3GE 4ZW6A 4QHPA 3B3BA 3FUMA 4XO5A 1QF1A 4N5PE 4XMXA 3FTXA 3ZI6A 4R5XA 4ZW3A 2DQ6A 3CHSA 4L2LA 3FU0A 4D9WA 1LNFE 3FLFA 1FJWA 3FTZA 3FH5A 2XPYA 3FULA 3FU6A 3FUFA 3FXSA 3P7RE 4XN7A 4MXJE 3T87A 2HPTA 3FH7A 3B7TA 3FHEA 1KEIA 4ZQTA 3FH8A 1TMNE 2TLXA 1KL6A 3DO1A 5FWQA 3F28A 4ZW7A 1OS0A 6TLIA 1FJVA 4RVBA 3FU5A 3CHQA 4Q4EA 1GXWA 2A7GE 3QGOA 1KJOA 4GERA 1ZDPE 1L3FE 5JS3E 3MS3A 3T8CA 4XNDA 3LS7A 1TLIA 2WI0A 5DYFA 4TLIA 3MSFA 1KR6A 4TMNE 5L41E 3FUHA 1LNDE 4K5OA 4H57A 1QF0A 3EIMA 1QF2A 1U4GA 3P7SE 4ZX5A 4TLNA 5TMNE 3T2IE 3QH5A 3T74A 4XO3A 4ZX4A 5HQDA 3NN7A 3KEDA 3FUIA 3T8DA 4QIRA 3B7SA 4MTWE 3EBHA 4XN8A 4D91A 1TRLA 4XN9A 2WHZA 4PVBA 4ZX3A 3U9WA 3CHPA 4K89A 4J3BA 4K5MA 5TLNA 2XQ0A 4ZW8A 1LNBE 3FTSA 2XPZA 1ESPA 1KROA 2TMNE 4XMUA 5LWDE 5L3UE 1FJQA 3DO0A 4GAAA 1FJUA 3MSAA 4OW3A 4XNBA 3FUDA 5FXNA 8TLIA 3N21A 3NQXA 1HYTA 4K5PA 1KS7A 7TLIA 3FUNA 4MKTA 3T8HA 1BQBA 3P7TE 4K90A 4K5NA 3EBGA 3FTWA 4QMEA 3FBOA 3T8VA 3CIAA 3T73A 5DPEE 3P7QE 5AENA 1GW6A 3FXPA 4K5LA 3FV4A 1Z9GE 4XMTA 2ZXGA 4M65A 5FSPA 1SQMA 1FJTA 3T2JE 3QH1A 4QPEA 4XMWA 1LNCE 3QJXA 2VQXA 3DNZA 3EBIA 3P7UE 4R7LA 2R59A 1FJOA 4XMZA 3FUEA 1PE5A 3TLIA 4XNAA 2HPOA 3P7PE 3FUJA 1LNAE 1EZMA 4TNLA 2TLIA 3CHOA 4N4EE 4X2UA 4QUOA 2GTQA 4XMVA 5DLHA 2G4ZA 4N66E 1KKKA 5BPPA 4XN1A 6TMNE 5K7TA 5LIFE 1LNEE 5JT9E 3B7UX 5JXNE 4R5TA 3TMNE 3SSBA 5DLLA 3CHRA 5FSJA 3FORA 5FSSA 3FGDA 3FTYA 5DPFE 4MS6A
chains in the Genus database with same CATH superfamily
3FUKA 2YD0A 5L8PE 4ZW5A 5TLIA 3T2HE 3MSNA 3P7WE 3FTVA 5JVIE 3T8FA 4NZ8A 3B2XA 4MWPE 5CU5A 4DPRA 5A3YA 4XN4A 4AR1A 3FVPA 3NQYB 1Z1WA 3P7VE 1TLPE 3MDJA 3B3BA 3FUMA 4QHPA 1QF1A 4XMXA 3FTXA 5LHDA 2DQ6A 4D9WA 3FLFA 4XO3A 3FULA 3T87A 3FXSA 4FKHA 4FYSA 3FHEA 3F28A 1OS0A 4NAQA 1FJVA 4RVBA 5C97A 4Q4EA 5K1VA 4FKEA 3MS3A 3LS7A 4TMNE 3EIMA 1U4GA 5HQDA 4XN8A 3SE6A 4K89A 2XQ0A 1ESPA 5LWDE 1FJUA 3MSAA 4XNBA 1HYTA 3EBGA 3T73A 3P7QE 1GW6A 4M65A 1FJTA 4HOMA 4QPEA 4R7LA 3FUEA 1PE5A 3FUJA 1LNAE 1EZMA 3CHOA 5AB2A 2G4ZA 4XN1A 5K7TA 4R5TA 3TMNE 3FGDA 3FTYA 4MS6A 1TLXA 1FJ3A 5JSSE 1NPCA 1THLA 4ZX6A 3B7RL 3PUUA 1H19A 3Q44A 1PE7A 3F2PA 3DO2A 1KTOA 1KJPA 4R5VA 3T8GA 3Q43A 4RSYA 4XN5A 3B2PA 4MZNE 4ZW6A 4N5PE 4ZW3A 3CHSA 3FU0A 1LNFE 3P7RE 4MXJE 3FH7A 4P8QA 2TLXA 3DO1A 4ZW7A 6TLIA 4FYRA 3FU5A 2A7GE 5JS3E 3T8CA 4XNDA 1TLIA 3Q7JA 1KR6A 3FUHA 3P7SE 3T74A 3KEDA 3FUIA 3T8DA 3B7SA 1TRLA 3CHPA 5EV7A 5L3UE 3DO0A 4KXDA 4GAAA 3FUDA 8TLIA 4OU3A 7TLIA 3P7TE 3FBOA 3T8VA 3CIAA 4FCAA 5FSPA 1SQMA 3T2JE 1LMLA 5LDSA 5AB0A 3EBIA 3P7UE 3QNFA 4X2UA 4QUOA 2GTQA 4AR8A 1KKKA 5BPPA 6TMNE 5LIFE 1LNEE 3SSBA 5DLLA 5FSJA 5FSSA 3B37A 4B52A 1HS6A 4Q4IA 3FTUA 7TLNA 4AR9A 4PU2A 3FU3A 4XO4A 2VJ8A 3DBKA 2DQMA 3B34A 4XN2A 1Y3GE 4F5CA 4R5XA 4L2LA 3FU6A 3FH5A 4XN7A 3B7TA 4Z7IA 1KEIA 4ZQTA 3FH8A 1KL6A 1ZDPE 4FGMA 5L41E 1LNDE 1QF2A 4KX8A 4TLNA 3NN7A 4QIRA 4MTWE 3EBHA 4XN9A 4ZX3A 3U9WA 4K5MA 5TLNA 5J6SA 4ZW8A 1LNBE 3FTSA 1KROA 4XMUA 5FXNA 3N21A 3NQXA 1KS7A 3FUNA 3T8HA 4QMEA 3FXPA 3FV4A 3QH1A 4FYQA 2R59A 3TLIA 2HPOA 3P7PE 2TLIA 5DLHA 5JXNE 3CHRA 5DPFE 4KXAA 3FCQA 1PE8A 4OI5E 4FKKA 1Z5HA 3FB0A 8TLNE 4PW4A 3NQZB 4KX9A 4FYTA 4WZ9A 4XO5A 3ZI6A 3FTZA 1FJWA 2XPYA 3FUFA 4KX7A 2HPTA 4KXBA 1TMNE 5FWQA 3CHQA 1GXWA 3QGOA 1KJOA 4GERA 1L3FE 4KXCA 2WI0A 5DYFA 4TLIA 3MSFA 4ZX5A 4K5OA 4H57A 1QF0A 5TMNE 3T2IE 4ZX4A 3QH5A 4D91A 2WHZA 4PVBA 4J3BA 4JBSA 2XPZA 4E36A 2TMNE 1FJQA 4OW3A 4IHQA 4K5PA 4MKTA 1BQBA 4K90A 4K5NA 3FTWA 4PJ6A 5DPEE 5AENA 4K5LA 1Z9GE 4XMTA 2ZXGA 4XMWA 1LNCE 3QJXA 2VQXA 3DNZA 1FJOA 4XMZA 4XNAA 5LG6A 4TNLA 4N4EE 4ARFA 4XMVA 4N66E 5JT9E 3B7UX 4II7A 3FORA
chains in the Genus database with same CATH topology
1TLXA 3B37A 3FUKA 3FCQA 1PE8A 4B52A 4OI5E 1HS6A 1FJ3A 4ZW5A 4Q4IA 5JSSE 5L8PE 3FTUA 1NPCA 5TLIA 7TLNA 1THLA 3T2HE 4ZX6A 3MSNA 3P7WE 3B7RL 3FTVA 3PUUA 5JVIE 3T8FA 3B2XA 1H19A 4MWPE 3Q44A 1PE7A 4PU2A 3FB0A 4DPRA 3FU3A 5A3YA 4XN4A 3F2PA 4XO4A 3DO2A 1KTOA 1KJPA 3FVPA 3NQYB 4R5VA 3Q43A 3T8GA 3P7VE 8TLNE 2VJ8A 4PW4A 4RSYA 3DBKA 2DQMA 3B34A 1TLPE 4XN5A 4XN2A 3B2PA 3NQZB 4MZNE 1Y3GE 4ZW6A 4QHPA 3B3BA 3FUMA 4XO5A 1QF1A 4N5PE 4XMXA 3FTXA 3ZI6A 4R5XA 4ZW3A 2DQ6A 3CHSA 4L2LA 3FU0A 4D9WA 1LNFE 3FLFA 1FJWA 3FTZA 3FH5A 2XPYA 3FULA 3FU6A 3FUFA 3FXSA 3P7RE 4XN7A 4MXJE 3T87A 2HPTA 3FH7A 3B7TA 3FHEA 1KEIA 4ZQTA 3FH8A 1TMNE 2TLXA 1KL6A 3DO1A 5FWQA 3F28A 4ZW7A 1OS0A 6TLIA 1FJVA 4RVBA 3FU5A 3CHQA 4Q4EA 1GXWA 2A7GE 3QGOA 1KJOA 4GERA 1ZDPE 1L3FE 5JS3E 3MS3A 3T8CA 4XNDA 3LS7A 1TLIA 2WI0A 5DYFA 4TLIA 3MSFA 1KR6A 4TMNE 5L41E 3FUHA 1LNDE 4K5OA 4H57A 1QF0A 3EIMA 1QF2A 1U4GA 3P7SE 4ZX5A 4TLNA 5TMNE 3T2IE 3QH5A 3T74A 4XO3A 4ZX4A 5HQDA 3NN7A 3KEDA 3FUIA 3T8DA 4QIRA 3B7SA 4MTWE 3EBHA 4XN8A 4D91A 1TRLA 4XN9A 2WHZA 4PVBA 4ZX3A 3U9WA 3CHPA 4K89A 4J3BA 4K5MA 5TLNA 2XQ0A 4ZW8A 1LNBE 3FTSA 2XPZA 1ESPA 1KROA 2TMNE 4XMUA 5LWDE 5L3UE 1FJQA 3DO0A 4GAAA 1FJUA 3MSAA 4OW3A 4XNBA 3FUDA 5FXNA 8TLIA 3N21A 3NQXA 1HYTA 4K5PA 1KS7A 7TLIA 3FUNA 4MKTA 3T8HA 1BQBA 3P7TE 4K90A 4K5NA 3EBGA 3FTWA 4QMEA 3FBOA 3T8VA 3CIAA 3T73A 5DPEE 3P7QE 5AENA 1GW6A 3FXPA 4K5LA 3FV4A 1Z9GE 4XMTA 2ZXGA 4M65A 5FSPA 1SQMA 1FJTA 3T2JE 1LMLA 3QH1A 4QPEA 4XMWA 1LNCE 3QJXA 2VQXA 3DNZA 3EBIA 3P7UE 4R7LA 2R59A 1FJOA 4XMZA 3FUEA 1PE5A 3TLIA 4XNAA 2HPOA 3P7PE 3FUJA 1LNAE 1EZMA 4TNLA 2TLIA 3CHOA 4N4EE 4X2UA 4QUOA 2GTQA 4XMVA 5DLHA 2G4ZA 4N66E 1KKKA 5BPPA 4XN1A 6TMNE 5K7TA 5LIFE 1LNEE 5JT9E 3B7UX 5JXNE 4R5TA 3TMNE 3SSBA 5DLLA 3CHRA 5FSJA 3FORA 5FSSA 3FGDA 3FTYA 5DPFE 4MS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TLX A;  3B37 A;  3FUK A;  3FCQ A;  1PE8 A;  4B52 A;  4OI5 E;  1HS6 A;  1FJ3 A;  4ZW5 A;  4Q4I A;  5JSS E;  5L8P E;  3FTU A;  1NPC A;  5TLI A;  7TLN A;  1THL A;  3T2H E;  4ZX6 A;  3MSN A;  3P7W E;  3B7R L;  3FTV A;  3PUU A;  5JVI E;  3T8F A;  3B2X A;  1H19 A;  4MWP E;  3Q44 A;  1PE7 A;  4PU2 A;  3FB0 A;  4DPR A;  3FU3 A;  5A3Y A;  4XN4 A;  3F2P A;  4XO4 A;  3DO2 A;  1KTO A;  1KJP A;  3FVP A;  3NQY B;  4R5V A;  3Q43 A;  3T8G A;  3P7V E;  8TLN E;  2VJ8 A;  4PW4 A;  4RSY A;  3DBK A;  2DQM A;  3B34 A;  1TLP E;  4XN5 A;  4XN2 A;  3B2P A;  3NQZ B;  4MZN E;  1Y3G E;  4ZW6 A;  4QHP A;  3B3B A;  3FUM A;  4XO5 A;  1QF1 A;  4N5P E;  4XMX A;  3FTX A;  3ZI6 A;  4R5X A;  4ZW3 A;  2DQ6 A;  3CHS A;  4L2L A;  3FU0 A;  4D9W A;  1LNF E;  3FLF A;  1FJW A;  3FTZ A;  3FH5 A;  2XPY A;  3FUL A;  3FU6 A;  3FUF A;  3FXS A;  3P7R E;  4XN7 A;  4MXJ E;  3T87 A;  2HPT A;  3FH7 A;  3B7T A;  3FHE A;  1KEI A;  4ZQT A;  3FH8 A;  1TMN E;  2TLX A;  1KL6 A;  3DO1 A;  5FWQ A;  3F28 A;  4ZW7 A;  1OS0 A;  6TLI A;  1FJV A;  4RVB A;  3FU5 A;  3CHQ A;  4Q4E A;  1GXW A;  2A7G E;  3QGO A;  1KJO A;  4GER A;  1ZDP E;  1L3F E;  5JS3 E;  3MS3 A;  3T8C A;  4XND A;  3LS7 A;  1TLI A;  2WI0 A;  5DYF A;  4TLI A;  3MSF A;  1KR6 A;  4TMN E;  5L41 E;  3FUH A;  1LND E;  4K5O A;  4H57 A;  1QF0 A;  3EIM A;  1QF2 A;  1U4G A;  3P7S E;  4ZX5 A;  4TLN A;  5TMN E;  3T2I E;  3QH5 A;  3T74 A;  4XO3 A;  4ZX4 A;  5HQD A;  3NN7 A;  3KED A;  3FUI A;  3T8D A;  4QIR A;  3B7S A;  4MTW E;  3EBH A;  4XN8 A;  4D91 A;  1TRL A;  4XN9 A;  2WHZ A;  4PVB A;  4ZX3 A;  3U9W A;  3CHP A;  4K89 A;  4J3B A;  4K5M A;  5TLN A;  2XQ0 A;  4ZW8 A;  1LNB E;  3FTS A;  2XPZ A;  1ESP A;  1KRO A;  2TMN E;  4XMU A;  5LWD E;  5L3U E;  1FJQ A;  3DO0 A;  4GAA A;  1FJU A;  3MSA A;  4OW3 A;  4XNB A;  3FUD A;  5FXN A;  8TLI A;  3N21 A;  3NQX A;  1HYT A;  4K5P A;  1KS7 A;  7TLI A;  3FUN A;  4MKT A;  3T8H A;  1BQB A;  3P7T E;  4K90 A;  4K5N A;  3EBG A;  3FTW A;  4QME A;  3FBO A;  3T8V A;  3CIA A;  3T73 A;  5DPE E;  3P7Q E;  5AEN A;  1GW6 A;  3FXP A;  4K5L A;  3FV4 A;  1Z9G E;  4XMT A;  2ZXG A;  4M65 A;  5FSP A;  1SQM A;  1FJT A;  3T2J E;  3QH1 A;  4QPE A;  4XMW A;  1LNC E;  3QJX A;  2VQX A;  3DNZ A;  3EBI A;  3P7U E;  4R7L A;  2R59 A;  1FJO A;  4XMZ A;  3FUE A;  1PE5 A;  3TLI A;  4XNA A;  2HPO A;  3P7P E;  3FUJ A;  1LNA E;  1EZM A;  4TNL A;  2TLI A;  3CHO A;  4N4E E;  4X2U A;  4QUO A;  2GTQ A;  4XMV A;  5DLH A;  2G4Z A;  4N66 E;  1KKK A;  5BPP A;  4XN1 A;  6TMN E;  5K7T A;  5LIF E;  1LNE E;  5JT9 E;  3B7U X;  5JXN E;  4R5T A;  3TMN E;  3SSB A;  5DLL A;  3CHR A;  5FSJ A;  3FOR A;  5FSS A;  3FGD A;  3FTY A;  5DPF E;  4MS6 A; 
#chains in the Genus database with same CATH topology
 3FUK A;  2YD0 A;  5L8P E;  4ZW5 A;  5TLI A;  3T2H E;  3MSN A;  3P7W E;  3FTV A;  5JVI E;  3T8F A;  4NZ8 A;  3B2X A;  4MWP E;  5CU5 A;  4DPR A;  5A3Y A;  4XN4 A;  4AR1 A;  3FVP A;  3NQY B;  1Z1W A;  3P7V E;  1TLP E;  3MDJ A;  3B3B A;  3FUM A;  4QHP A;  1QF1 A;  4XMX A;  3FTX A;  5LHD A;  2DQ6 A;  4D9W A;  3FLF A;  4XO3 A;  3FUL A;  3T87 A;  3FXS A;  4FKH A;  4FYS A;  3FHE A;  3F28 A;  1OS0 A;  4NAQ A;  1FJV A;  4RVB A;  5C97 A;  4Q4E A;  5K1V A;  4FKE A;  3MS3 A;  3LS7 A;  4TMN E;  3EIM A;  1U4G A;  5HQD A;  4XN8 A;  3SE6 A;  4K89 A;  2XQ0 A;  1ESP A;  5LWD E;  1FJU A;  3MSA A;  4XNB A;  1HYT A;  3EBG A;  3T73 A;  3P7Q E;  1GW6 A;  4M65 A;  1FJT A;  4HOM A;  4QPE A;  4R7L A;  3FUE A;  1PE5 A;  3FUJ A;  1LNA E;  1EZM A;  3CHO A;  5AB2 A;  2G4Z A;  4XN1 A;  5K7T A;  4R5T A;  3TMN E;  3FGD A;  3FTY A;  4MS6 A;  1TLX A;  1FJ3 A;  5JSS E;  1NPC A;  1THL A;  4ZX6 A;  3B7R L;  3PUU A;  1H19 A;  3Q44 A;  1PE7 A;  3F2P A;  3DO2 A;  1KTO A;  1KJP A;  4R5V A;  3T8G A;  3Q43 A;  4RSY A;  4XN5 A;  3B2P A;  4MZN E;  4ZW6 A;  4N5P E;  4ZW3 A;  3CHS A;  3FU0 A;  1LNF E;  3P7R E;  4MXJ E;  3FH7 A;  4P8Q A;  2TLX A;  3DO1 A;  4ZW7 A;  6TLI A;  4FYR A;  3FU5 A;  2A7G E;  5JS3 E;  3T8C A;  4XND A;  1TLI A;  3Q7J A;  1KR6 A;  3FUH A;  3P7S E;  3T74 A;  3KED A;  3FUI A;  3T8D A;  3B7S A;  1TRL A;  3CHP A;  5EV7 A;  5L3U E;  3DO0 A;  4KXD A;  4GAA A;  3FUD A;  8TLI A;  4OU3 A;  7TLI A;  3P7T E;  3FBO A;  3T8V A;  3CIA A;  4FCA A;  5FSP A;  1SQM A;  3T2J E;  1LML A;  5LDS A;  5AB0 A;  3EBI A;  3P7U E;  3QNF A;  4X2U A;  4QUO A;  2GTQ A;  4AR8 A;  1KKK A;  5BPP A;  6TMN E;  5LIF E;  1LNE E;  3SSB A;  5DLL A;  5FSJ A;  5FSS A;  3B37 A;  4B52 A;  1HS6 A;  4Q4I A;  3FTU A;  7TLN A;  4AR9 A;  4PU2 A;  3FU3 A;  4XO4 A;  2VJ8 A;  3DBK A;  2DQM A;  3B34 A;  4XN2 A;  1Y3G E;  4F5C A;  4R5X A;  4L2L A;  3FU6 A;  3FH5 A;  4XN7 A;  3B7T A;  4Z7I A;  1KEI A;  4ZQT A;  3FH8 A;  1KL6 A;  1ZDP E;  4FGM A;  5L41 E;  1LND E;  1QF2 A;  4KX8 A;  4TLN A;  3NN7 A;  4QIR A;  4MTW E;  3EBH A;  4XN9 A;  4ZX3 A;  3U9W A;  4K5M A;  5TLN A;  5J6S A;  4ZW8 A;  1LNB E;  3FTS A;  1KRO A;  4XMU A;  5FXN A;  3N21 A;  3NQX A;  1KS7 A;  3FUN A;  3T8H A;  4QME A;  3FXP A;  3FV4 A;  3QH1 A;  4FYQ A;  2R59 A;  3TLI A;  2HPO A;  3P7P E;  2TLI A;  5DLH A;  5JXN E;  3CHR A;  5DPF E;  4KXA A;  3FCQ A;  1PE8 A;  4OI5 E;  4FKK A;  1Z5H A;  3FB0 A;  8TLN E;  4PW4 A;  3NQZ B;  4KX9 A;  4FYT A;  4WZ9 A;  4XO5 A;  3ZI6 A;  3FTZ A;  1FJW A;  2XPY A;  3FUF A;  4KX7 A;  2HPT A;  4KXB A;  1TMN E;  5FWQ A;  3CHQ A;  1GXW A;  3QGO A;  1KJO A;  4GER A;  1L3F E;  4KXC A;  2WI0 A;  5DYF A;  4TLI A;  3MSF A;  4ZX5 A;  4K5O A;  4H57 A;  1QF0 A;  5TMN E;  3T2I E;  4ZX4 A;  3QH5 A;  4D91 A;  2WHZ A;  4PVB A;  4J3B A;  4JBS A;  2XPZ A;  4E36 A;  2TMN E;  1FJQ A;  4OW3 A;  4IHQ A;  4K5P A;  4MKT A;  1BQB A;  4K90 A;  4K5N A;  3FTW A;  4PJ6 A;  5DPE E;  5AEN A;  4K5L A;  1Z9G E;  4XMT A;  2ZXG A;  4XMW A;  1LNC E;  3QJX A;  2VQX A;  3DNZ A;  1FJO A;  4XMZ A;  4XNA A;  5LG6 A;  4TNL A;  4N4E E;  4ARF A;  4XMV A;  4N66 E;  5JT9 E;  3B7U X;  4II7 A;  3FOR A; 
#chains in the Genus database with same CATH homology
 1TLX A;  3B37 A;  3FUK A;  3FCQ A;  1PE8 A;  4B52 A;  4OI5 E;  1HS6 A;  1FJ3 A;  4ZW5 A;  4Q4I A;  5JSS E;  5L8P E;  3FTU A;  1NPC A;  5TLI A;  7TLN A;  1THL A;  3T2H E;  4ZX6 A;  3MSN A;  3P7W E;  3B7R L;  3FTV A;  3PUU A;  5JVI E;  3T8F A;  3B2X A;  1H19 A;  4MWP E;  3Q44 A;  1PE7 A;  4PU2 A;  3FB0 A;  4DPR A;  3FU3 A;  5A3Y A;  4XN4 A;  3F2P A;  4XO4 A;  3DO2 A;  1KTO A;  1KJP A;  3FVP A;  3NQY B;  4R5V A;  3Q43 A;  3T8G A;  3P7V E;  8TLN E;  2VJ8 A;  4PW4 A;  4RSY A;  3DBK A;  2DQM A;  3B34 A;  1TLP E;  4XN5 A;  4XN2 A;  3B2P A;  3NQZ B;  4MZN E;  1Y3G E;  4ZW6 A;  4QHP A;  3B3B A;  3FUM A;  4XO5 A;  1QF1 A;  4N5P E;  4XMX A;  3FTX A;  3ZI6 A;  4R5X A;  4ZW3 A;  2DQ6 A;  3CHS A;  4L2L A;  3FU0 A;  4D9W A;  1LNF E;  3FLF A;  1FJW A;  3FTZ A;  3FH5 A;  2XPY A;  3FUL A;  3FU6 A;  3FUF A;  3FXS A;  3P7R E;  4XN7 A;  4MXJ E;  3T87 A;  2HPT A;  3FH7 A;  3B7T A;  3FHE A;  1KEI A;  4ZQT A;  3FH8 A;  1TMN E;  2TLX A;  1KL6 A;  3DO1 A;  5FWQ A;  3F28 A;  4ZW7 A;  1OS0 A;  6TLI A;  1FJV A;  4RVB A;  3FU5 A;  3CHQ A;  4Q4E A;  1GXW A;  2A7G E;  3QGO A;  1KJO A;  4GER A;  1ZDP E;  1L3F E;  5JS3 E;  3MS3 A;  3T8C A;  4XND A;  3LS7 A;  1TLI A;  2WI0 A;  5DYF A;  4TLI A;  3MSF A;  1KR6 A;  4TMN E;  5L41 E;  3FUH A;  1LND E;  4K5O A;  4H57 A;  1QF0 A;  3EIM A;  1QF2 A;  1U4G A;  3P7S E;  4ZX5 A;  4TLN A;  5TMN E;  3T2I E;  3QH5 A;  3T74 A;  4XO3 A;  4ZX4 A;  5HQD A;  3NN7 A;  3KED A;  3FUI A;  3T8D A;  4QIR A;  3B7S A;  4MTW E;  3EBH A;  4XN8 A;  4D91 A;  1TRL A;  4XN9 A;  2WHZ A;  4PVB A;  4ZX3 A;  3U9W A;  3CHP A;  4K89 A;  4J3B A;  4K5M A;  5TLN A;  2XQ0 A;  4ZW8 A;  1LNB E;  3FTS A;  2XPZ A;  1ESP A;  1KRO A;  2TMN E;  4XMU A;  5LWD E;  5L3U E;  1FJQ A;  3DO0 A;  4GAA A;  1FJU A;  3MSA A;  4OW3 A;  4XNB A;  3FUD A;  5FXN A;  8TLI A;  3N21 A;  3NQX A;  1HYT A;  4K5P A;  1KS7 A;  7TLI A;  3FUN A;  4MKT A;  3T8H A;  1BQB A;  3P7T E;  4K90 A;  4K5N A;  3EBG A;  3FTW A;  4QME A;  3FBO A;  3T8V A;  3CIA A;  3T73 A;  5DPE E;  3P7Q E;  5AEN A;  1GW6 A;  3FXP A;  4K5L A;  3FV4 A;  1Z9G E;  4XMT A;  2ZXG A;  4M65 A;  5FSP A;  1SQM A;  1FJT A;  3T2J E;  1LML A;  3QH1 A;  4QPE A;  4XMW A;  1LNC E;  3QJX A;  2VQX A;  3DNZ A;  3EBI A;  3P7U E;  4R7L A;  2R59 A;  1FJO A;  4XMZ A;  3FUE A;  1PE5 A;  3TLI A;  4XNA A;  2HPO A;  3P7P E;  3FUJ A;  1LNA E;  1EZM A;  4TNL A;  2TLI A;  3CHO A;  4N4E E;  4X2U A;  4QUO A;  2GTQ A;  4XMV A;  5DLH A;  2G4Z A;  4N66 E;  1KKK A;  5BPP A;  4XN1 A;  6TMN E;  5K7T A;  5LIF E;  1LNE E;  5JT9 E;  3B7U X;  5JXN E;  4R5T A;  3TMN E;  3SSB A;  5DLL A;  3CHR A;  5FSJ A;  3FOR A;  5FSS A;  3FGD A;  3FTY A;  5DPF E;  4MS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...