4II7A

Archaellum assembly atpase flai
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
512
structure length
504
Chain Sequence
b'SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGEIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FlaI ATPase
publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
total genus 156
structure length 504
sequence length 512
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ii7A05
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ii7A02
3.30.360.100 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ii7A01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ii7A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ii7A04
1ZD1A 2P6RA 5FBVB 4EPXA 4B33A 4EKDA 3GFTA 4DLXA 1Z6XA 1Q21A 2LWIA 4JLBA 5EP3A 4PAQA 4HYYA 5CIQA 3T1TA 4QL3A 5CLQA 3GLHE 1VCMA 4LBVA 1CJVC 2A3RA 4DCNA 2WJGA 5EUMA 3TSZA 3TSOA 1X3SA 2NPFA 2HF8A 2QY9A 2B7BA 4JBXA 5L3QA 2J0QA 1DG3A 3KXIA 3TKLA 4HLQB 1BYIA 2GAAA 1MABA 1YU9A 2QQ0A 1VCIA 1XCGB 4TYPA 4ESVA 2GEVA 4EIWA 2CVHA 4OHWA 1DAMA 3B6EA 1NKSA 4NYMQ 1SVOA 4IDQA 1N5KA 2F1JA 2A30A 2VL7A 3B1VA 1YZLA 4X8HA 2E9SA 2ZREA 2WSMA 3LNCA 1ZU4A 2JGNA 2O8DA 2QMHA 4MRSA 2NO6A 5F2EA 1VMAA 4ITRC 4B75A 4NTZA 3H86A 4AC9A 4C30A 2WWWA 3FKSD 4LPSA 3L2OB 2FFBA 4RD4A 4WAUA 4AYXA 2IS6A 2YC2C 1E1QD 1TADA 3LH5A 1PLKA 1XXHE 1Z0IA 2ZSDA 4FXPA 2J7PD 4GMDA 3K9HA 4KI0A 4V0OA 2ZRKA 1A2KC 3C5CA 3K0AB 4QHSA 2V3CC 5E3HA 2VHUA 4G0NA 4HLCA 5FR1A 1NLYA 2AKYA 2HXYA 1RFLA 3CPHA 3KB1A 1Z2AA 4TSFD 2FPLA 4A8JA 2DBYA 3VNUA 1FQKA 1G7TA 3FDIA 5FUVA 4AKGA 1ZVQA 2VHCA 4BUJA 2V8OA 1GNPA 4ZDKA 4JKYA 1JXMA 3SDZA 3Q8XB 3BBPA 1EFTA 2C5LA 2WKPA 4D2IA 3ND9A 4RD6A 5FUXA 1T5IA 2GNOA 1YZUA 2KSQA 4BQSA 3CNNA 5JWRA 4MUBA 1Q20A 2O8CB 1SHZA 5FBRB 1GITA 4HI0E 3T1QA 4DSUA 1NLZA 1XRJA 1EFHA 4P4SB 1YR7A 3TUIC 5JFGA 5KSOA 3LW7A 1ZBDA 2A78A 1G1MA 2FEOA 4PC6A 5SZIA 1WB9A 2IYXA 2YWFA 1KZGB 2WKQA 1DVRA 3K9NA 4ZI3A 1BOFA 1CLUA 3VR6A 1D8TA 2QAGA 4TL8A 2JDID 4ZCLA 1OPXA 1E2EA 3QKRB 4US1R 1UBFA 1MT0A 2ATVA 4V0ME 5H8WA 1G3UA 4PHGA 5LD2B 3A36A 2D3WA 3GJ4A 2W2VA 2NZ8A 3PEYA 3BB1A 3THXB 4B47A 3AVVA 4E5UA 2ZYUX 2H1LA 3RS7A 2O8EA 1ZAKA 4GI7A 4Q4AB 2OFXA 4UNSA 2DY1A 4XVRA 1IN6A 5DHAA 4ZI2A 1E4VA 3K8YA 1Q1ZA 1U98A 4Q9JA 2F1IA 2AX4A 3QXHA 4LYFA 1K5DA 3WMFA 4PPFA 1I4DD 4ASUA 1AKYA 4TT3D 2JIZD 1WBDA 2BKUA 2NPIA 1E9RA 3CZPA 3UATA 1U8ZA 3AKCA 1VCOA 5JMTA 3K0CC 4Q00A 2RGGA 4V0KA 3Q7QA 5KTYA 2OV2A 1GZSA 4JSYA 3FKSA 2R6FA 1U0HC 3EAQA 4NL4H 1NKTA 2W0SA 1KMHB 2ZS8A 1TF5A 4KFRA 1F3OA 2O0JA 1XEXB 4DWJA 3WNDA 1M6NA 4ILEA 1NVVR 4BASA 4MRRA 1QG2A 1TUEA 1OB5A 2D62A 1T91A 2J7PA 3AF2A 3MAAC 2X2EA 4B32A 2WICA 4OBEA 1K8RA 4NE2A 4DLSA 4F4IA 2REOA 1E2HA 2P6UA 4M8NE 1JALA 3EC2A 4EFNA 4JLDA 3HU2A 4HLUC 4AWXA 3QXCA 2WJHA 4KU4A 3REFA 2BBOA 2QZ4A 2VP5A 4TSFA 2PX0A 3NC0C 2IXGA 2ZI9A 4C2UA 1DO2A 4PANA 5UKDA 2YKGA 5FOSA 2L0XA 2QM8A 1HURA 5AR1A 4GP6A 1G41A 3P32A 3ZGXA 5FOUA 3TK1A 2QI9C 5FOTA 4KSBA 3M1IA 4TMTA 4A92A 2QGNA 4B35A 2HT6A 1PV4A 4DLUA 4E09A 2ZXUA 3VU9B 2WAXA 2VTKA 1E79A 4DKXA 4HEJA 2DFTA 3LDAA 4QFMA 5FR2A 3PUWA 3PXGA 4MGZR 1N5JA 5CJPA 2IK8A 1IN5A 3TUZC 2AKAB 3WMGA 1ZIOA 5EXXA 1FMJA 2REXB 3CRVA 5KDOA 4NZYA 1HE8B 2QE7D 2C99A 4DSNA 3PEWA 1E94E 3V4RA 3X1XA 1N6IA 2FJUA 5HZHA 5B58C 1W4RA 5F9HA 4E22A 1QHHB 2FSGA 2A9KA 5IF9A 3GP8A 1QRAA 2OESA 3QG1A 4P4TA 5CK5A 2O8BB 4YDSA 2PCJA 4JL8A 2XXAA 3CRQA 4L16A 5KO2A 2HJGA 4NYMR 4LYHA 3GLGB 1JBKA 2PEYA 3D3QA 1ZD8A 3FGNA 2ZROA 4N0EA 4W9MC 4BPBA 3N70A 1LNZA 1ZD9A 2QBYA 1OXXK 4PHHA 4TT3A 2JIZA 2VA8A 1XTQA 1UKVY 1WDTA 2F1RA 5DE3A 3F5FA 1CULC 4OI4A 1P9WA 3WHLA 1I4LD 4IKEA 2F1HA 1RYHA 1ZP6A 4YONB 3CRW1 2ORIA 3O8DA 3O47A 4A2PA 4EJSB 2QSZA 1G64A 2CL7X 4TQUS 3W8RA 4DDUA 4B3FX 3BB4A 4QM7A 1NI3A 2OXRA 5J4VA 2QU8A 1M34E 4LJAA 5IT5A 2WWHA 4Q4HA 4II7A 1EFRD 2RGCA 421PA 5CM9C 2A5FA 2QPAA 3AGPA 4LV6A 2ZANA 1XP8A 4PQYA 4DIDA 4B3DA 4I99A 3W3AA 1N0UA 3NBYC 4GZLA 4MUAA 4A0RA 1E3MA 1K5GA 2J45A 3U60B 1JEEA 1FFHA 2OCBA 3DM9B 2QT1A 4C0QC 3VMFA 3VNVA 1TL7C 4M21A 4C0SA 4TZ6A 1Z6YA 2WSSD 1XD8A 1ZJ6A 2PLRA 1QHYA 4JLOA 4RY2A 2WTUA 5B64A 2G6BA 3B60A 1BO6A 1U8AA 5GADl 2OBMA 3KFVA 2ZRCA 2BVNA 3H1TA 5JSZA 2XZLA 1KSFX 3MFYA 3GQBA 4JL5A 3NKVA 4FWTA 4FN5A 3DKPA 2DWPA 1FX0B 3NC1C 2KB0A 4QM6A 5DYIA 1XDBA 2BBSA 1JPJA 1NSTA 2CEAA 1UPTA 1KSGA 1UFQA 4BGDA 5TMPA 1OSNA 3CNLA 3NBXX 2ZRAA 2NOAA 2CDNA 3THXA 2QE7A 1R0YA 1OH5A 1PZNA 4U7DA 2HUPA 4B6FA 4PO9A 2GJKA 3VHLB 3OESA 2QSYA 2ZI5A 1Q1BA 1U9IC 3RS3A 2CE2X 2KBEA 1R5BA 2YC4C 2R6DA 2BIFA 4DEYA 5H1YA 2HT1A 1W0KD 2ORVA 1Q0UA 4KVAA 1R6BX 1SXJD 5TXGA 1Z6AA 3SI7A 4L8GA 4A1FA 1LW7A 4MGYR 1KK0A 3GCGA 3H2YA 1YQTA 2P0EA 2NO9A 4EJSC 5DGXA 5CB8A 5L3SB 3K09C 2QL6A 1IN8A 4PQRA 1Z06A 4UNPA 2V55B 1BIFA 1KOFA 1RIFA 1OE0A 4UNNA 1W4BA 3K70B 2PT7A 3IBYA 1KMHA 2OO7A 2YV5A 3QVUA 4DRZA 4CRWB 1SKYB 3QXJA 4KV9A 3SQWA 2ZRMA 1FQJA 4YLGA 1IXSB 1G8PA 2Q6TA 5FTLA 121PA 2GZAA 3MLEA 4WZAE 1N3BA 1XJCA 2F43B 2XAUA 4PZZA 4TMXA 2CBZA 4PSVA 3BH0A 1YR8A 2AWNA 1DAHA 3DPUA 4V0NA 2Q3HA 4KJZA 4Z1MA 3GPLA 3CM0A 1P2TA 1L4UA 1KDTA 3JZAA 3QVVA 4RFVA 2KWIA 4IOKA 1Z8FA 3RRNA 2WHXA 3CR7A 3QG5A 1ZM3A 1CKEA 4GPTA 3U7FB 3N2EA 2BHRA 4G5QA 3CZQA 3NVAA 1JR6A 2ZJ5A 1ZNWA 3Q3JB 1KO4A 3L0SA 3AH8A 3VU9A 4MYCA 5JEDA 1OJLA 3WYFA 1JPNA 4TYNA 4PQFA 3GLIA 4DVGA 5FTKA 2J0VA 2AR7A 1I2MA 2FV8A 4LV5B 1ZINA 1IN7A 1XFAA 3QEOA 4TL6A 1VG1A 3WHKA 3LRPA 4BRUA 2IA5A 2Z6VA 3SZRA 4IEEA 4IEIA 4KVGA 3G0HA 3C5HA 4OI1A 5DN6A 4B74A 1R0ZA 2D7CA 2ZI4A 3I3SR 5EXPA 2AD1A 4WBSA 1JJ7A 2V54A 2FA9A 3KTAA 1G3MA 2P3SA 4PXAA 1KJWA 1N6KA 3ASYA 5KNBA 1ELOA 4D82A 4DDTA 1D6JA 1XX6A 1QHHA 2OFWA 2D2FA 4M22A 4WXPA 4NU0A 1FTNA 1P61B 3PENA 2O8BA 2C98A 1YE8A 2OBLA 4NH0A 4PAMA 3ZS8A 5JCZA 2NGRA 2H5EA 2XNSA 1K6MA 5H70A 1R2QA 1W5TA 4E03A 2W83A 1MABB 4RFSA 3DHWC 621PA 1P4SA 4A0FA 1W36B 2C04A 1SVSA 3ADCA 4XOIA 4MKFA 2LKCA 3ECCA 3K70D 2CL0X 3U6BA 3A37A 4LI0A 3SJCA 2PEZA 3Q72A 3R8CA 1EESA 1AS3A 3W6PA 2QENA 3EXAA 4OKSA 3LA6A 2VP9A 2GXAA 1Z0AA 4AI6A 2A2ZA 1VYUA 1N6PA 3C4JA 4GOJA 2GRJA 1SVIA 3REGA 2ZM5A 2BC9A 1QF9A 1G16A 3CH4B 3GJ0A 2FPMA 1FP6A 1GSIA 1A4RA 5HKKD 1IBRA 4N0DA 2GEUA 1F60A 1HT1E 2ZS9A 1E9DA 4HB3A 3LX8A 4P0TA 2W6JD 3UMSA 1GAJA 4QC2A 2XB2A 1OXSC 1P72A 3OEED 2WMNB 3N2IA 4NCNA 3U2QA 1Q44A 2J7KA 1J7KA 4C0AC 2J3EA 4US0R 2DHRA 1G3RA 4XSGA 4ABYA 1KI4A 2JATA 2AWOA 4RSGA 3QF4A 3Q85A 4LHWA 1XPOA 1SVMA 4JLMA 2X1VA 5JCPA 2WJIA 2VH5R 4C0HA 3IPXA 2V4ZA 4QGFA 2ZU0C 1G20E 3VR2A 2IYTA 2ZEJA 3VR3A 3U3RA 3J81k 4NCHA 1DTSA 2QMUA 2WJYA 4ZDIA 4W5WA 4FIDA 1P2VA 4EUNA 5DSZA 4QXAA 2IXEA 2GXQA 4CIDA 3O8BA 1OFUX 3BB3A 3OE7A 5AK0A 3QSYA 2QAGB 2ZIAA 4QNRA 3FHOA 4YC7A 1W5SA 4DIEA 1F5NA 2D2EA 3KDSE 4V02A 2KE5A 2RKOA 4RD3A 1GNRA 2H57A 4ON9A 3AKYA 2IUSA 4AYTA 2WWFA 4V0LA 3QJYA 2V7QD 3WYAA 3VKWA 4UJ3A 3VR4A 2GZHA 3BGWA 1CIPA 2QP9X 1F2UB 2O8EB 1ZUHA 2I4IA 2AFIE 2NTYC 4A6PA 2FU5C 1RZ3A 1W0JD 2JAQA 3KXLA 4EPVA 1KAOA 2KJQA 2RHMA 5L3SA 3DMNA 5HE9A 4IOLA 4AURA 1EXMA 3W6OA 3DKVA 2IUUA 3FYHA 3DOFA 2F55A 1ZW6A 5DNYB 3AF1A 1MRSA 4B73A 3I62A 3U3KA 1VIYA 3EZ2A 2QP4A 4MDFA 1AK2A 2JLVA 1N6HA 4LK2A 5LBIA 1U0LA 4PC3A 1YZKA 2PZEA 3THOA 4JBWA 5FL7D 5KNCA 3CX7A 2NIPA 2OILA 1E9BA 2LKDA 2IWHA 2XZOA 3LBIA 1FUKA 3DZDA 2BMDA 2F43A 4DLTA 3BRWD 3ZZTA 4UQOA 1NG1A 1YHNA 4GFDA 5HKKA 1HTWA 3PIRA 5B57C 4A8JC 1E1RA 3TRFA 4RJLA 4AG6A 1GIAA 3GJ5A 3IO3A 2W6JA 1R10A 1E69A 3T06B 3CX6A 3IKJA 2X8AA 3PFIA 3CPEA 4DDVA 1XD2B 3IHWA 4B3CA 1FZQA 4M1MA 3UXMA 3U61B 1E2KA 1G8FA 4YDHB 2ASEA 1ZUNB 3BC1A 4ZDJA 1XZQA 3KKPA 4GNKA 3FMPB 5EXTA 1ZM9A 1ZC3A 1I2DA 1AS2A 2RMKA 5JHHB 1YKSA 2ZJ8A 2FN4A 2VP2A 4HDCA 1TF2A 4CEIA 3TR0A 1GVNB 1IY0A 1D2NA 4HB2A 4QHYA 4M2LA 1OV4A 3SHFA 2G77B 4U00A 3PCRB 3RYTC 3NG1A 3MMPA 4OQFA 1A82A 2GCNA 1GWNA 2CL6X 3P26A 1J8MF 1D5CA 1TEXA 2QGZA 3LFUA 4TTPA 2A5YB 4QJ4A 1MV5A 2GTPA 4TTRA 2ZI6A 1F48A 1R5NA 1DEKA 1OF1A 3THWA 3FTQA 1CJMA 4LHVA 4HB0A 2OM2A 3TQFA 4NDZA 1E98A 1JAHA 5HCIA 4KFUA 1KO7A 3OF5A 1VG9B 1LS1A 3FFBA 3FWYA 4BLTA 1JR3E 3P1JA 5TY0A 2DWOA 3IBGA 2V7QA 3KXKA 4M1OA 1W2GA 2NO7A 2MSEB 1XNJA 2EFHB 1E32A 4YMTA 2MMGA 1XMVA 4IVRA 1OH8A 3RHFA 3CF2A 2ZPTX 2XXAB 1UKZA 3EA0A 4C7OB 2PJRA 1OXTA 2CE7A 2UVQA 3U44B 4B6EA 4QGHA 1OIWA 1VECA 2WJVA 5LPNA 2ZRDA 1E2LA 3THYA 1A5TA 4WIAA 4P4UA 1RYFA 5J5CA 3RWMB 2XSZD 3ZVNA 2GVDC 2B8WA 2CCGA 2R6CA 4EPRA 1EX7A 2QBYB 1Z0DA 3CLVA 2FGJA 5EP1A 1DADA 3KL4A 5GVRA 1C1YA 3RRMA 3QUSA 4Q9KA 5KSYA 5FL7A 4MRVA 1S2MA 4Q1EA 2ZJZA 5C4GB 1LFDB 2C2HA 1KY3A 4GOXA 4LPKA 4M1SA 1OH7A 4IVPA 2RGXA 2VHQA 2VF7A 3X2SA 3BD9A 3ZZ0A 4C3ZA 1Y63A 4IW3B 4Q4HB 3EA5A 5LDDC 2GCOA 5ELXA 1ODFA 4HAYA 4HSEA 2WJJA 4FMBB 5FPYA 4CVNA 1LF0A 4FD2A 2JLXA 1T5LA 1OXUA 1F2TB 1G19A 1NIPA 3I8XA 3LVRE 5CJ2A 1G4AE 2OT3B 1ANKA 2HF9A 4MYUA 4KHZA 3AF3A 5SZKB 3IDQA 1P7CA 3JZMA 4G3XA 4WA7A 3L0PA 4LJYA 4XD7D 1G291 1QVAA 2QORA 4KLZA 4V03A 3TIFA 1UKEA 2QROA 3G82C 3T5GA 2DR3A 3GJ6A 1QVRA 1P5ZB 2FH5B 4DUGA 3MD0A 4EFMA 3AKDA 3BH7A 4L9SA 1XMSA 4IXMA 5D3MB 5JSZB 2ZAMA 1JQJC 2VRWA 2ZRFA 1E2IA 4C4PA 2C9CA 5DI3A 2IC5A 4PPNA 1W44A 2I3BA 3GEEA 2OLJA 1Z28A 4PHFA 1R8SA 4ZO4A 4PPQA 2Q3MA 2ZJYA 3ND8A 2HCJB 2Z4RA 5G53C 1MO3A 1E99A 2IYWA 3KKMA 3W8NA 1XTKA 3CNOA 3NBZC 3OIYA 2EFDB 3QY0A 1ZNYA 1F2UA 1IJFA 2R8RA 4D25A 2ZRBA 2P5SA 2PLFA 2UZ3A 3MGCA 1NN0A 2VBCA 1Z08A 4Q18A 5EE0A 1XEFA 4I4LA 2GA8A 2IYUA 2XNDD 3PQCA 5D3QA 1CR2A 2PT5A 3C15C 3WP0A 5FPSA 3AVOA 2CXXA 3HR7A 3HYRA 2Z0MA 2R62A 5CIWA 2EFEB 1X8KA 1MO4A 3P4XA 1ZC4A 2XSZA 3B85A 3LXRA 1E2GA 1ESMA 1G21E 1Q3TA 1J2JA 2WV9A 4NYIQ 2RGAA 2EYQA 4A0HA 4B2LA 1XPRA 1N6NA 3TW8B 4CW7A 3SYKA 1P2SA 3LLUA 2I1VB 2IEZA 1QHGA 4DCVA 4H9GA 3LO5A 4FMCF 1NVUQ 1ZMXA 1KNXA 4JLAA 1EG7A 4NP6A 3RS4A 4A82A 1HQCA 4D0GA 1E1QA 2ZE8A 3QEJA 1YZNA 2DPXA 1O87A 1G3QA 5HPYB 5HZKA 1XD2A 2Q3FA 4LZZA 4A15A 2VHTA 4OHYA 1Q1QA 4IOJA 3V4FA 1XMIA 3SQXA 3R9XA 2YYZA 3B13B 3X1DA 1DOAA 4Q5IA 1G9XA 2GXUA 4TLAA 5TB5A 1KO5A 1JEDA 2Z4SA 1XEWY 1CF4A 2OCYC 3A4NA 3QKTA 4JIMA 1SKQA 2FZ4A 2QPOA 2ZJOA 5AJZA 4BLOA 4JT2A 4XD7A 2IF2A 1WF3A 2NG1A 4LX0A 1E2FA 3HDTA 5JJIA 1TAGA 3TGPA 4GZMA 4Q01A 3LV8A 2Q21A 5DIFA 2ZE5A 3HWSA 3GLIB 5LD2C 1GDDA 1JB1A 2G9NA 3HR8A 2GEDA 5GJWC 1AQYA 1NY6A 1M2OB 3RLFA 2R6GA 1Q22A 3I73A 2YNMA 4PZYA 2JDIA 2HV8A 3EPHA 3RSLA 3SBDA 2HDNB 3TVDA 2FSHA 2CLCX 8OHMA 1E0AA 3MCAA 1E9SA 1GRQA 1OIXA 2FSIA 1TPZA 3Q9LA 4A4DA 2J1LA 2DFKB 5FTJA 2RH5A 3KTAB 4Q1AA 1Z07A 3L82B 1VG8A 1XZPA 4PO1A 2OE2A 5DI9A 1DO0A 1GRNA 3KZ1E 1LY1A 4BZPA 4D6PA 2FGKA 3IILA 3L8YA 2NZJA 4G5OA 1J8YF 1X8JA 3SOPA 1OFTA 4C7OA 5FTMA 1WCV1 1OYYA 3GEIA 3K9LA 3RC3A 1GKUB 4DJTA 3U44A 2ZYVX 3U3JA 2ZRHA 4NBSA 2JJ2D 5J4HA 5LB4A 3D31A 1SXJB 2K5UA 2CHVA 1NLFA 3FFAA 3FOZA 4PX9A 4RFSB 2VQSA 3ETLA 1X1SA 3ONWA 2Q9BA 2FZLA 4Q1BA 4J0QA 2WWXA 2I1QA 1NY5A 2CHQA 1ZNXA 4O25A 2NQ2C 3SHWA 2RB4A 1ETUA 1G6HA 2GJ8A 3VAAA 1E2JA 2ORWA 3B1XA 3LBHA 1UEJA 2PX3A 3Q5DA 3T35A 5L3VA 1SULA 2VP6A 4M1WA 4JLVA 3SU8A 4PSAA 3OZXA 3RABA 1HH4A 1UBGA 4RZXA 4ERNA 2AN9A 2RGBA 1AZSC 2VYFA 5AUQA 3VX3A 1YZGA 1IY2A 1QHIA 1G7RA 2FFQA 3UANA 1RKBA 5JWHA 1H8ED 4K8OA 2ZUBA 3GLGE 1F2TA 2D4HA 2GJSA 4YXWD 2J0UA 1JI0A 3GJ8A 1KSJA 1KK1A 2C8VA 5EE5B 5JRJA 4TZ0A 2IYSA 3AP3A 5FL3A 3K0CA 4LYAA 4C0KA 3NDPA 3AM1A 3AVYA 1S1MA 3JVUA 4FCVA 4U02A 4BWYA 2AXPA 3QF4B 5FPTA 1BYUA 4TL9A 5CYPA 3QOFA 1LS6A 3U7EB 1EGAA 2QQEA 4XTCS 2GBLC 2ZR7A 4LOAA 4V0MA 1DPFA 4DBLC 4I1VA 3DEFA 1NMYA 4D26A 4Q1DA 3GMTA 2ZYTX 2R44A 5D3MA 2XTZA 4BEBA 3WRXC 1D9XA 4IDPA 4K81B 1E9CA 4ZCMA 1ZM2A 1E96A 1XTSA 2BM0A 3R7WA 4LDJA 2AHOA 1UF9A 1UAAA 5DO9A 3ASZA 4QBGB 3FPAA 4MYTA 5FOWA 4HLUA 4FMCB 3U3OA 2IHBA 4FCWA 2CHGA 2CNWD 4Q4LA 1KI1A 2YOHA 1OIVA 3AEZA 2OFOA 4MKHA 4CGZA 4BRWA 1W1WA 3KJGA 1S0UA 3PEVA 1IJEA 5TVKA 5C18A 4URZR 2FPKA 2OSBA 4KSCA 3QNUA 3UMFA 1S3GA 3DVLA 1WA5A 4HB4A 1XPUA 5FUYA 4O2RA 4B76A 3X1WA 3UG7A 1CJKC 1E6CA 2V6IA 3MJHA 5GJCA 1IN4A 3RS0A 4E07A 1W48A 1CRPA 2QAJA 3SJAA 1BMFD 4KAXA 3L43A 1US8A 3G5UA 3EX7C 1NJFA 1U90A 4OQXA 4RD2A 4BFZA 4NYIR 4JKIA 2IYLD 3M4YA 3KFXA 1O3YA 3ZZUA 3EPKA 2BV3A 3AUYA 3X1YA 2Q9AA 2JLWA 3A58B 3HU1A 4XVUA 5J47A 3ZD7A 4M53A 2WIBA 4M9QA 1Z6GA 2DWQA 4F93B 1N0WA 4GP7A 4XVQA 5AWFC 2BKEA 2REBA 2OAQ1 3T61A 1G3IA 1Z6TA 3DOEA 1OXVA 3TE6A 3L8ZA 2XITA 4UXJA 1EFRA 1ZRHA 1U99A 4DLVA 4DDWA 1T3SA 2MMCA 1H8EA 2XOKD 5KDDA 4FMDF 4Q7LA 4NCJA 5JS7A 1M1YE 3OEHD 1NBME 4YXWA 3UIEA 5AUNB 2NMVA 2IEYA 3AVPA 4M9ZA 4NCIA 4JVNA 4MDEA 1II8B 2VSXA 3BAFA 2LCFA 5EZ5A 3TR5A 2RGNC 4FCTA 3ZD6A 4A36A 2RGEA 4BLQA 1P60A 3FMFA 3IQXA 3WNCA 4PC7A 2W2XA 3I5XA 5KSPA 2WSSA 2P6NA 1M7GA 2JLQA 3I4LA 1PVOA 1W49A 2YINC 2YWGA 3SFZA 1SGWA 4CEIB 2W0MA 4O0MA 4PFSA 1SKYE 2EFGA 3QE0A 3LX5A 1N25A 3CWZA 1HA3A 2IUTA 2R65A 1AM4D 4US2R 2D06A 3K1JA 3SR0A 5EE9A 2IT1A 1HQYE 3TVTA 1TQDA 5CK4A 2ANBA 1NMXA 5CDFE 2DCUA 2J5XA 2WPDD 1YVDA 5ANRB 1CR0A 4AD8A 4JL6A 5IDVA 1M8PA 3THWB 2CJWB 3ICQB 1S8FA 1N0VC 2CNWA 4DCSA 3GLFB 4R7ZA 2W6ID 1GKIA 1Z47A 4LY6A 4NKRA 5BN3A 1OKKD 3VR5A 1Z0FA 2OCAA 1UKYA 3ZH9B 1T9HA 2QN6A 3IUYA 1NVWQ 2H16A 4IVQA 3TAUA 1LV7A 4DC9A 1M74A 2B7CA 4LBZA 1YZQA 4DEXA 1KZ7B 1G5RA 1W0KA 4LC0A 3C8UA 1ZCBA 1SXJA 2O5VA 1DAFA 1R4AA 3W5JA 1G18A 2C9OA 3K70C 1NIJA 1I4TD 2BDTA 5EZ6B 1BMFA 2ZJBA 4LJ8A 3EIHA 5BYJA 3KJHA 3THYB 4P3YA 2WWIA 2J46A 2ERYA 3NHAA 2J0SA 1SHKA 5KYKA 1HUQA 3U7HB 5BXQC 3T15A 1F6BA 4RZ3A 4CEHB 1ZIPA 3F8TA 1TU4A 3B78A 1X8LA 4GSYA 1KI8A 2QRNA 5K8TA 1U9IA 1AJEA 2YOGA 5JZVA 2JLYA 4O3MA 1QHNA 5JWOA 1NG9A 2G0NA 3M6AA 1OLOA 1OB2A 1X1RA 3MSXA 1COWD 4IXNA 4DT1A 4F91B 1Y3AA 4ARZB 4BZQA 3EIEA 4FINA 4HZUA 3EPLA 4AY2A 2JEOA 2NO0A 2XOKA 2GCOB 2XEXA 3K09A 4M9XA 1H65A 4ZKEA 1DAGA 1P6XA 4WVFA 1QHXA 4I1OA 1V43A 4Q4JA 2AK3A 1U8YA 3A8TA 1GL7A 3LXXA 4URXR 4XSHA 4RZUA 1P2UA 5E95A 1RW4A 2WZQA 1U81A 2YVUA 2ZE6A 2J41A 5K8IA 2J59A 2H17A 2GZDA 2B8TA 1SVKA 3EZFA 1EWQA 3TNFA 3SN6A 4MA4A 4B2PA 5C2JB 1NRJB 2ATXA 3A4LA 3S1AB 4AIIA 1T6NA 1S9DA 1W2HA 4Z8YA 1HT2E 2F9LA 5KUTA 5A0FA 5F3WB 3SBEA 4WXRA 2ZI7A 5TARA 4OJKA 2WMOB 1VG0B 2GF0A 2WPDA 1KKMA 3A1TA 3QI2A 1NP6A 4JLNA 5DI3B 2ZAOA 5FBQB 2AFHE 4X8LA 1CTQA 5LB2A 3PUYA 2XTMA 4F92B 4TLEA 2W6IA 3QENA 1P73A 5EP4A 3DMDA 3LD9A 4BFUA 1Q12A 3KJEA 2BEKA 3RNLA 1KDRA 1NF3A 2ZR9A 1OKKA 1Z5ZA 1W36C 1CEEA 4NMMA 2F3TA 1VYVA 3K0FA 2PZFA 3GEHA 2OZEA 3QQ5A 1FTSA 4OQLA 1ZM7A 4JLPA 4PAOA 2HLDD 2QMOA 4AKEA 1E2NA 4B2IA 1V5WA 1HYQA 2IL1A 1MO5A 3D8BA 1G7SA 4Q66C 3IGFA 3PEUA 1W47A 3CONA 3ZQ6A 4L5BA 4POAA 1VIAA 2JJ1D 4IFEA 5B2ZA 5E7IA 2BJWA 3KB2A 3CF6R 3R9IA 2EWWA 4GDFA 4AKHA 2GHIA 1B0UA 1CP2A 3DDCA 4LGMA 4RKFA 4HLDA 3TAHA 1TMKA 4JS0A 1AN0A 3CKLA 4G5GA 4EPTA 1Q57A 2ZJ2A 2BWJA 2ONKA 4NCKA 4Q03A 4KLNA 3B1ZA 4TMWA 4TQAA 1HV8A 2FEMA 3TUJC 5EJEA 4WOPA 5JLJA 1R7RA 3CRRA 5F98A 4B3GA 4LC1A 5L8VA 1L4YA 1P75A 4M1TA 4JBYA 2BM1A 3OEEA 4G1UC 4CEJA 4NHOA 5FFMA 2E1RA 4AK9A 1LTQA 3ZIAD 1G8YA 1II8A 3EG5A 3QIAA 3I1FA 3KQLA 1NSFA 1W4AA 1NVXQ 2GKSA 4ZIRA 1G7CA 1IAQA 3CO5A 2FFHA 1MH1A 4LHYA 1R0XA 2KI5A 4C0JA 1VTKA 3B8HA 3CPJB 1GG2A 5SZJA 1XJ0A 3WNBA 3H0KA 4M4SA 4URVR 3NXSA 1YR6A 4TLDA 1YJ5A 3R9WA 4BFTA 2JLRA 3W34A 3WRYC 3WY9A 3K53A 3CB4A 2QAGC 1S3SA 4Q48A 4BEJA 3AGQA 1E2QA 1U94A 2B6HA 2FOLA 2R6AA 4URUR 4XJXA 4B44A 4XWKA 5KSZA 5C4MA 5FTNA 3TW4A 1G5PA 3UKDA 2GDJA 3U5ZB 4GT1A 1QDEA 6Q21A 2PZGA 1XU4A 2CJWA 1WP9A 1UDWA 5JEEA 4UNQA 2AK2A 3GLFA 1X6VA 3ZLJA 2ODEA 5CB6A 3P4YA 4AKIA 2WM9B 3HPRA 2WBLC 3H84A 2IS2A 2C96A 3BK7A 3W5IA 2A7QA 3I5YA 4F4JA 3CRMA 1KTVA 2JA1A 1FP7A 1Z63A 3JVVA 2CK3D 3IIMA 4W7SA 3BE4A 1S9HA 1NN1A 3SNHA 2ZUDA 1T0HB 3MUFA 1N6RA 1RRCA 3DL0A 3WMEA 4ACAA 5G40A 2BEJA 2KBFA 4R2IA 4QJ5A 4C0LA 1W0JA 2VF8A 4YMWA 1N5IA 2HLDA 2FWRA 4KITB 1N6LA 2VLIA 1CU1A 3WBJA 3T1OA 1GUAA 3KX2A 1U0JA 2OXCA 4UXIA 1XXHB 3TH5A 3C16C 4HUQB 4RD1A 2OCPA 4CEHA 2JJ1A 2D7DA 5JHGB 1G8HA 3ADDA 4R2HA 4QKQA 1KDPA 4ESHA 1LVGA 1SZPA 2BBWA 2PJZA 4URWR 2HEIA 4KO8A 4D0NA 4M1YA 3FMIA 2GF9A 4Q7MB 1L2TA 2DFLA 2GILA 3VQTA 2IYYA 4TLCA 3I8SA 4QJ3A 1AZTA 3QBVA 4ASUD 3D6TB 1KKLA 2UZIR 3MJRA 1KDOA 1MRNA 3BFXA 4ARZA 3E5HA 1ZCAA 5EUQB 2B21A 1SVWA 4R98A 3UMRA 5IRCD 2GWHA 4FWIB 3A1VA 4LHXA 4NPHA 3ZJYA 5FPKA 2TMKA 3NHBA 1RE0A 3I92A 3ZIAA 2CCJA 4EFLA 2G1JA 2A5JA 2E87A 4RCZA 4MRNA 2J0UB 1CS4C 1XWIA 3IIKA 1PJRA 2G1KA 1KMQA 4TL7A 2J87A 4D0LB 1KSHA 4QBFA 5IK2D 5GVSA 3WP1B 3VKGA 2EYUA 2VP4A 3B2EA 4PZLA 4PSKA 4Q9HA 2XTNA 2A5DA 3ADKA 4JSTA 1G17A 5KHOC 3C14C 4G01B 2ECKA 4OK6A 3SFVA 2BCJQ 3MRSA 4HDQB 3S1AA 1OW3B 4JT4A 4LCBA 3KKOA 4BFWA 1AA9A 3QKUA 3SYNA 2BMJA 2V6JA 1JR3D 2WOOA 5AJXA 1GILA 4JJZA 3GJ7A 4DCTA 1MKYA 4LSGA 3ZVRA 4LBWA 2IS4A 1IHUA 2F7SA 2CVFA 1P9NA 3R7WB 2IYVA 1KK2A 1Q3HA 2PL3A 4DB2A 2C95A 2ZYWX 1J99A 4A9AA 2DFNA 2MSCB 1E0KA 1TTTA 3K0SA 1NMZA 2VSFA 5HTKA 5AUPB 3KUCA 1HE1C 1GM5A 4K46A 1E79D 3SEAA 4CZ2A 2CK3A 1VPLA 3QKSA 2Z43A 4KFTA 1AKEA 3I61A 2GETA 3GFOA 3W6NA 4IDHA 3PUZA 5GJBA 1IQPA 2QA5A 2XJ9A 1AGRA 2BBTA 3OFND 4Z51A 3V00A 5EE1A 4OHVA 1EFUA 3DO6A 3EZ9A 2DB3A 1T8UA 3QBTA 2ONJA 2F3RA 4Q7KA 5GJVC 5G3ZA 3ICEA 3CW2A 3A1WA 4U5XA 2C77A 1US8B 1YR9A 2X2FA 3P20A 2HJVA 5TV2A 4D4MA 4N1AA 4TYYA 1C9KA 1AIPA 1DE0A 2J9RA 2XB4A 1R0WA 2BMFA 2OAP1 2QRZA 3ZVMA 1RJ9A 5FI1B 4FI3C 1DAKA 2HXSA 3SC3A 1II0A 4BE7B 4JVMA 4Q7JB 1YRAA 3NH9A 2G83A 3TSWA 3GD7A 3GJ3A 3IQWA 2ODWA 4WZBE 3RS2A 2D74A 3O8CA 1GP2A 1XEWX 4LJ7A 3BIFA 1KIMA 3IPYA 2IYQA 3OAAD 4UJ5A 721PA 1HY3A 1P62B 4JVLA 3W90A 4DLZA 2ZVPX 3A4MA 1TU3A 3R20A 4RKEA 1KNQA 3QPWA 4OL0A 2ZUCA 4TMVA 4JMPA 1NL3A 5AJVB 5B30A 2ZE7A 1W4CA 4OI0A 1GTVA 2ZRPA 2GJAA 1LF5A 5J40A 5IK2A 2FG5A 4BLSA 4D81A 2N46A 3MG9A 1TUIA 2YJTD 3V9PA 3PVSA 5A5GA 3KKQA 4NONA 1IM2A 5FI0B 5CYOA 4LJ9A 5JI2E 3GLHA 2GVZC 4F7WA 3A1SA 1JR3A 2R9VA 1QBKC 3HPQA 2HYIC 5JJLA 3L0OA 2UKDA 5KOYA 1WXQA 4PTLA 4TLBA 4B3BA 2QMEA 4MGKR 4UXHA 4PR0A 3EARA 1RVDA 1MR3F 5JBQA 4WZ6A 4GL2A 4Z54A 2QTVB 2QP3A 1EK0A 1BKDR 1M7HA 4AG5A 4IHQA 1KO1A 1YZTA 2G3YA 1E9FA 2OEPA 4MRPA 4L4UA 1NNEA 3VTKA 4Q9IA 4P33A 2Q9CA 1TQ6A 1SVLA 2RGDA 3BWDD 2ZETA 3AF0A 3T1VA 1CRQA 1OH6A 2C78A 3FHCB 1UEIA 1NN3A 1Z3IX 4RVCA 4LV8B 3R8FA 1VHLA 3LW8A 2XNDA 4N3NA 1Z22A 1AS0A 4W5HA 1KI3A 1QG4A 2EVWX 3OFNA 2ZITA 1T4GA 2XGJA 1ZU5A 2CMKA 2QTFA 1XXHA 2OBNA 3B7GA 4KCGA 4BZXA 1FPMA 1XCMA 2O0KA 3PITA 4FW9A 4HUQA 4QOSA 3TQCA 5FUWA 2P65A 5CITA 3GLIE 4M1KA 3C41J 4Q9LA 4EPYA 4L9WA 3SS8A 1N6OA 1XF9A 3TBKA 4RCYA 1VYTA 4IRUB 1XTRA 1U2RA 4B71A 3MWKA 5FBWB 1TNDA 1ZUIA 4OI2A 4X8OA 2OUKA 1R5OA 1KI7A 5EXSA 1N2CE 3AB3A 5SZHB 1G6OA 2FNAA 1UM8A 4D4LA 4D80A 2PH1A 3T12A 4B43A 1E0SA 2FE4A 3AP1A 3LY5A 3W3ZB 5BN5A 1Z83A 1CJTC 2ZRLA 2G0TA 3QPUA 4OQNA 3IO5A 4W5JA 5FH9A 4Q19A 3OAAA 4QG7A 3CIOA 1JXOA 1PLLA 3NTUA 3OIVA 4DT1B 5KNDA 1GL6A 5AJWA 4L15A 1S96A 3ADBA 3CBQA 3K0EA 2X19A 1SXJE 1E0JA 3NBFA 4HZUB 4BLPA 3LLMA 3U3MA 2Z83A 2JLSA 4EQ6B 2WWYA 1A2BA 4Q4JB 5P21A 3LWNA 3K0AA 2R2AA 5KU1A 4D4JA 3P27A 4TWZA 4R9UC 3SYLA 1J70A 1KYIA 1RRFA 5FOVA 1E4YA 1KI6B 3LQQA 4OK5A 1D2MA 4Z1MD 5BWMA 4H1UA 4JLJA 4LUCA 5G3YA 2O8FB 3VKHA 1KY2A 1VHTA 1L8QA 2OG2A 5DHFA 4B3XA 5BQ5A 2QEQA 2V1XA 4QGAA 2FDCA 5CLLA 1DBSA 3K9GA 3VR1A 1PUJA 1TX4B 2FX3A 3EC1A 2QT0A 4TMKA 4HAVA 3IEUA 3LVQE 4NYJQ 4TN1A 4IOMA 4GRAA 3RC8A 3X1ZA 5TDHA 2O8CA 4OHXA 3PUXA 5BN4A 3AP2A 3QPVA 4F4CA 3O8RA 1W7AA 4PO8A 4MKGA 1GKYA 4P4SA 5EE3A 2GXSA 4EAQA 3E70C 1CJUC 1GOTA 4LHZA 1CXZA 2IWRA 1SXJC 5E7MA 1KK3A 3CH5A 3NEYA 3IEVA 2QG6A 1TQ4A 4F38A 2AL7A 5K8UA 1CR1A 2ZJAA 3H4MA 5JS8A 4C2TA 1Z0JA 2Y8EA 3QKRA 3K0FB 5DN6D 4CYMA 4DZZA 4YQFA 3FKQA 3MWJA 2W58A 4XIGS 1P9RA 2VSOA 3NWJA 1IOZA 4A0GA 4P31A 2Q0HA 3B5JA 2JJ2A 4PC2A 1VCNA 2N1BA 3EWSA 4H1VA 4LJ4A 4QGGA 4KBFA 1KGDA 5FPHA 3KQNA 1E2MA 4S2EA 2EFCB 4JJKA 3T34A 3PJRA 3EIQA 3HYTA 4Q4AA 1KAGA 2AD5A 2FF7A 2F6RA 2ERXA 3LQRA 1AQUA 1II9A 3KQUA 4OQMA 3AV0B 4ZV4A 3AVQA 4MH0R 2ZRIA 3KQHA 4UKDA 3ZDQA 1YRBA 4P32A 4HAUA 2H8KA 4R71A 5J4YA 5L3RA 2P67A 2ZQ5A 3KUDA 2XZPA 3BXZA 5G41A 4BFSA 5E4FA 1OFIA 3RS5A 4CT4B 5K8LA 4KFSA 3W9YA 2WVJA 1H8HD 2ZS7A 3OIUA 4Q47A 4CEJB 1HEIA 2WOJA 1XEXA 1J90A 2OLKA 1BH2A 1G4UR 3EZ7A 3WYGA 2MSDB 3HU3A 1KI2A 2EQBA 3LAWA 1ONBA 4TTQA 4ACBA 3U7GA 2QNRA 4ZIRB 2EW1A 1SQ5A 2W00A 2IBMA 1BS1A 3Q7PA 5HE8A 1KJZA 1GNQA 1DELA 1XTIA 521PA 4DSOA 5KPJA 2FMXA 1X86B 5E7JA 5BW8A 2ZSEA 2ZI3A 1XB2A 4JVSB 4ZKDA 3U4QB 2BJVA 5EP2A 4DXAA 2ZR0A 4BFXA 1R8QA 4QBHA 4Y0AA 2IF0A 3QXXA 4IFBA 3ZVLA 2H7VA 1S4QA 1ZNZA 1E2DA 3NIBA 3B9QA 4G5RA 3OIWA 4PHTA 1XTJA 1VKJA 2ZU6A 1WRBA 3RDPA 5AUOB 4JYBA 2ZRNA 3IIJA 1E2PA 4HUTA 1DARA 2ODNA 2IYZA 1N5LA 3QXSA 1UBEA 1KI9A 2IYRA 4OJQA 2PCLA 2CCKA 1DAIA 2YWEA 2F9MA 5JI3E 5DH9A 4IDOA 4KBGA 3RANA 2P5TB 2VPPA 1KHTA 1G5TA 4Y0VA 3AVWA 4GOKA 4JLKA 3BS4A 2GBLA 4MKIA 3OE7D 2WAYA 4I1SA 1B23P 4MITA 2P2LA 4CF7A 4I1UA 3BJIC 3NH6A 3MWLA 2WWGA 2OHFA 3NDBB 2YOFA 4BECA 4DLWA 4LBYA 2GESA 4OYHA 4A6XA 1E9EA 4LWZA 2JJ8A 5DYGA 2IW3A 3RSOA 3UG6A 3BOSA 1ZYUA 1DS6A 3QF7A 1T8TA 3CUEF 4QHTA 4XWOA 3AQ4A 4G5SA 4XWAA 1IXZA 3F0TA 2SHKA 2HCBA 1NBMD 3PG5A 3GLGA 3FB4A 1D2EA 3GLFE 1MO6A 1QZXA 3BFVA 5L3QB 3FMOB 1EFCA 4DSTA 2EU8A 2FSFA 3KKNA 4HDOB 4QNMA 1D9ZA 1IXRC 1W46A 5HCNA 1FMLA 1L7VC 5C1BA 4KYIB 4O2LA 1XJQA 2PMKA 5BYKA 2DYKA 1P3JA 1FOEB 2PBRA 4YMSA 5AJYA 1FNMA 3HP1A 1OFHA 1XCPA 3GFPA 4B34A 4BFYA 3RVBA 1XD9A 4C0BA 2O8DB 4EJSA 1H8HA 1NJGA 2JLZA 3CWQA 1JJVA 2NO1A 3OEHA 1S1CA 1ZM4A 2GAOA 4ZPXA 2VO1A 4PC1A 3ZS9A 4EQ6A 3ZQJA 3FVQA 2XX3A 2ZTSA 4HAXA 4DCUA 1KI6A 1JECA 2ZRGA 4WW0A 1JQLB 1E1RD 2JASA 2V9PA 3B1YA 2XJ4A 3LBNA 3I72A 3U6KA 2O8FA 1WQ1R 2BOVA 2CLDX 2O0HA 3TLXA 4HAZA 4HATA 3E1SA 4IJMA 1EWRA 2ANCA 4TMZA 4CT5A 4M9SA 4UNRA 1A1VA 1FW6A 4MYHA 3L0IB 3AF4A 4ZCIA 1LB1B 4NYJR 1E9AA 5J4KA 4Q1FA 4A8JB 3EWAA 5M04A 4BFVA 4A2QA 5C46F 1MOZA 4M0LA 1C4OA 4IDNA 2HYDA 1NN5A 2BMEA 3F3YA 1G8GA 4Q02A 3AKEA 4QRHA 1Z29A 3SJBA 1OHHD 3UK6A 4Q21A 4DLRA 4YMUA 3B9PA 1T0JB 3WBKA 2RGNA 1FNNA 2AXNA 3N5CA 1KJYA 2H92A 2YHSA 1Z2CA 4XH9B 1UADA 5FBLB 3KJIA 1FX0A 1Q1EA 4A2WA 4FMDB 3VFDA 2IXFA 3T5DA 1JAIA 3QKSB 5IHPA 2QUZA 2O52A 3AVUA 1M7BA 1UJ2A 2GK6A 2JCSA 2ZVQX 1EX6A 5F9FA 4TYQA 4GMXA 2A5GA 1XMJA 4GBMA 3Q5EA 1QHSA 3CX8A 5KDLA 2CLSA 2B92A 3PV0A 3HJNA 5JJKA 3OHMA 1FL9A 2IHYA 3NEJA 4JZKA 1PUIA 1RC8A 1CBUA 3EPJA 2VHJA 2W2TA 3CF0A 1KO8A 2YWHA 4HZIA 1DG1G 4BLRA 1RRGA 2RHDA 3PUVA 5HR5A 1NBMA 3RWOA 3FE2A 5KPDA 1RJ9B 3AVXA 2WKRA 2VP0A 1W36D 1TF7A 1TQ2A 3RRZA 1JNYA 4CDGA 2ZSBA 3E2IA 3DM5A 3RRYA 3CR8A 4OHZA 3AVTA 5DLQC 2EWVA 1GFIA 1WE2A 1FUUA 1UBCA 4MGIR 4B48A 1COWA 3A1UA 4I81A 3FHTA 5J4LA 2C9YA 3PR1A 4PPGA 1ESNA 4YMVA 3SE0A 4XTRA 1IY1A 1WBBA 2C03A 2ZSFA 5DISB 4S35A 1GRRA 4LJ5A 4D4KA 2IS1A 2X77A 4ZDWA 2RAPA 2V1UA 2GJ9A 5JRZA 5CM8B 2ODBA 3WXMA 1T3LA 3A6PC 4RZ2A 2Z5FA 3VX4A 2YZ2A 5FOXA 2JLUA 1NVVQ 1UDXA 221PA 3AUXA 4KODA 3BH6A 5CDFA 4DLYA 2VEDA 2VIIA 1CR4A 4DHEA 3EZ6A 1WMSA 4MQBA 3B1WA 1RRPA 3BORA 4TQ9A 2ZSAA 4OK3A 3M0EA 4EPWA 4DB4A 3U4QA 2IX3A 3GJXC 3ZYCA 3B82A 1T3HA 4URYR 3EASA 2GCPA 4KXFB 3VHXA 4AYWA 2QM7A 3BFKA 1RPZA 1OT3A 3GLHB 1DAEA 4LJ6A 3UPUA 4RD0A 4LRWA 4HAWA 5JECA 2QPTA 1Z0KA 3IHLA 3TJZA 2G88A 2N42A 1TEVA 2H18A 3SJZA 4KYUA 3DZ8A 3RAPR 3BERA 4LYJA 5EQTA 3UWKA 2FFAA 2PMDA 2RCNA 3C7KA 1AGPA 3D7MA 1OHHA 3I32A 1GL9B 1VDZA 2QTHA 3TMKA 1OYWA 4X8MA 4Z8XA 2ZRJA 4DUGD 3MWYW 3EW9A 4Q1CA 3KQKA 4C9BA 3UWOA 821PA 2GK7A 4TYWA 4EDHA 1PLJA 1XBTA 1IONA 4JYCA 2BCGY 2WIAA 5H68A 5A4JA 4QBIA 1A7JA
chains in the Genus database with same CATH superfamily
4EPXA 4B93A 1C30A 4DJ3A 4QL3A 1E3JA 5BV0A 3SXUB 3WA6A 3VPGA 1ZD2P 3WB0A 1XVUA 1RLMA 1ICIA 4ZVSA 4P3KA 3OHSX 3DAPA 1QOPB 1UPCA 4GHIA 2VL7A 3B1VA 3LY4A 4X8HA 3T12B 4XIYA 2MSNA 1KZ6A 2QMHA 3JWEA 3O5AA 3LHFA 1YA4A 5CBKA 4HQKA 1P1JA 5CCDA 1V4BA 2QN1A 1YQEA 5DTQA 3HN6A 2IHNA 3CVUA 1ZVQA 3JQ7A 4L4ZA 4GNRA 5LHDA 2MR5A 1CY8A 1WPGA 2PA0A 2E21A 4KN8A 2EP8A 2VGKA 1UDBA 1PIOA 4US1R 1PJTA 3H7WA 3FE3A 1USWA 1TIPA 3THXB 3J7AS 2O8EA 4Q4AB 1WAMA 3WLHA 5F1GA 1U98A 5DFXA 5KYUB 1BA3A 4ASUA 2IPXA 1VCOA 1MC4A 3K0CC 3P2MA 2OV2A 2J3TC 1NTRA 3KPYA 1NKTA 2W0SA 3DWKA 3HJBA 2YMPA 3U1TA 1MX9A 1P8JA 2JI4A 3AF2A 5FSRA 1WXGA 3N6IA 2P6UA 4AK1A 4HLUC 4AJJA 1JHRA 1I30A 1L2CA 2WAFA 3W8DA 4X95A 3MJ4A 1DO2A 2L0XA 5AR1A 1I6KA 3AOEC 3OPPA 3IDSA 3GLTA 1O7JA 3TDNA 3ABRB 3F5MA 4LF9M 3KQVA 1P0IA 4AROA 5JH7A 2X1MA 1DQRA 3IS2B 5DXJA 5JAQA 4RS4A 4PSUA 4NZNA 2NUTA 2FSGA 2KZSA 2PCJA 1MAWA 3N74A 3OQIB 2QF7A 3IPCA 3BYDA 2A58A 4CHGA 2QBYA 3B34A 5JBNA 1WDTA 1C9DB 3CRW1 5LQRA 1B15A 4V0SA 4DDUA 3Q3HA 1WCIA 2XUDA 1EFRD 4MLCA 5BUQA 5LOVA 5IASA 2JNWA 3DEIA 5K0TA 2AMVA 3F5QA 4MUAA 2OCBA 1E9VA 2JN7A 1ZJ6A 2PLRA 1MW8X 5B64A 2XCIA 3CISA 3D5QA 4D3ZA 2PQ2A 3FMVA 2YZMA 4HBTA 1NFRA 3GBSA 1NSTA 2P1ZA 2O9BA 3DAHA 1CFJA 4L07A 2NOAA 4D3XA 2C4WA 1B43A 3VHLB 2VTBB 3R5FA 4FS8A 1LJLA 1Q0UA 2I6TA 2H51A 2ISCA 3KFLA 1M1YB 3OPVA 3RIYA 1UBLS 1LLBA 1LPAB 4IFTA 3SAVA 4QB8A 2FE1A 2EW8A 2DJIA 3IMEA 3M6HA 3PRYA 5K09A 1ACFA 1I6WA 3T3PB 2F43B 4RVOA 2CBZA 1RI5A 2BSAA 1CLEA 3OOJA 4HGOA 4NQZA 4NECA 3V3KA 3WKBA 1I7SB 3N2EA 2NV6A 4WNYA 2YTZA 3CUWA 2BZGA 1FYXA 1XFAA 3GDOA 3LQKA 2ZWIA 1YAXA 5EC8A 4CLCE 2DBRA 4KWHA 1CS0B 1QHHA 1UDCA 1D2GA 2G4VA 1IHDA 5EWMA 5GINE 1G28A 5A3VA 1V3UA 4OVDA 1V3VA 4HL6A 2Z6DA 2DHCA 2JUJA 1W5TA 4WDRA 4TSKA 3NMUF 1RWKA 4W1QA 2XQJA 4E14A 2M7UA 3NHQA 1D2HA 1AGXA 3HR4A 3PD7A 4GC5A 1ECCA 3K9QO 3DE2X 1NW4A 1C2YA 3OH8A 3L41A 5HD3A 3W05A 3PPIA 4I1IA 4YUZA 2H2AA 4KO3S 5LZ2A 2PSHA 1VB6A 1NAIA 4WASA 2O9AA 3KLOA 4DJAA 3H5LA 4AJLA 3QF4A 1L7PA 1G20E 4B5KA 1QIEA 2UVPB 3C7UA 1RTKA 2CNDA 2BFMA 4QXAA 5LWDE 3MNFA 1S1YA 2W8BA 3IBCA 2OBYA 4AB1A 3N39C 2VJYA 1R1DA 4P7KA 3N05A 3C6ZA 4HY3A 3TM5A 3WYAA 3IH8A 1XN4A 2TMGA 3VR4A 2FW0A 1ZG6A 3BGWA 3RUPA 1Y8AA 3CGGA 2JGFA 4YR7A 4TUWA 2KJQA 5L3SA 3ZE1B 1KJJA 1SKOA 1LC3A 1M8GA 3HJGA 3JQQA 4Q6WA 1GDHA 1R3DA 1X2BA 5D3ZA 5A4DA 5JFOA 3A9VA 4UBKA 4M7RA 1X9GA 3B7RL 1DOZA 1Y3FE 1K0UA 4ALIA 4D9JA 2EZTA 4D9MA 2DFDA 4DLTA 3GPDG 4GFDA 3DO5A 3K4HA 3GJ5A 4E5YA 3IJEB 2X8AA 3UXMA 4R31A 3QKIA 1GPKA 3BC1A 4G4GA 2WWTA 1GPUA 3DW1X 2RMKA 4K87A 2VJWA 3FPBA 2LPMA 4FYXA 4B7UA 1NZDA 3W9UA 1IIBA 4U00A 1DXQA 5BNWA 1TEXA 1UZNA 3B9BA 2XMCA 4QJ4A 1JSZA 4PTYA 5DF9A 1OF1A 3OECA 3U3XA 4OGKA 1RKXA 3KB8A 1EK1A 2DAPA 3P1JA 3SFTA 3GRRA 1KBZA 4RK1A 5BN1A 2OV6A 2YY5A 3ECSA 3W5BA 5CTMA 1UKZA 2PJRA 1T5DX 4J16A 3VKUA 3R44A 2GVDC 1BD4A 2IKQA 2ZBPA 1SCBA 3SZ3A 1VSTA 4EW7A 1CVLA 3CUEC 3D3WA 2VJQA 2R5NA 4C3ZA 2LHCA 4IW3B 1LDMA 5JS6A 4KMOA 1FQOA 1E2UA 4TTIA 1QNFA 1C7EA 3DO8A 1MXFA 4AJOA 5DNCA 2HF9A 1PI5A 1G6AA 1P7CA 2FW7A 3IQGX 1UK8A 2GEJA 3UB5P 1IFYA 1GQQA 3H04A 2I7TA 1QVRA 1U0OC 3WMRA 2QKYA 4PF1A 2AOTA 3ZYZA 3DMGA 4XBOA 1BFUA 5HAQA 3IVAA 3G30A 3D81A 1PQYA 2OLJA 4ODIA 2YW2A 3ANNA 3Q12A 2O3RA 2UZ3A 1PHRA 4POOA 1Z8DA 2XNDD 4KXXA 4EU0A 1LLQA 1PS9A 5DJTA 3E9QA 4F5DA 3AINA 2PTGA 2DMRA 2Y21A 4EHDA 4IEDA 3IODA 3EY4A 2BPOA 2WIGA 4YJGA 3ZCTA 2E4XA 5CTJA 1HTBA 4UMFA 1KEWA 4EI9A 1HQCA 2Z98A 3LFHA 3CMZA 2F67A 5CA0F 3E0XA 1K8QA 1O87A 4F6RB 1XD2A 1YONA 2DFPA 2PUBA 1YJBA 2INWA 1LWOA 4O63O 1MN3A 4HWGA 2P0YA 3GLIB 4EVIA 1NONA 3PWSA 1RADA 4IUBS 1AQYA 1LNCE 3JYHA 3TOCA 5L10A 1QGUA 3AERA 3OZFA 2FSIA 1TPZA 4A4DA 4A7PA 3DV9A 1RP1A 1JA1A 2OE2A 1QRSA 3GW8A 5I7UA 2WSLA 3T74A 1KDZA 3RC3A 5HK9A 3HFRA 4C75A 5JAHA 2Q27A 4R1UA 2J0EA 4N9KA 4M37A 3F2VA 5JC1A 1YRYE 1V2GA 1W29A 4IBCA 5CUQA 5L3VA 1NW9B 4D5GA 1ND5A 5GAJA 4F4FA 1JR4A 3UANA 1Q0PA 2VQ6A 1P77A 2ZFUA 2BGWA 3RVSA 4YXWD 4EYSA 3TEMA 2CDAA 3ZBQA 2AXPA 1BWPA 3PNYA 1Z13A 5YASA 2ODAA 4IUYA 3Q7IA 4GHAA 2Z1DA 3GMTA 2ZYTX 4Y9RA 1R50A 4IDPA 5EG5A 4ZVNA 5JRDS 3ABQB 1AHHA 2PYZA 5CA0B 2OFOA 3DZFA 4OU7A 4BRWA 4MS6A 4CKZA 2I2CA 1DTWA 4PYKA 1V47A 1WA5A 1EQAA 2HHAA 1GEGA 3QUQA 4KXNA 4E07A 2JK0A 2FLVA 3IE1A 3MRXA 2XDAA 1SU6A 3CJTA 4F5EA 5TR7A 2FR8C 1XJ5A 4RQBA 4U3TA 3HU1A 2FQQA 1M2KA 4XCQA 2WIBA 1Z6PA 3CCCA 1E7QA 4EJ6A 3E22B 1L5KA 1EDZA 5EJAA 4V39A 4BMSA 4UA7A 4JR1A 4FMDF 4S1TA 1Z25A 4YXWA 4Q9DA 5HQJA 1ECGA 1F38A 4CM4B 5LQDA 3T1HM 2HKJA 3IQXA 3L3BA 2R60A 3N76A 2W0MA 2NVBA 4IXDA 4PFSA 5EGNA 3D7KA 3K1JA 3SR0A 2O0MA 3OFJA 1XFNA 4NBVA 3L8HA 5CDFE 4AP6A 1K88A 4UE6A 5SYNA 1A5BB 1S8FA 4A26A 1T43A 2DGDA 1XJWA 3ILVA 2RGRA 3EF3A 3GV0A 1T3GA 4LEIA 1T9HA 3FF4A 3ZI0A 1W5DA 3TLZA 2QXTA 1ZCBA 5FO0A 3VDRA 4FSXA 3SS7X 4WKOA 5C7YA 3UK1A 1C1KA 1F6BA 4RZ3A 4Q24A 2LE0A 4XW2A 1TU4A 2ZVDA 3PA6A 3QPDA 1DKNA 3ENKA 4EW1A 1U1FA 1NNUA 3HE3A 2WWVD 4OP3A 3LYAA 5I3CA 4KZ8A 3W06A 1MA3A 2XB9A 1I6MA 3IQEA 3E3OA 4BZQA 3QX3A 3D2AA 5A2QA 4B80A 1DMSA 3OQBA 2X3UA 1DAGA 4KO1S 3LXXA 1P2UA 3WLJA 5IJZA 4RK5A 3ZJTA 1UC4B 2J59A 4E5MA 1JTEA 2FK8A 1P1FA 3R5KA 5AOAA 1M0TA 2WRZA 5A0FA 3W79A 4ER3A 2FCRA 3LUDA 3D9YA 1VDDA 3PUYA 3H2IA 4O5AA 4MK4A 1DC5A 1DWOA 4NMMA 2JHPA 4PAOA 5K6AA 4F3LA 1IJBA 4UHHA 4U9HS 1E2NA 3IVXA 3O92A 1W47A 3DTNA 3EVZA 5LUBA 3EEYA 3U80A 1OBOA 1CP2A 4E6XA 2I2WA 3FUKA 4O0PA 2XKBA 4EJFA 3E98A 5EIBD 1D3AA 4FN4A 4UEWA 1W4AA 4H4DA 3VA7A 4MHSA 2W37A 2P27A 2FEAA 3M1AA 4Y3IA 1WSDA 3K53A 3EGCA 4WNIA 1A3CA 2Z2MB 1G5PA 1VPWA 5CM2Z 1QQ7A 3I83A 2C5FA 2ZWAA 3AEUA 4HYQA 1UDWA 5JEEA 1P4JA 1XRNA 4AZFA 2P11A 3KOZA 3HCDA 2WC1A 2B4AA 1HT3A 1Z5VA 3BK7A 3W5IA 2VC2B 3IIMA 1NN1A 1RWVA 1RRCA 2R59A 3MRTA 5A03A 1N6LA 2QUKA 3CT6A 4XEHA 2Q07A 3MT7A 2RC6A 4II2A 2Q6VA 4UTVA 2GF9A 1HL7A 5DM70 1LJUA 3KCQA 3D7LA 1Z36A 3VDQA 4XYLA 2JAWA 4LHXA 2TMKA 1DC3A 1WHTB 4RCZA 4QD4A 2JZOA 4CHTA 3IIKA 2M98A 3COVA 2QYTA 3ET5A 1JU4A 4GXTA 1KKUA 3GFRA 4BBUA 4MVJF 1SCWA 3WBFA 2WFLA 4M88A 4RACA 3UDXA 4JT4A 1JR3D 2HWXA 3GJ7A 3E9YA 1YKFA 3CLOA 5FJJA 3QW4B 3FI9A 3AR5A 3PE4A 3G2MA 4FONA 4HVTA 3HUOA 3U7IA 2XMGA 1TTTA 4MQ5A 1LEHA 5J9FA 3F92A 1NVEA 1UWPX 3EP3B 4KFTA 1AKEA 4BU1A 3GFOA 1OZGA 2QA5A 3C43A 4F72A 4P0PB 3TNJA 1ECLA 5A71A 1R27A 3ZQ4A 4Q7KA 3ICEA 3P9YA 1JIJA 1FIUA 5D84A 1WCXA 2J9RA 4WMLA 2PU7A 2GB4A 2BFDB 3GJ3A 5BR7A 3J7AC 4EMUA 1JQDA 2UXCM 1XEWX 3UGKA 2QRJA 2UUCB 2DRIA 3RGSA 4LXTA 4JVLA 4MQMA 1QYXA 2JHAA 1KR2A 2ZUCA 1K8XB 1DJMA 5IBPA 3IIIA 1IDOA 2WF6A 2WZBA 4RHTA 3ROKA 1FJVA 4LF5M 4YCMA 2NVUA 1U7DA 1X2EA 1N2JA 1JR3A 1QBKC 2NV2B 2WFMA 1RLOA 4XMXA 4TLBA 3TLYA 1H6BA 1RVDA 3I9FA 3KVRA 1BKDR 4FH2A 1NRWA 2HO5A 2RGDA 3BWDD 1SQ0A 1M40A 3FHCB 1Z3IX 2P0AA 5ITYA 2H7CA 2IOYA 2HRBA 3RC9A 4DR4B 1KI3A 4XLZA 1AN9A 2WQZA 2ZITA 2G82A 2OBNA 4NWIA 2I3DA 3MS3A 3KSZO 1MEEA 4PYOA 3SS8A 4R01A 1U65A 3O1JC 1P1HA 1UM8A 4BGVA 4D80A 4YRTA 4B43A 3LY5A 5THQA 3DG9A 4WBGA 4Z4HA 1XZ8A 1MH9A 3LHSA 5EUBA 4NAUA 4N40A 2CUZA 2R6R1 2FPIA 1WDLA 2JLSA 4EQ6B 3H0VB 3SXPA 4X1LA 1NW3A 4ML3A 1D2MA 4Z1MD 5JT9E 1VHTA 3CI6A 4NE9A 5BQ5A 5A5VA 1CZOA 1DBSA 1MIOB 5DNUA 4BMDA 1BDJA 1E6MA 3IEUA 1QQBA 2GGSA 1YB5A 5EVJA 2O8CA 5AKGA 2NYAA 4RPGA 5FD8A 4DZZA 2IXDA 3JQGB 2WI0A 3QOXA 4P58A 1CIJA 2EV9A 1OBFO 3FUJA 3TNDA 3UTCA 1E7SA 1T34A 5H9WA 1NASA 2JEYA 4DGQA 4PAGA 1NZFA 5T57A 3S4YA 4P1ZA 3WDKA 1EW0A 2Y4AA 4H4EA 4B82A 2IDZA 4MV0A 2ACVA 3R9KA 4O4LA 3HU3A 2PHZA 5HA5A 2QRKA 3ENQA 3ZWOA 1Y3CE 1I2WA 4KKXB 1A69A 3TZHA 2ONZA 3HO1A 3ZU3A 5K4HA 4DXAA 2PBYA 1GN9A 4NOJA 4PCAA 4ZT4A 4G5RA 2ZRNA 2GKGA 1OZAA 2WUEA 5LQAA 2ZC3B 4RMIA 2PCLA 1XMQM 4KZKA 2ZTHA 1K92A 1GV0A 2C9ZA 5J58A 2B2XA 3QE9Y 1DXHA 2YH2A 1VKZA 2BEVA 2GOYA 1JFLA 3R09A 3ACDA 4LTMA 1L1EA 1Q7TA 3F4BA 2H5JA 3MXOA 4JROA 3TRHA 3UOAB 1H4TA 4RELA 1ORYB 5H0IA 4CQJA 1ZGHA 3KJQA 4R0MA 4DRXA 4YV0A 5I8ZA 2XFSA 2R25B 5AJYA 4WL9A 3BAZA 3TVYA 3RUAA 1JJVA 1S1CA 2YJ5A 2P2ZA 2GAFA 1VL5A 1O0BA 2XTAA 2EZ9A 3NKFA 1XZDA 4PZ9A 3L6UA 4HATA 5IKMA 5EIHA 1RWMA 4M9SA 3M83A 3BE8A 3ROMA 2GZRA 5ESRA 4B4VA 5SV2A 3RYIB 2X4AA 4A8JB 4B6QA 1K6IA 3BCRA 2R4UA 3INYA 4A0QA 2RGNA 3SASA 1FNNA 1KJYA 1JDNA 1JAXA 2IXFA 1SG6A 2KRKA 2IPLA 2IHTA 4EBBA 4KVFA 2OGUA 1P7VA 3OLVA 5EJ5A 2CD9A 3FCEA 1L9KA 3OHMA 3OU6A 4WZAA 1YOVB 2B6NA 4DXCA 5EVEA 1HNNA 3RWOA 1H4SA 1FMCA 3SX4A 1IM8A 3K6SB 2V2FF 2AGVA 4G84A 1YWGO 1UBCA 2RGOA 4BC0A 5E7QA 1ESNA 1UKCA 1CDZA 1D0VA 2C03A 2HF6A 3ZKWA 3TDMA 2BFOA 4FNAA 2K47A 3E23A 2Z5FA 3FPEA 5FOXA 3VU1A 5IDYA 1RRKA 1DWUA 3CURA 4D56A 2CUNA 4XX0B 1TUBA 3HKCA 3I76A 5HHTA 2I6SA 4RD0A 5KHAA 1Z0KA 2I1WA 4ROSA 1XZLA 2WJWA 2ZRQA 1UCFA 1ETHA 4MLDA 4OFXA 3UWKA 4HN9A 2FQXA 3KCNA 5HF9A 2V8FA 5HDDA 4D3DA 3UWOA 3KSJA 1QHFA 4QXRA 3F1PA 3A3FA 4DLXA 3ZR4B 3DLIA 1QF6A 5JS3E 5B3JC 4BNJA 1XNGA 5HFAA 2PV0A 4OHWA 5BUCA 2TYSB 2C4UA 3T4UA 1GTSA 4EDFA 2VDLB 1ZU4A 2C57A 5HSGA 4MGKE 2NO6A 2NUPB 4UAGA 4X71A 2W3HA 1S2DA 5AW4A 4M55A 5AQEA 4FXPA 3WG9A 2E85A 4GMDA 1AGYA 2HDSA 2XRNA 1OVGA 3FPHA 3ZW8A 3SC2B 3MK6A 4N7RA 1RKQA 5BQPA 4L4YA 5IDQA 5CFQA 4ESPA 4M8KA 5U9CA 3ZEIA 1JHVA 1JXMA 4WKPA 2NQ8A 2WYUA 4RD6A 5AI9A 3RIXA 2Z3XA 1B41A 1SHZA 4M0CA 2JF0A 3NOOA 4UTRA 3CKYA 5KSOA 4LNHA 2IYXA 3PE3A 3NYQA 2JDID 4HYTA 1MT0A 1CUAA 1WVGA 3KQMA 1X7GA 2JRLA 2GR9A 3AVVA 3MBOA 1X87A 4UAAA 2OFXA 2R9XA 1CE8B 3GA7A 3OOSA 4GRDA 1ONGA 4CMBA 4FM9A 4JQYA 5A3YA 2OO9A 3INNA 3RF6A 2QRGA 1SVNA 4BNXA 5DEOA 1VKNA 4JGPA 1V6SA 1BVYF 2P2NA 4YT2A 1JG7A 1OGJA 2B1QA 4EGJA 4GM1A 1FVHA 2WYOA 1G68A 5DDIP 3PU6A 4QQNA 4L22A 2Y2NA 1QE3A 3VH1A 4A27A 3P9RA 5IAGA 2PUEA 2C5SA 1YE3A 3M6LA 3JAKA 1G41A 1K55C 4W8GA 3WISA 4JGRA 2BR4A 3AEQB 5JZSA 3OCNA 4WFQA 1UXJA 1EE9A 2SCUB 3PRHA 1DV2A 4Z4EA 3TUZC 4LRSA 2BUCA 2QE7D 1JIUA 1QPBA 2XFTA 4KQGA 1N6IA 3E15A 2FJUA 3WGHA 2PV7A 1FRVA 5DM2A 4E22A 5ITXA 4RDXA 5HWWA 4W9MC 2PQMA 2LCIA 2N0SA 3U0BA 3F9IA 2XDMA 5FLXS 3CB2A 3E9MA 2AG5A 4NPAA 3T1YB 5KOHB 2CD7A 4NMXB 1BT5A 1YI8A 1MWUA 1BVRA 1SCKA 2VZEA 2XQVA 2W2PA 3KQTA 3L1KA 3QBJA 2XK1A 4AJ1A 3MMHA 3UYKA 4D8XA 5HIJA 3U60B 1PJBA 2Z8YM 2QT1A 2ZM0A 3PGA1 1EXNA 2XR1A 2ZUEA 1G4HA 2J3HA 2J08A 1AK1A 4S2UA 1ZIXA 1LI4A 1ESIA 3K94A 2W4QA 5JR3A 3S29A 4EG7A 1PS0A 4AF6A 5I9IA 1UBOS 4A03A 1G0NA 1OSNA 3NBXX 3FOBA 1WTCA 2QE7A 4RLSA 2HUPA 4BNTA 4P5DA 3SY8A 1QYIA 3WSTA 1P0MA 5CEBA 1ZI6A 4KVAA 3HCNA 3GPYA 4FHGA 5F52A 4B40A 1U3DA 2NO9A 2QL6A 4L7VA 2O54A 1MA0A 1L5RA 2BGKA 3JV7A 4DRZA 1SKYB 4D6YA 4JT8A 1G8PA 2M1CA 4XNBA 4FP9A 2VFAA 1XJCA 1I80A 3NIAA 1I94B 1FDTA 1I1HA 3QVVA 3LNTA 5AJHA 3O9MA 2F62A 3ONDA 2W4IA 1RXCA 1JFSA 1LK5A 4EUKA 2BEUB 4JUDX 2OHIA 1BEZA 4DVGA 1RQ7A 2DF8A 1UZMA 4J7AA 1ZINA 2DH6A 3B7PA 2XH9A 4KUEA 3D4OA 3FG9A 4DL9A 2E6KA 1QV9A 5LXTA 3GUYA 4KQ6A 3G9XA 1K7YA 4UHCA 4RTOA 1XX6A 2D2FA 4M22A 4RNCA 5IH7A 5KEIA 3ZIUA 2BI4A 1DX6A 5H70A 4PX5A 4BUZA 3OLZA 4E03A 3AIOA 4TX1A 1QIKA 4YJFB 3FKWA 621PA 3I39X 3CZ5A 4MUXA 2J9PA 2CRUA 2KNZA 4BENA 1NI4B 5TS3A 5F2NA 3F4LA 2Y2LA 1L3BA 3N8KA 4N7JA 1VYUA 3G02A 3D2BA 3W04A 3MKFA 3JY6A 4ROTA 5HKKD 2Y2QA 1Y6RA 2YXNA 3OEED 2PA3A 4ZMSA 1MX1A 1YCFA 3LICA 1W1UA 2JD1A 3UFXA 3U9SA 5ERXA 3JD1A 1EZMA 4RF5A 2A86A 1QZUA 1ZL2A 2I4NA 2NZYA 2IXAA 1PCXA 2X7JA 5F33A 1E77A 1FU7A 3OE7A 3P9XA 5T5QA 1W5SA 1ABFA 1HNZM 1LK0A 3KDSE 4NOMA 4ZYZA 4BVLA 4V0LA 3AUSA 3OCVA 1OJ5A 5IVDA 4FJ1A 1FUEA 2CV0A 4GQAA 3V33A 2KX6A 4QUJA 3V8BA 4C76A 1N2OA 1EWTA 3FCCA 1KFVA 2WAEA 3U3KA 4BD0A 3L92A 4PKYA 2JLVA 4I50F 4S2KA 1HLUP 4RVNA 5HKKA 3PLRA 4A8JC 1DKMA 4GE0A 2YJNA 4LF6B 2XR0A 4KNYA 2RAVA 3P9ZA 4Z5XA 1QV7A 4TKZA 5DRYA 3UV6A 1E2KA 4J1NA 3B70A 4U2DA 1H5UA 5FWXA 1H2FA 1X15A 4G4NA 1ZJWA 4KQKA 1TF2A 1GVNB 3TI7A 1EIJA 4GCZA 1EJ2A 1HORA 1EWYA 1N33B 1TZCA 3AM3A 1MV5A 4ANFA 3FTQA 4UOZA 1E98A 1TLFA 1SCUB 5AO9A 1Z0ZA 1LS1A 3G0BA 2L17A 1ST2A 1JEYA 3FRJA 4DCJA 1XNJA 5AVYA 4YMTA 5JVDB 4TT8A 3L06A 3QEMA 4B3SB 5MN5A 2R6CA 1EX7A 4DYVA 5EP1A 3RRMA 3AW8A 1GTL1 3L29A 3K9CA 3H11B 3WB1A 4Q4HB 1NT2A 3F8WA 4X93A 4HSEA 4CVNA 2FLKA 2IIVA 2HRCA 1XQXA 3W5HA 4HGRA 2WADA 4P4NA 2F5QA 4XUXA 3WGMA 4V03A 2B4YA 1YVUA 3SAWA 3ETNA 4HAOA 1X7XA 1AD2A 3L5OA 4OW3A 4F3RA 3Q2OA 2ZWVA 1GJRA 2DQ4A 2HL6A 4IIEA 4WYYA 2WYWA 2I3GA 2R8RA 1VSVA 4Q18A 2NUPC 1F51E 1XTTA 4CDNA 3WP0A 4MIKA 3DQZA 4JDUA 3DBHA 2EFEB 5KIZA 4JENA 3LXRA 4LY9A 2E7ZA 1ESMA 1B8PA 1Q3TA 1J2JA 3NIFB 4NYIQ 1IUNA 4FHDA 4B2LA 1N6NA 3VSBA 2I4TA 1L4BA 2NYUA 1OREA 3GUCA 1E1QA 3NU1A 4JK3A 3P5SA 1G3QA 1BGWA 1QIGA 4XLLA 3AV3A 1HF3A 1Z2OX 5HWVA 3C6BA 3LXMA 2OD9A 2XQIA 3L9XA 3EBHA 1HOXA 3TMYA 1TRHA 5CFPA 1EHCA 3ZHCA 2FZ4A 3T1XA 3FA2A 5GMOA 4ZC1A 1QJCA 3ZDXB 3UJ9A 3LV8A 3P09A 4U5QA 1JB1A 4OB6A 4BMWA 1O9GA 2HV8A 1IN1A 2YFKA 5TEWA 1GYRA 4BWVA 3K15A 1XZPA 1X8JA 2WPNA 3IKLA 4JHXA 5F2KA 3U3JA 4B3JA 1KOLA 4LQLA 1J7JA 5EMKA 3NHMA 3HUUA 1NY5A 1I8TA 1I24A 3QJGA 4L6AA 1E2JA 3LBHA 4YQZA 1TIKA 3HN7A 3Q5DA 5EVIB 2CSUA 3ZX5A 1YZGA 5I7RA 2YHAA 3MF0A 3ROZA 4L9RA 3GFVA 2QL5A 1DCTA 2ABWA 1RMYA 1S2IA 5AW3A 4KX9A 2VPTA 1BYUA 2AOXA 2FH5A 2ZR7A 1YVEI 4B3HA 4MS3A 1VMEA 2ZMAA 2NAPA 1E9CA 5JXNE 4TWRA 3ZG5A 4C6TA 3T5BA 1JI3A 3PQDA 4Q4LA 2CVPA 2YOHA 1KU0A 1QUFA 4OP1A 5IT0A 5K05A 3QNUA 3C4QA 2O0LA 4HB4A 1XGJA 4GPD1 2NYVA 5GIPE 2EF1A 2X9GA 3I4YA 4HQAA 3SJAA 5EEGA 4MIYA 3EPKA 3FUIA 1ESCA 3HRHA 3AHIA 5J47A 1M5RA 4E08A 2QJWA 2DM6A 3OQJA 1G3IA 1U1CA 4ID3A 3C0KA 4DV5B 1SUCA 2CNNA 2ZXFA 1XRQA 3IE0A 5CURA 1KDYA 4M9ZA 3ENZA 4OQIA 3PX3A 3U0VA 3AT1A 2HSJA 2W2XA 3ZHZA 1W49A 3PB3A 2PQ0A 4CEIB 2EFGA 3QE0A 4FK8A 2A9RA 3Q3GE 1NMXA 2W93A 7AT1A 1F4LA 3HV2A 1LNFE 1SN7A 4D4HA 5BN3A 2ECPA 1AE1A 3Q40A 4DC9A 3FPGA 1YZQA 4KUOA 1G5RA 4WCDA 2C7OA 1R4AA 3UAGA 2QL7A 3ZC3A 2PUFA 3ZNYA 3THYB 3U7HB 4ZX3A 2R00A 3FNBA 5MHTA 3O1HB 2QRNA 3PC8A 1ZFNA 3KPWA 1Y3AA 2JEOA 2NO0A 1C7ZA 3GG9A 2AK3A 2Y8HA 4URXR 1U81A 2XCUA 3N7TA 3VK8A 2J41A 2OLEA 5TGTA 1KJIA 4F8JA 3JQEA 1Z4IA 2FCAA 1RR6A 4WELA 4DRYA 5IPFA 4EUVA 1KA9H 4WXRA 3B2PA 4KIJA 3IXQA 1KKMA 2FQWA 4JLNA 1NP6A 2ZAOA 4AO8A 6REQA 1XU9A 3KPVA 4LYYA 2G9QA 2C8KA 4AWBA 3WLAA 3GRPA 4IL5A 4WUJA 4JLPA 1U4SA 3LMKA 4G1FA 4AKEA 1HYQA 1TDZA 1MO5A 1IBKB 2J85A 4Q66C 1SUWA 3GBPA 3A6FA 4ENTA 3UXYA 3P0RA 2EWWA 3AETA 2ZSUA 4HLDA 4B1FA 1DRMA 1C7QA 3OC6A 5JARA 3I53A 3PQ6A 3V42A 1X37A 1Q57A 1XHBA 4YRKA 4MLLA 4JBYA 2JHEA 4R2KA 4CG0A 1E1YA 4AJ9A 4O59O 2JVIA 1XJ0A 3RUEA 1GT91 1YR6A 4FNMA 1FMTA 3BIJA 2P7IA 3CB4A 1U94A 3IFSA 4AQDA 1HETA 1QB7A 3AI2A 3GQVA 4UHUA 4PO3X 1KBOA 4AZ3A 4UMVA 3P4YA 5I9SA 2VUIB 2JHFA 1NUSA 4FUTA 2Q0QA 1J23A 3E1GA 1E2BA 1VMKA 4XO3A 1L4HA 1FR6A 1NATA 1N4AA 4HUQB 2PUJA 4CEHA 1GPLA 2E3JA 4KKVA 5E9AA 1PF7E 3E61A 2HIAA 1KDPA 3OF3A 1SZPA 1C29B 3WJ1A 2F17A 4ASUD 4L0QA 1YLPA 3A14A 1S2LA 4MA5A 1XZBA 1BZYA 4Y3UA 5KYXA 3HZOA 3UTDA 1OXBB 4PW0A 3M70A 3B2EA 2XTNA 3ADKA 5KTMA 1K5HA 3R1IA 3BMNB 3KKOA 1AA9A 4ZJ2A 4TMFA 3DZ5B 2Q2NA 3OTOM 1C0PA 1WMFA 4MVJP 1V9CA 1L5WA 4CV1A 3LYLA 1U80A 2JKYA 2PGAA 1P3Y1 1NMZA 4LCMA 4XVCA 3HSYA 2K4MA 1VPLA 3W6NA 1BE6A 1ZITA 3C8ZA 4YRGA 2XT6A 4QYTA 4D6XA 2ONJA 3VE4A 3P20A 5FHQA 2C2WA 4N1AA 1AIPA 4JU8A 2GPJA 3E4QA 1RJ9A 4MWBA 1ZN7A 3GRAA 1JBQA 3E7XA 4DA4A 2QN8A 4I4TA 4C4XA 5K3SA 1UJ6A 3KC2A 1TKRA 4JNKA 5BMVA 1GP2A 4ZA2A 3OBIA 4BX3A 1C0IA 2X5KO 1XUOA 2X22A 2LVBA 3QELB 3L7IA 4ENQA 3BDAA 2AXQA 3TDKA 4YJ3B 3V4PB 2WM8A 3QLJA 2GJAA 2MH8A 1PGOA 4BLSA 3D72A 3MG9A 3GLRA 4YP9A 4X63A 5TFQA 1R6XA 5FI0B 5CYOA 5JI2E 4MQFA 2HYIC 5KOYA 4KNVA 4UDXX 4F4DA 3U4MA 3T3IA 2AQKA 4OXQA 3HUDA 1ZSVA 3N53A 1MQAA 3JQ8A 1RD4A 2BFNA 4JYAB 5CJJA 4W5HA 2P9FA 3B7GA 1JUDA 3K6KA 2PXXA 2BTFP 4J29A 1PEAA 1AT1A 1T36A 3N2ZB 1G6OA 3J27B 2ZTLA 3DEJA 3KSUA 4E12A 3HDGA 2NU8B 4GLOA 2V3WA 5A1JA 4AS1A 4FDUA 5K6RA 1L8AA 5P21A 2C7VA 2JB9A 4OAPA 3RQSA 4Z86A 2VOJA 2ZLBA 4QXOA 3R6DA 1ZO8A 2I2BA 2QEQA 2GI4A 5LMCA 3OQ6A 2ILTA 4TN1A 4DYHA 1USGA 2PMCA 4WH0A 4EW6A 4OHXA 4BJ3A 4PO8A 5BQXA 3LIEA 5M6DA 4LHZA 4WK6A 4G0ZA 2JCYA 3E9RA 3FNGA 4EK9A 4C2TA 1QYDA 4A0GA 3LECA 2Q0HA 4ND8B 2O2CA 4K3UA 2GUWA 2FPSA 5EVIC 4YRLA 4JJKA 2JIPA 2YBEA 2DTEA 2EJUA 3VP2A 1L4FA 1AQUA 4BLUA 2EDCA 3CEPB 1ZJYA 4DV1M 1QZEA 2UUPA 2O5CA 1B4DA 4HDKB 1MDFA 1K3TA 2PH3A 5TX7A 5G41A 4BFSA 4CGYB 3I05A 4EQ1A 1NAHA 2HP5A 4K5PA 1RE1A 4BYMA 2JGIA 4CEJB 4Q9AA 4KZ5A 1OJ7A 2CXUA 4AO7A 1ONBA 1VJ1A 3O93A 2W00A 4I5FA 2CZQA 4MTCA 3E6AA 3P94A 4CODB 2F4VB 4BMPB 5EP2A 3LT0A 1U6JA 4JKTA 4BKMA 1PKEA 4E4RA 4AQYB 4JYBA 5EWJA 4TNLA 2GBFA 3FR7A 2ODNA 1N5LA 5CTNA 1JU9A 3QMVA 1ZR4A 3DL2A 3VO9A 1MZUA 2AEMA 4R4RA 1ULAA 1PFQA 4PLYA 5C8DA 3VR4D 1O9BA 3HLWA 3AQ4A 3NXKA 5LBRA 1NBMD 4NZZA 3IP3A 5L3QB 4ZO6A 2EX0A 1Y28A 2Q22A 2PH7A 1OFHA 4ME4A 3UB7A 4D96A 1STOA 4XI9A 1Z62A 3WBBA 5JSKA 2APJA 5DBIA 4CMIB 4BDSA 3HFJA 1D1PA 1WCWA 2Y1DA 4NJMB 4YP0A 3IP5A 3RAEC 1LQTA 4I6EA 2QM0A 1VFPA 3SJBA 2NLOA 1V9YA 4YMUA 1T0JB 1QORA 3WV5A 4PIPA 3RR2A 5FBLB 4IHKA 4EG5A 4EFDA 4GD3Q 4P3PA 2WTAA 1ZBQA 1J1IA 2H1HA 1EX6A 5DP1A 5ECYA 4GBMA 3AHEA 5FNVB 3CX8A 5DB4A 4GKJB 1EFUB 1QE5A 5E2EA 3IYLW 3T0IA 1Y7HA 2EJVA 5DPMA 1GPJA 3ANMA 1NBMA 3ZU4A 3MHTA 1XDUA 2FPGB 2IELA 1OIZA 3VOBA 3WRVA 4CMJA 1USUA 4WLAA 3PR1A 3HO8A 3TIIA 2ZTUA 2IS1A 2WKIA 4KZPA 4M6WB 1MKIA 1Q74A 1ESDA 2IODA 3W8KA 3PX7A 4MQBA 3BORA 2P79A 3CT4A 1P2DA 4LGWA 1YVRA 5HNKA 4DR4M 3M9LA 2IOFK 3GLHB 2DR0A 2AOVA 1OT5A 3LEQA 2NX2A 4MVJM 3NRCA 2V5VA 3UAWA 3DZ8A 1K4EA 2PMDA 3TXYA 4MVXA 4GR5A 1JPUA 1N2ZA 4PE5B 1RBZA 3DMPA 2WIAA 1DC8A 4M0FA 4P92A 4M3KA 1RRMA 5EJGA 1I3OA 3ZHHA 5HQDA 1HYGA 5EKDA 2VHEA 2O05A 4K6HA 5AESA 2EUCA 3TKLA 4UAUA 1S8NA 4RPKA 5F12A 1RHRA 5FQKA 1T2EA 3PWKA 2A33A 5CVUA 1VMIA 2UZ1A 4KK4A 3LSYA 3RJMA 2BHTA 4RFLA 2G09A 5CHYA 1XRRA 2OV1A 2L18A 3VMMA 5AM1A 3V1MA 3F6YA 3RHZA 1PQPA 2VHUA 1WE4A 1Z17A 3CLSD 3C3JA 3STVA 1Z2AA 2JIDA 5REQB 2C88A 1PFWA 4QO8A 3O83A 4YPFA 1I0IA 2CKMA 3WK7A 5ADVA 5JWRA 5AVUA 3G59A 2AHMA 1RI2A 4Y2YA 3EMKA 1ZBDA 4NG4A 1O94D 3OT1A 3UDIA 1BWSA 3DLHA 3KT8A 4ZW5A 3H5TA 4XYEA 1V8ZA 2ZAYA 3LI2A 1NWCA 3LQFA 2X3YA 1IN6A 5A9RA 1Q1ZA 4RVDA 2AX4A 4FB4A 4KZ4A 4PCVA 3EEHA 1CUFA 1T2FA 4FH4A 4IJWA