4II7A

Archaellum assembly atpase flai
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
512
structure length
504
Chain Sequence
SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGEIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
molecule keywords FlaI ATPase
total genus 156
structure length 504
sequence length 512
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ii7A05
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ii7A02
3.30.360.100 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ii7A01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ii7A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ii7A04
5KSYA 4FWTA 2ZR7A 1VG8A 4M9XA 2H16A 4FINA 5HKKD 2QRNA 1U2RA 1KGDA 2E1RA 4US0R 5L3RA 3T06B 1KAOA 2R8RA 4RD1A 4Q7MB 2C96A 3Q5DA 1MRSA 4V0MA 4GRAA 3QQ5A 4HI0E 4XSGA 5FBRB 3TUIC 3U2QA 2QT0A 4LJYA 3O8CA 5D3MB 1TQ2A 1Z0JA 1TNDA 1ZCAA 2NGRA 4NCJA 5G41A 2IS2A 1D2MA 1KK1A 2XGJA 2ECKA 3JZMA 4P32A 4MYTA 5EXTA 4EQ6B 3ZVRA 2Z5FA 1XXHA 3LBNA 4HB0A 2GWHA 4E03A 2Z0MA 1TMKA 1CU1A 2ZU6A 2FZ4A 2P0EA 3N70A 4BFUA 3IILA 1NIPA 2GZAA 1AK2A 4OJQA 1XD9A 4OQFA 1XEFA 4GP7A 5FOTA 3R8CA 1JEEA 3NHBA 4E09A 3BB3A 4A0HA 4KFUA 3AF1A 3EXAA 2F43A 3RRNA 4L9SA 2Q3MA 1XXHE 4URYR 3M4YA 6Q21A 1CLUA 5KNBA 1GKIA 5AUQA 2ZANA 2GBLC 1Q22A 4TLAA 4JYBA 2BV3A 4XTRA 3JVVA 4Q4JA 4RSGA 4QNRA 1II0A 3OIUA 1W4AA 2KI5A 2K5UA 1Z0IA 4IKEA 4M0LA 1G7CA 2GEDA 2XAUA 3ADBA 3CO5A 2IK8A 4QHTA 5TARA 4DLZA 2ZJ2A 4QG7A 3C16C 4TLBA 5EE1A 5KO2A 4PC7A 2RGBA 2EFCB 3B60A 3REGA 3V9PA 4EAQA 2B92A 3OIVA 3BGWA 1XMIA 2ZRDA 1YRAA 1OV4A 1GAJA 5A4JA 4HB3A 2CLSA 5FOUA 1CJVC 4LC0A 1I2DA 1COWA 1Z0AA 2OEPA 4H9GA 3W9YA 2OCYC 3LO5A 4UXJA 1N6IA 2QMHA 2QUZA 3EC1A 4A1FA 2ZJYA 1SVSA 1OIXA 2MSCB 4TTQA 3P4YA 1WP9A 4DT1B 1GRQA 2RHDA 3GLIA 3MCAA 2DFLA 5AJWA 2G3YA 3ZQJA 3ZVMA 1W5TA 3CW2A 2GJKA 3CX8A 1UAAA 3IPXA 5J40A 5CDFA 2N42A 5J4VA 3HU3A 1OSNA 1P6XA 3MJHA 4LJ8A 1NP6A 1Z0KA 4EPVA 1KO4A 4XWOA 4QGFA 4PHFA 4QBHA 1OHHD 4R98A 4AWXA 3TW8B 2OFWA 4IOLA 3R9IA 1QF9A 2WOJA 3LNCA 1KJYA 1W48A 1E2GA 4M1OA 1GNQA 3MWJA 1FFHA 1GRNA 2ZE7A 4PPFA 4MA4A 3H4MA 4TTRA 2OG2A 2NPFA 4LJ6A 4JL5A 4KV9A 1DAKA 5F2EA 3U7EB 3A6PC 3THYB 3FFBA 4B3XA 1E1RA 2ANCA 4V0OA 2YVUA 1N5IA 4JLVA 5CLLA 4BLQA 2RGAA 5FUVA 1UBEA 1KNXA 1ZJ6A 1F5NA 1F2TA 3KQHA 2ZAMA 2GXAA 1GWNA 1NJFA 1R7RA 5J5CA 4Q1CA 5C4MA 3E2IA 4AC9A 3EIQA 4AK9A 2DHRA 3AP2A 4ARZB 5JCZA 3DOEA 2A5JA 1VDZA 4NH0A 5L8VA 3UATA 1E0SA 5EE3A 4Q02A 1YR8A 4V02A 2YYZA 3VNVA 5BN5A 2DFNA 5JEEA 4BZQA 2AN9A 3R9XA 5EXSA 2IA5A 1IQPA 2FFAA 1OW3B 4HUQA 4BFWA 3GCGA 3ZGXA 3CKLA 3GJ7A 3SC3A 2ODBA 2P6UA 2GVDC 1FPMA 1QBKC 4WOPA 5FTKA 1YVDA 2NZ8A 1E0KA 1XCGB 4A0RA 1HH4A 2JLYA 3BS4A 4US1R 1RJ9A 1W1WA 1DAMA 4ZI3A 3QNUA 4DCVA 1JR3D 2AHOA 3FMPB 2W00A 5LD2C 3DKVA 4B75A 2JA1A 4ZV4A 4LBWA 5JHHB 2RGNC 4MKIA 5LPNA 2ZSDA 5JI3E 2YV5A 3RC3A 3VHLB 2ZU0C 3TLXA 1UEIA 4N0DA 1U8ZA 3EASA 2WJGA 5CJ2A 1Z8FA 4DLUA 4TYQA 1H8ED 1ONBA 1YJ5A 4JT2A 4FWIB 4DWJA 3SFZA 1NVVQ 1RFLA 3TUZC 4A6PA 3I62A 3AP1A 1S1CA 4KVAA 3BRWD 3AVQA 4H1UA 4DZZA 1YZQA 4PC1A 4A6XA 3C14C 4DLXA 4BEBA 3PIRA 2D7CA 1JECA 3TIFA 3CUEF 4Q4LA 3HR8A 2OFOA 4Z8YA 2Q6TA 2V54A 3GFPA 3LFUA 1E99A 3IO5A 2WWIA 4Q00A 5JEDA 3KUDA 4JLMA 3O8RA 4TT3D 4URUR 2GCNA 4Q4AB 1OF1A 4PZZA 2ZRCA 1ZUIA 1ESNA 2JAQA 2NIPA 3CM0A 3FMIA 1PUJA 2AWNA 1TTTA 3NKVA 4IXNA 4MKHA 5AJZA 1AKYA 2VP9A 3EAQA 1EFHA 5E95A 3VU9B 4LYHA 3TUJC 1W47A 4B47A 5DE3A 2OCBA 1BMFD 2ZJOA 4M8NE 3WXMA 3QBTA 2JIZA 1HE1C 2P5SA 1YRBA 1N6PA 2DYKA 5EXPA 1VCOA 3DZDA 1KTVA 1G5TA 1GRRA 1E79D 2PLFA 1KK0A 2HJGA 4PAOA 2C78A 3QVUA 2ODNA 1VHLA 1BYIA 2XTNA 3D8BA 4XVQA 5JJIA 2QMOA 2WWFA 3Q85A 1KIMA 2PT5A 1XX6A 5DHAA 3U5ZB 2KSQA 5G3ZA 4BZXA 1T3LA 2RB4A 4S35A 1P9RA 3FOZA 3LAWA 4A0GA 1GKUB 4JSTA 2VHJA 1KI7A 3RRZA 1AIPA 1R4AA 3THOA 1RZ3A 1N5KA 1XNJA 4HLUC 1CJUC 4M4SA 3DOFA 1GNRA 4QL3A 4ABYA 4CYMA 2HLDA 1G8GA 4RKFA 2SHKA 2GXSA 3O8BA 4L15A 4C2TA 2JLRA 1NN0A 4KU4A 1TX4B 4A2PA 1G41A 5CB8A 4ZDJA 1E69A 5FTNA 3CWQA 5IRCD 1G291 1JQLB 4Q1BA 3EZ7A 2YWGA 4FMDF 2JLXA 2C8VA 3CX6A 1U8AA 5JJLA 4DCUA 1SVKA 3SE0A 3U3OA 1OFUX 1YKSA 1E9CA 3W3AA 4RFVA 2ZRMA 1G20E 3WRXC 4BFVA 1VIYA 1NVWQ 3NBFA 4JKIA 4Q7LA 1NNEA 3B7GA 2LCFA 1U98A 2V7QA 3ZIAD 1J2JA 3ZDQA 4B35A 3FPAA 4L4UA 3W6PA 2O8DA 1R0YA 3I72A 1XXHB 4CZ2A 1KYIA 2FNAA 1YZGA 5EUMA 3UMSA 2WVJA 3EG5A 1PUIA 3K0CA 5JLJA 5HKKA 5CK4A 1Q3TA 3I8XA 5FPYA 4TT3A 5ANRB 2NO1A 2NTYC 1SXJA 3IIKA 2F43B 4QXAA 5CDFE 3GLFA 3ZZ0A 5FUXA 1H8HA 2GETA 1JXOA 2QMUA 2IX3A 1MO6A 3PEUA 2CCJA 1Z06A 3U44A 2UVQA 3OEHA 1YR7A 5H70A 3CZPA 3WNBA 3ADKA 2IHYA 4IRUB 3THWA 4PHHA 4DLYA 2JIZD 1SKQA 2H7VA 1A4RA 2QGNA 3H1TA 2DB3A 3ZH9B 3U6KA 1E2LA 1LS1A 1T5IA 3FHTA 1NLYA 3WMEA 1L2TA 4QNMA 1V5WA 1SXJD 2WKRA 5AUPB 1E4YA 3K0AB 3Q3JB 2WHXA 1P7CA 1L4YA 3L0OA 3SDZA 1OH8A 2UZIR 4DSNA 4CEJA 3W6OA 1NMYA 1R0ZA 2JLUA 1SVIA 2ZE6A 4TYWA 4URXR 1VHTA 3NHAA 2FZLA 4LCBA 4B2LA 5KHOC 1P2UA 1GDDA 1KI6A 2VHTA 1KJZA 1IONA 2CNWD 1XPUA 1Z6GA 5F9FA 4FMBB 3N2IA 3QPUA 4FCWA 2G83A 3RS3A 4D26A 3VR3A 3L0PA 2CLDX 3RSOA 4OQXA 4DT1A 4Q7JB 4QOSA 3KUCA 1A1VA 2HYDA 3REFA 1G8HA 1GTVA 1MV5A 2HJVA 1HURA 1NRJB 4IDOA 2WZQA 1DE0A 2V1XA 3CBQA 1K5GA 4C0LA 5M04A 1UEJA 1E9FA 4E5UA 3WHKA 2IXFA 3EZ2A 4A8JA 1J70A 3GJ0A 1TQ6A 3GLHE 3IBGA 2WICA 1FQJA 4B3BA 2IYXA 2AL7A 2HF8A 1LTQA 4A2WA 2WSMA 4WZBE 1G3QA 3A1VA 1OYYA 3LQQA 5IK2D 5G40A 1XTJA 2J59A 2RGCA 3EA5A 3B2EA 4IFEA 3M0EA 4LRWA 3B1YA 2A9KA 4CGZA 1NN3A 3UMFA 1W2GA 1G8PA 5TVKA 3BE4A 4KJZA 1CR2A 2WWXA 1N0VC 3IEUA 4LV8B 1KSHA 4WBSA 3LW7A 1R5BA 2OLJA 4M1TA 3PEWA 4K8OA 2W0MA 3PFIA 3UK6A 4NCNA 4QBGB 5CIWA 4DEXA 3U4QA 2H8KA 2KB0A 3B1WA 4AIIA 2MMGA 5FPKA 2AFHE 1KHTA 2EYQA 2R44A 4HSEA 3MJRA 3EPHA 1XTSA 4BE7B 4DCTA 1KNQA 2O8CA 3AVOA 2CXXA 5J4LA 1G7SA 2VIIA 1J99A 2V8OA 2VF7A 4RCYA 2IWHA 3WYFA 2WMOB 5HCNA 4OI2A 1XMSA 4W5HA 2PX3A 4NE2A 5LD2B 2EFGA 5HR5A 3MWYW 4PPNA 1Q3HA 4WA7A 3WRYC 3KJHA 5GVSA 1VTKA 4TTPA 4FCVA 3L8YA 3BH7A 1WE2A 3FMFA 2FSHA 1W36C 1T8UA 2CJWB 2E87A 3CRQA 4Y0AA 3RNLA 1G5RA 1JB1A 2D62A 3B78A 2VH5R 3RHFA 4PSAA 4LYFA 1W4RA 3WY9A 2PEYA 1QHIA 4YMVA 4CVNA 1U94A 4KFRA 2JJ1D 3C5HA 2BKEA 4WVFA 5SZIA 3A36A 2PLRA 3U6BA 3SBEA 3HYRA 4LHVA 2RGEA 3RS7A 2VP0A 3CNOA 2P6NA 4OI1A 1YZLA 4BECA 2CCKA 2FEOA 2ZYWX 4B3DA 4FXPA 4LY6A 1Z0DA 3H0KA 2CMKA 2BJWA 3P1JA 3BFVA 3PCRB 3LQRA 2GAOA 2ZRPA 3KKQA 4M1SA 2ZYVX 3P32A 3TK1A 3VNUA 2BBWA 1JQJC 4Q21A 5BW8A 1YU9A 4M1WA 2FV8A 2ZM5A 3AEZA 1IY1A 2P2LA 2IYTA 2W83A 4MRRA 2YNMA 4BUJA 3KZ1E 4B6FA 1WBDA 2J0QA 5E3HA 4C30A 2AX4A 4OI0A 1M7GA 4GBMA 1S2MA 3F3YA 5J47A 621PA 1XEXB 3FFAA 1OH7A 2IHBA 4DSOA 1YE8A 3LXRA 3W6NA 4NZYA 1Z22A 3VU9A 1JALA 2OM2A 1ZNYA 4TLDA 3J81k 2REOA 4AYTA 4LI0A 1ZBDA 3AQ4A 4ILEA 5B58C 3NBZC 1R2QA 1AZSC 4N1AA 2UKDA 1OKKD 1G21E 1RW4A 2QRZA 3BERA 2WJYA 4LBVA 1H8EA 3UPUA 4TMKA 4M1YA 4EPXA 5K8TA 4MKGA 4YXWD 4AKEA 2D06A 2ZR0A 2RKOA 4BLOA 2V7QD 1BOFA 1P73A 4NCKA 3PITA 4HAUA 4EJSC 5K8UA 3AVUA 2O8EB 4JBXA 4DRZA 1OB5A 2YOGA 1U99A 1QDEA 2XJ4A 5FPTA 1RRPA 3NXSA 3X1YA 2ZI6A 3KTAB 3W5IA 3KL4A 3HR7A 4Z54A 4OHXA 1SULA 3BK7A 4C7OB 4UJ5A 1Z63A 1SHZA 2BIFA 2VSOA 4NKRA 2KWIA 2J87A 1NKSA 2FU5C 5EE5B 5KU1A 2B6HA 3RWMB 4CEIA 4NHOA 1RKBA 1DO0A 4H1VA 1ZUNB 1I4LD 1ODFA 3GLHB 4DLSA 2CCGA 1T6NA 3DM5A 2O8FA 4DJTA 3QKSB 4LV5B 1S96A 4N3NA 3DMNA 5JWRA 1X8KA 3MSXA 3SEAA 4Q47A 2OE2A 1S9DA 4S2EA 2FGJA 1JPNA 2FOLA 5FUYA 2I1QA 1KZGB 2PBRA 3C4JA 1OFHA 1NN5A 1IY2A 2H92A 4YMUA 4YLGA 1KI9A 3O8DA 4M9ZA 4NBSA 4PTLA 4Q9IA 4G5QA 2QG6A 2NO6A 1U8YA 5FBWB 4BASA 3K8YA 3D31A 1GKYA 1ZIOA 4D0LB 1GP2A 4TWZA 4C0SA 2IW3A 2Z4SA 2BBTA 2ZIAA 3U3KA 3ADDA 4ZIRB 3PUWA 4NCIA 4IEEA 3UMRA 4EFNA 1S8FA 4G0NA 4P4UA 1A2BA 1R6BX 3DL0A 1C4OA 3R20A 3ZD7A 3MD0A 3RLFA 3UKDA 1COWD 1K5DA 4PC3A 2QPTA 4MH0R 4OHYA 3I61A 3AF3A 4IDHA 4UNNA 1KDPA 2HCBA 4D4LA 3KXLA 2DBYA 3U7FB 3FYHA 2RGDA 3CPEA 4XIGS 3SYKA 4KITB 5BQ5A 2FSFA 3FGNA 4B48A 2LKDA 5EP1A 2XXAA 1ZYUA 4TMWA 1R5OA 2C9OA 2CDNA 3OE7D 4M9SA 3WYGA 4P3YA 3BH0A 4G01B 1W36D 3U4QB 3EARA 2ZTSA 3TKLA 1A7JA 3EZ9A 2CE2X 3U44B 1OLOA 5IK2A 2RH5A 1BMFA 3W34A 5KOYA 2V4ZA 4GZLA 4K81B 3WP1B 1W0JD 3RAPR 5JSZA 1X8JA 1Z6TA 1XB2A 1W4BA 3A1WA 3EPJA 1N6HA 5G3YA 3NDBB 1Q20A 4A82A 1S3GA 3T34A 1LNZA 3MUFA 4BFSA 1JPJA 4TL9A 3C7KA 2VSFA 4P4SB 5JZVA 2ONJA 1E9EA 2EVWX 4A36A 1YHNA 2G0NA 2IXEA 4YMWA 4O2RA 1XPOA 4BFTA 4C9BA 2J7KA 4IVRA 1E3MA 5EP2A 2PT7A 5FUWA 4W9MC 2F1RA 1CBUA 2ODEA 2R9VA 4F7WA 1ANKA 1Q1QA 2ZRFA 2EFHB 1GL7A 3PXGA 3I32A 4JLNA 3K9NA 2EU8A 2ORWA 2RGGA 2W2TA 3QKTA 1E9BA 3A4LA 3NIBA 3KQUA 1KK2A 5EQTA 3TSZA 2QBYA 2QE7A 3B5JA 1U9IA 1WQ1R 1W5SA 1YZUA 2MMCA 2GJSA 2VHQA 2O8BA 4TSFA 1E1QA 4DC9A 2BKUA 1X3SA 3LLMA 2WWWA 1W44A 1ZD8A 1J90A 4I99A 1TAGA 1X1SA 4RFSB 3THXB 1XD2A 1G4UR 2QI9C 1VCMA 1AQYA 3GMTA 3T5DA 5HPYB 2J1LA 1EFTA 3SQWA 1HTWA 2F1IA 4LJAA 4KFSA 2FGKA 2Z83A 3AVTA 3IDQA 5JWHA 1N6OA 2NZJA 1ZMXA 2GA8A 1EFRD 3C5CA 5FH9A 4AYWA 3ZS8A 3VHXA 2J0VA 4F4JA 1OIWA 2QAGC 1QRAA 4ZCMA 5EE0A 3UG6A 4FMDB 3K0SA 3T35A 1IHUA 1S4QA 4PZLA 4QJ4A 2IS4A 1E2HA 3KFXA 3KKPA 1EXMA 3CZQA 3MFYA 2IUUA 4WXRA 1J8MF 1QHHA 4WAUA 3V00A 5FBQB 4D6PA 2WIBA 2IYYA 2FWRA 2GRJA 4B71A 3A4NA 2QSYA 3SJCA 2C9YA 4ZDKA 3C8UA 2O8EA 4DLWA 3EX7C 3DO6A 4XTCS 2O8CB 3QPVA 1IN6A 2A78A 3SYNA 4YONB 4MGYR 2VP4A 4DDTA 2Z4RA 4FN5A 4UNSA 2WWGA 1FP7A 1NI3A 3HJNA 2G9NA 3KQLA 4QM7A 1KZ7B 2BC9A 4HZUA 2QP4A 4D80A 1OFTA 3QKRA 4UNRA 1DARA 1YZKA 1CF4A 2CVFA 2PH1A 1B0UA 2QAGA 121PA 3NC1C 1C9KA 1FQKA 1UBCA 3CF0A 4YMSA 2JATA 3GEEA 3SQXA 1Z2AA 1AS0A 2IYLD 4Z1MA 2DCUA 2B8WA 1X1RA 3U7GA 1OYWA 4D4KA 1KO8A 1UF9A 4IFBA 3OIWA 4P33A 3GP8A 1JR3A 3RS5A 4IOJA 4B32A 3GLGE 1K6MA 2R6GA 3ICEA 3SYLA 1QVAA 1DS6A 1IXRC 1ZVQA 1E6CA 5D3MA 5DO9A 5C1BA 1Z28A 1MT0A 3G82C 1PLKA 3JZAA 3LWNA 4OKSA 4DB2A 5HE9A 1W0JA 3E5HA 1CP2A 2R6CA 3AVVA 4WIAA 4V0LA 1M1YE 1M6NA 2C99A 1BIFA 4HB2A 4PSKA 5GJVC 3GLGB 2QROA 2OILA 1P9WA 1BYUA 1XTRA 2CLCX 3QF7A 2CHQA 4NYMR 1ZC4A 1U9IC 3NWJA 4P0TA 4CEHA 2GCOA 1E94E 5B2ZA 2R6DA 3T5GA 1XRJA 1RIFA 2BDTA 2IF2A 5AWFC 1HA3A 4HAWA 3T1VA 4KHZA 3TR5A 1L7VC 1A5TA 3P26A 3VAAA 1GFIA 3N5CA 2QEQA 5E7IA 5AR1A 3SZRA 4HAYA 2C98A 2ZRHA 4CEJB 5TV2A 2QTHA 3OEHD 4A9AA 2FPKA 1ZC3A 3VKHA 5DH9A 3VR2A 4UKDA 1TADA 2X77A 3SN6A 1D9XA 1VCIA 2YC4C 1ZU5A 1OXXK 2BEKA 1G16A 1U0LA 2EW1A 3IKJA 3K9LA 4XD7D 5AUOB 2ERYA 2R2AA 4AG5A 2ZSAA 2PZFA 2C2HA 3FVQA 4PSVA 3MG9A 3DPUA 3TJZA 2V1UA 3A1UA 5BN4A 5AJXA 1LF0A 1U0JA 3QKSA 4GSYA 4QHSA 5DYIA 1VKJA 1CXZA 4GOKA 4O25A 1HE8B 2Q9AA 1MOZA 2WJJA 3NBXX 2VF8A 4TMVA 3NH9A 2PZEA 3F8TA 4XWKA 2QP3A 5CJPA 2GK6A 3SU8A 2ZS8A 3DM9B 1KK3A 2IT1A 1SGWA 3L0IB 4WZAE 1X6VA 3C41J 5DNYB 3HDTA 1XPRA 1G6OA 3PEYA 4TQUS 5JFGA 3FHCB 2HYIC 3FMOB 2GJ8A 1R8QA 2WAYA 4TYPA 5FOWA 4JSYA 3IUYA 1W36B 1P4SA 2ANBA 1SXJC 3DEFA 2XX3A 4JVSB 4EFLA 1OKKA 4GOJA 1DOAA 1E2DA 1LS6A 1RVDA 2YWFA 3R8FA 1H65A 4CDGA 3A1SA 1IN8A 4LPSA 3R7WB 4Q4HA 4PC6A 2GTPA 4ZCLA 2NO9A 1IAQA 4X8HA 4LPKA 2X19A 4D81A 1KSGA 1HYQA 1NG9A 2R65A 3ZS9A 4YC7A 4AD8A 1Y63A 2PL3A 1L4UA 1ESMA 1T0HB 1D9ZA 1P60A 2ZE5A 1GL9B 3I73A 1EWRA 4FW9A 4LWZA 3ETLA 3EA0A 1G3MA 2XOKD 4JVNA 1E9SA 1G64A 1SVOA 4Q1AA 2HUPA 2PJRA 3RRMA 3QY0A 3LY5A 5EP3A 2ZYUX 4DKXA 1CULC 1R0XA 3MLEA 5FFMA 4QFMA 1DG1G 1M7HA 3R9WA 3AVWA 3ZIAA 1DELA 1KAGA 1W7AA 1F2TB 4CF7A 4DLTA 5L3SB 2NQ2C 4IXMA 2Z43A 4TZ0A 4JLPA 2ZPTX 4XJXA 1UKZA 2QQEA 1GILA 1IN7A 4ITRC 1EFUA 3IEVA 1E2IA 3W5JA 2B8TA 4B3GA 5UKDA 4QHYA 1WXQA 3TVTA 1MABA 2GXQA 2J5XA 4R2IA 1E9AA 2ZRLA 1E2MA 5HTKA 1XZQA 3DMDA 4UXIA 3U61B 5FBVB 2IYVA 2ONKA 4C2UA 3VX3A 4KO8A 2ZVQX 2QTVB 1Q0UA 4GMXA 4IEIA 2OLKA 1NLFA 4AKIA 4PO9A 2YWEA 1ZM3A 3NH6A 2KBEA 1F6BA 1ZM4A 2ZJAA 3B85A 4OBEA 3UWOA 2QORA 1YR9A 4PAMA 1HT1E 2JLSA 3FHOA 4B33A 1AGRA 4JBWA 1VPLA 4TL7A 4PQFA 2I3BA 4LUCA 1WB9A 4QGGA 3A58B 2XZLA 3P20A 1KI3A 4IOMA 1TF7A 4QBIA 4Q18A 2YC2C 3IQWA 1VYTA 1TPZA 3EZ6A 2JGNA 3D6TB 4MRNA 2IBMA 4AI6A 1DO2A 1SVWA 2WIAA 4PHTA 2O0HA 3EPLA 2Q9CA 3RRYA 5JMTA 3OFND 4MDFA 1R8SA 2J46A 3TH5A 3TRFA 5DN6A 3Q8XB 1D6JA 2CHGA 1NF3A 1GSIA 1BH2A 2Q0HA 5GJWC 4KODA 3AGQA 3LV8A 1E0AA 3TAUA 1F48A 4KVGA 4URWR 1FW6A 2GCPA 3C15C 3OZXA 2W6ID 4G1UC 2BMDA 2D74A 3OFNA 5KDOA 4DB4A 1NIJA 3EPKA 4X8LA 5AJVB 4EJSA 1XJQA 4C7OA 3Q7QA 4MGKR 4DHEA 2FE4A 3RWOA 4M53A 1VG9B 2WTUA 4D2IA 4MITA 2DWQA 3FKSA 1Z2CA 4CW7A 4WZ6A 4EKDA 4QGHA 4QGAA 1WMSA 4GDFA 4KFTA 1NMZA 3FDIA 4A8JC 5KDDA 1EX7A 4QBFA 3QG5A 3LBIA 4CT4B 1JAIA 2BCJQ 3EWAA 2ZSEA 1T3HA 1FTNA 1PVOA 4F91B 3RS2A 2PCLA 3WNDA 2FN4A 3G5UA 4LYJA 2AXPA 4ACBA 1JR3E 3ZVLA 1XU4A 1I4DD 2QL6A 4PC2A 5G53C 3B13B 4NMMA 1XJ0A 4QKQA 2R6FA 4RD4A 5E7MA 1OFIA 4Q9KA 1WA5A 1CS4C 4DBLC 1SZPA 2Q3HA 2FMXA 5A0FA 4AY2A 4UQOA 1FMLA 4FMCB 4XOIA 4RCZA 2CEAA 3K09C 1DAEA 2FJUA 3K0EA 1T9HA 4HZUB 2XB2A 2ZAOA 3NVAA 3TMKA 1Z07A 3OAAA 3GEHA 2JJ1A 1X8LA 3B1ZA 1TF5A 5DI3B 4B2PA 2FEMA 2QAGB 2FF7A 4ACAA 4DCSA 1VIAA 2A5YB 3L0SA 4Q19A 4Q4JB 1JJVA 2N46A 3CONA 3HWSA 2A2ZA 2JCSA 4V03A 4ZIRA 1NVVR 2C03A 5FL7A 5FL3A 3KKMA 3I3SR 2J0UA 2BJVA 4LV6A 1NMXA 3VKWA 3LD9A 1DADA 4HLQB 4B2IA 1Z47A 2FSGA 2AXNA 2BM0A 4M1MA 1KSFX 3K70C 1CR4A 5TB5A 1E2KA 3OAAD 4EPYA 4QJ3A 3GJXC 4Q9JA 2R62A 4AG6A 2F3RA 2ZI7A 2I4IA 4HUTA 2PMKA 1P2SA 3K09A 4WXPA 1AZTA 3AP3A 1ZAKA 2FSIA 1CR0A 2GCOB 3GLIE 4D25A 4XWAA 1NG1A 1RRCA 3G0HA 2AD5A 2QPOA 2J0SA 2BMEA 4GP6A 3T61A 5CIQA 2GVZC 4HAZA 2IS1A 3EIEA 3KXKA 1E2EA 2YINC 3FTQA 4I1UA 1UFQA 1ZM7A 2XSZA 1ZNWA 4OK3A 3AM1A 2A5DA 3O47A 4DSTA 2KJQA 3TAHA 1V43A 4JIMA 1AN0A 4TZ6A 1BKDR 2OZEA 1XWIA 2Q9BA 1FX0A 4D0GA 2RCNA 1UKVY 4DCNA 1UBFA 5JSZB 1JJ7A 3THWB 3HP1A 2V6JA 4RZ3A 3LX8A 5FOVA 3CNLA 4ZO4A 1VG1A 1KSJA 1G1MA 3VFDA 3BB1A 1ZD9A 3VR5A 2QBYB 3TSOA 2JASA 2H1LA 2IS6A 4JLAA 4IHQA 2F9LA 2FFQA 4MUAA 5FR2A 2VQSA 3ICQB 2MSDB 2V3CC 2PX0A 2WBLC 1P2VA 5FTMA 2GILA 2OSBA 1LV7A 5EZ6B 1PZNA 3WBJA 3QEOA 1XD2B 2GK7A 3WNCA 5LDDC 3PUZA 3PENA 4PXAA 4BZPA 2QT1A 4KAXA 3T12A 1J8YF 4C0AC 3KJEA 4MYUA 2OXCA 3U3JA 2I1VB 4D0NA 1IN4A 2CNWA 3TSWA 2JLZA 2JDIA 4URVR 3B1XA 4JL8A 1EGAA 4Q1FA 1W49A 1N2CE 4LOAA 5E4FA 1C1YA 2VBCA 3GQBA 2VLIA 1AKEA 1KOFA 4Z8XA 1TU4A 3KQKA 1UADA 2JJ2A 2A3RA 2ORIA 4JLKA 4Q9LA 3PUVA 1FUKA 1KI8A 3EWSA 3PVSA 1R5NA 4EUNA 1TEVA 1XCPA 2WPDA 3QG1A 3EC2A 2RGNA 4MGIR 1GOTA 4O2LA 4PFSA 4V0KA 2ZJ5A 3GEIA 3QE0A 1Z0FA 5SZKB 5C46F 2QENA 2NO0A 5GVRA 1NN1A 4NYIQ 2HXYA 4HATA 1F60A 4JMPA 5GJCA 2NMVA 5FTLA 1ZIPA 4TQ9A 2XB4A 1SVLA 2DWPA 4HAVA 2O52A 1JNYA 2AWOA 4JVLA 4LYAA 4B6EA 1OXSC 2OESA 3HU2A 3KB1A 3OEEA 3BBPA 4GT1A 5L3QA 1WCV1 1MR3F 1FNMA 3Q5EA 2LWIA 4P31A 2DR3A 4LHZA 2RGXA 1QHHB 2ZEJA 5L3VA 1IXZA 4HUQB 4TLEA 2ZUBA 5DSZA 2XITA 1SKYE 4GOXA 5C4GB 3CIOA 1FTSA 3GD7A 4LJ7A 3AVXA 3IBYA 4LDJA 3SI7A 4Z51A 3KDSE 4TLCA 4BLRA 3VR1A 4PX9A 5TDHA 2ZJ8A 4NPHA 1AJEA 2OFXA 1UKEA 4LJ5A 5JCPA 2YKGA 1XDBA 5KYKA 2RMKA 4LBZA 3WP0A 4C0HA 2DFKB 4DDVA 2FH5B 3IQXA 4EFMA 3ZVNA 1E96A 5F9HA 2GXUA 2GJAA 3VQTA 1IBRA 2BBOA 1OE0A 1TU3A 3QPWA 4FI3C 3SNHA 3VX4A 2ZRNA 1U0HC 3P27A 4TYNA 1QG2A 1AQUA 1GG2A 1TQ4A 1WRBA 1XP8A 1YZNA 4TN1A 3D3QA 1G5PA 3ND9A 4MRVA 4EIWA 5CM9C 1YZTA 1KO1A 3SS8A 2GESA 1CRPA 3ASZA 3OHMA 2X2EA 1G3IA 1ZRHA 4I1VA 4RKEA 3K0CC 3DVLA 2JEOA 3F0TA 4R2HA 1Q57A 2ODWA 2F55A 5EXXA 2BWJA 1ZINA 2W0SA 5JRJA 4R71A 5H8WA 3X1DA 4MUBA 4Q9HA 2WKPA 4DLRA 2JLQA 2PMDA 4MRPA 5CYOA 2B7CA 2CK3A 5K8IA 2QY9A 5IT5A 4U7DA 3QXXA 3X2SA 2OV2A 3P4XA 4JT4A 2F7SA 4KLNA 1E1RD 4NTZA 4W5WA 2WWHA 2YJTD 4TSFD 2ZETA 3QI2A 2ZJBA 3VR6A 3U60B 2RAPA 2QE7D 4EPRA 2WOOA 1S3SA 1Q1BA 2CL6X 4TMTA 4GFDA 4BGDA 3LLUA 3BORA 2BOVA 1P62B 3ZQ6A 3ECCA 3ZZUA 3I5XA 5EZ5A 1E2NA 4LHXA 4NL4H 1FUUA 4ZCIA 3LVRE 3OF5A 5JHGB 1XCMA 2D2EA 4PO1A 2WMNB 1OXUA 1TF2A 2HV8A 3AH8A 4QRHA 821PA 1GITA 1D2NA 3H2YA 2GNOA 4ZDWA 1VYVA 1Z29A 1GUAA 1DAFA 4JLJA 4RZUA 2ERXA 1ZP6A 1SXJB 2FDCA 4R9UC 4JJKA 5DN6D 4C0BA 1TQDA 2JLWA 5SZHB 3MAAC 3KFVA 4DXAA 1EFRA 1RYHA 3IHWA 3SHFA 4I1SA 3KJIA 4B3FX 3AGPA 5FBLB 3AKDA 3W3ZB 2FFHA 2QAJA 2BEJA 5BN3A 2D7DA 3L2OB 4DIDA 2GDJA 3B1VA 3T15A 2J41A 4JJZA 1AS2A 2KBFA 2QSZA 2WSSD 4EDHA 1T8TA 4PPQA 1NY6A 4OHVA 1XTQA 4OJKA 5DISB 3I5YA 1SVMA 1NJGA 1YQTA 2Z6VA 1VYUA 3U7HB 1WF3A 2O8DB 1Z6YA 3WMGA 1F2UA 2GEUA 3A37A 2IYZA 1KDTA 4II7A 1JBKA 1G8FA 2HT1A 3SHWA 3QXCA 4MRSA 4JYCA 3W8NA 4KCGA 4RD2A 4LC1A 3CH4B 4LJ9A 3CRW1 2VYFA 4LK2A 2RHMA 1P2TA 1Z83A 1R0WA 2VRWA 3VTKA 3ZYCA 5FI1B 2G1JA 4TMXA 3ASYA 1FOEB 4DLVA 3UWKA 2ZE8A 1XTKA 4YDSA 4I81A 4JL6A 5FOSA 2A5GA 2XTZA 1US8A 1LFDB 3HPRA 4ERNA 1B23P 2FA9A 1G6HA 1JI0A 2GF0A 4YXWA 2DY1A 3CNNA 2ZRKA 2G6BA 4JLBA 4Q01A 4BFYA 3BC1A 8OHMA 3SJBA 4HAXA 5B30A 1XMJA 4IDNA 5IDVA 3QOFA 1OJLA 3QVVA 5KDLA 4DDWA 2JJ8A 2G0TA 1QHNA 4LJ4A 1N6LA 2C95A 1LW7A 4POAA 4GPTA 3AV0B 3KJGA 2FPLA 4FMCF 1ELOA 1II8B 4B3CA 5JWOA 3H86A 3BWDD 4OK5A 5LB2A 1D8TA 2PZGA 1D2EA 1NBMA 2REXB 1QHGA 1FP6A 2GAAA 5JECA 4NP6A 2MSEB 1RJ9B 4RZ2A 3B6EA 3EZFA 1N6KA 2ZRIA 4TL6A 3ND8A 1YR6A 4HDQB 4L9WA 3TR0A 2VP2A 5KSPA 1PJRA 2OHFA 2JLVA 3AKCA 4BLTA 4GNKA 1NLZA 4C0KA 2QP9X 3S1AB 1VECA 2ATXA 4PQYA 2G1KA 3NTUA 1EX6A 4LGMA 1GIAA 4ASUD 5LBIA 2QPAA 5H1YA 4AURA 2Q21A 4A8JB 3W8RA 2GF9A 4D4MA 1CJTC 1G8YA 3WMFA 2FPMA 2OCPA 3K9HA 3PG5A 3ZJYA 1HT2E 3LDAA 4DSUA 1K8RA 1TEXA 5A5GA 2A7QA 3N2EA 4V0ME 3QEJA 5CLQA 4J0QA 2BMFA 3GJ4A 1Z3IX 1UDXA 2WWYA 1EK0A 5DLQC 1JXMA 2ZSFA 4W7SA 3MWKA 3GJ3A 4A4DA 2AK3A 3K70D 2VP5A 3CRVA 1XD8A 3E1SA 2VTKA 4LSGA 2P65A 1MO5A 2W6JA 1MO3A 3SJZA 3UIEA 1E32A 4XSHA 4JZKA 3UANA 2R6AA 2XSZD 5GADl 1JAHA 4P4TA 3HU1A 3Q72A 1W4CA 1T4GA 2FFBA 2DFTA 4UNPA 5BYJA 3PUXA 3FKSD 1IY0A 4BLPA 3T1TA 1KI2A 2AK2A 4ZPXA 4HYYA 4MGZR 2WSSA 4UNQA 4OQMA 4PPGA 3NC0C 4B44A 3KQNA 1XEXA 4F92B 5DI9A 1E4VA 2YHSA 3A8TA 4NYJR 3TQFA 4ZKDA 3QF4B 1MO4A 3LA6A 2ZROA 4NYIR 2IYRA 2PCJA 3RDPA 1G7RA 1DEKA 1S9HA 4Q5IA 4Q66C 1O3YA 4G5GA 3K0FA 1KI1A 3RS4A 5BWMA 3GFTA 4C3ZA 2J45A 1NBMD 1DVRA 3UXMA 3X1XA 2ZJZA 2OBLA 3SBDA 4ASUA 1CRQA 2O5VA 5DGXA 3AKYA 3L8ZA 1FNNA 2JDID 1MH1A 2OXRA 2W2XA 4QJ5A 2YZ2A 4BPBA 3FB4A 3MRSA 3EW9A 2WPDD 5JRZA 1AA9A 2CJWA 2W58A 1HUQA 2OAQ1 3BFXA 1OH6A 2VHUA 5IF9A 2EWVA 2D2FA 2WJIA 2JJ2D 2KE5A 2VEDA 4X8OA 4RY2A 1P3JA 1RYFA 2ZRJA 4M22A 1AS3A 3A4MA 5HZHA 3AF2A 4I4LA 1Q1EA 2J0UB 2J7PD 4RD0A 4TMZA 2N1BA 1E2PA 2ZITA 5KUTA 5FOXA 1Z5ZA 1KY2A 5D3QA 4B34A 5DI3A 4BRWA 3MGCA 4MYHA 3CB4A 1OH5A 1PLLA 3DKPA 4BFZA 1IOZA 1RRFA 2IUTA 2OO7A 4EQ6A 3ZLJA 3VKGA 4LZZA 4L5BA 5ELXA 4U02A 4Q03A 4R7ZA 3AUXA 4DUGD 4BLSA 4ON9A 4TQAA 5TY0A 3OIYA 1CTQA 4WW0A 4PO8A 1G9XA 2QN6A 5HE8A 4KXFB 3UG7A 4V0NA 1A2KC 4DVGA 3FE2A 1JEDA 1Z6AA 2DWOA 3L82B 4NYJQ 2WV9A 1Z6XA 4FD2A 4B43A 5H68A 1II9A 1ETUA 4GL2A 1T91A 2GHIA 3WHLA 4PANA 2ZI5A 3D7MA 4O3MA 4LHWA 1UKYA 3KTAA 5FI0B 2ZRAA 4JLDA 1XBTA 4CEHB 2EQBA 4A15A 3BD9A 1N0UA 1KMHB 1OB2A 2QM8A 5P21A 1HQYE 1BO6A 4MKFA 2D3WA 3AUYA 3PQCA 2REBA 4G5SA 4IVPA 2C77A 1II8A 3IIJA 4KI0A 1ZCBA 1CKEA 1EG7A 5SZJA 4RD3A 3RABA 2BBSA 3TVDA 4Q7KA 1LY1A 2BMJA 5J4HA 2O0KA 1S0UA 3B9QA 1N0WA 2P5TB 3CF6R 1EFCA 4YDHB 5C2JB 1GM5A 1SHKA 5KNDA 2EFDB 1N6NA 1NBME 4P4SA 1NY5A 4CIDA 2FG5A 1NSFA 2OBMA 3FWYA 5FL7D 5EJEA 3GLHA 2O8FB 2XJ9A 3NBYC 1Q44A 2XNDD 3AKEA 2OT3B 2W2VA 3AF4A 4IDPA 2ATVA 3FKQA 5CM8B 2QGZA 3CF2A 4Z1MD 1AM4D 2HLDD 2TMKA 4U5XA 3QBVA 721PA 1PLJA 1W0KD 1X86B 4EPWA 5BXQC 4X8MA 2J7PA 2ZYTX 2F6RA 2HEIA 4G3XA 3EIHA 3PV0A 4OQNA 2ZUDA 3RS0A 2AR7A 4G5RA 4MDEA 2P67A 3IGFA 4ZI2A 3NEYA 4PHGA 1I2MA 1US8B 1XEWY 2H5EA 3DHWC 1KO7A 1FL9A 1P9NA 1XEWX 4M21A 1QHXA 5CB6A 5TXGA 3GJ6A 3BH6A 4CT5A 1IM2A 2EYUA 4QC2A 1QHSA 1SKYB 4DEYA 2X8AA 2C04A 4IDQA 2XXAB 4C0QC 5KPDA 3A1TA 1LB1B 1CR1A 1FZQA 2J3EA 2O8BB 2X1VA 4B76A 3LXXA 2H18A 2NPIA 5JJKA 2QQ0A 3F5FA 2NO7A 3I1FA 3AVYA 2HDNB 3W90A 1GZSA 1CEEA 3QKUA 2QU8A 3KXIA 3QUSA 2CL7X 1UPTA 1HY3A 3AF0A 4I1OA 3IHLA 3U3RA 1OIVA 2GZDA 4NYMQ 5L3QB 2IYQA 1QG4A 4Y0VA 4AYXA 3LVQE 2P3SA 3THYA 3KB2A 3LRPA 3QENA 4KYUA 4LBYA 1VG0B 3CRRA 5KPJA 1G4AE 3HPQA 4HLCA 3SR0A 2QM7A 3QXSA 5LB4A 1SXJE 3U3MA 4RD6A 3RSLA 4BQSA 4B74A 421PA 5J4YA 4ESVA 1J7KA 1W2HA 1KMQA 5BYKA 5F98A 3TW4A 1Q1ZA 2F9MA 1KKLA 4NONA 1L8QA 4FIDA 1OHHA 2YOFA 2ZI4A 3Q9LA 4IJMA 2HCJB 4D4JA 4XVRA 3GPLA 1T3SA 5EUQB 2AKYA 3X1WA 1ZU4A 3PUYA 4BRUA 3NG1A 3E70C 4OL0A 1XTIA 3PJRA 2CHVA 1DG3A 2UZ3A 3GJ8A 3QKRB 3S1AA 3JVUA 1E79A 4HEJA 2V9PA 3DDCA 3KKOA 2B7BA 2FX3A 4JVMA 1KI4A 1DTSA 5AUNB 3M6AA 3GLFE 1IJFA 3OEED 1JR6A 2AFIE 2ZVPX 1NL3A 5E7JA 4LX0A 4M9QA 1CIPA 3I8SA 4OK6A 4HZIA 4RZXA 2ZUCA 3OESA 2QA5A 2Y8EA 2ZS7A 3SOPA 5CYPA 4TL8A 2XZPA 3BB4A 2CL0X 4N0EA 3BJIC 4HDOB 3ZZTA 1H8HD 4KBGA 4DIEA 4YQFA 5EE9A 1HQCA 3SFVA 5DIFA 4HDCA 3LBHA 5CITA 3THXA 4OHZA 1M7BA 2IEZA 1KY3A 3RANA 5DYGA 1P75A 3TGPA 4JS0A 1EWQA 4M2LA 2XOKA 4UJ3A 4GI7A 5TMPA 1F3OA 3CPJB 3I92A 3KKNA 1UJ2A 4FCTA 1IN5A 4OHWA 3QF4A 1G3RA 3LX5A 3LH5A 3V4FA 3CR8A 4KSBA 4QM6A 1Q21A 2NOAA 3TNFA 4LHYA 5K8LA 1E9RA 2D4HA 3VR4A 2A5FA 5EP4A 1W0KA 3RVBA 3V4RA 4Q4AA 4HLUA 3BOSA 1DAHA 1XJCA 2G77B 1E2FA 4CEIB 4TYYA 1GNPA 4Q48A 1E9DA 2QNRA 3MMPA 4XH9B 1QHYA 1M74A 1MRNA 2CK3D 2VA8A 1RRGA 2AD1A 2CE7A 3CPHA 3RYTC 5HZKA 4DDUA 1M8PA 1ZM9A 3NDPA 2ZI9A 1E2QA 3B8HA 1F2UB 1UBGA 1VCNA 4JLOA 4K46A 2NG1A 2VHCA 4L8GA 2EWWA 4KBFA 1MKYA 3IIMA 1NKTA 1E0JA 2IYUA 1XF9A 2L0XA 2V6IA 2C5LA 2ZI3A 3CLVA 4F38A 4US2R 2J9RA 1UM8A 1N5JA 3GLIB 2AKAB 3B9PA 1IJEA 3IPYA 3K70B 4ZDIA 1W46A 4IVQA 2IWRA 3QJYA 2QTFA 4D82A 1RE0A 4YMTA 1Y3AA 4RJLA 2X2FA 1XMVA 3CH5A 2ASEA 1VMAA 5FTJA 2IXGA 1HEIA 3WYAA 1OT3A 3R7WA 3K9GA 1OXTA 5IHPA 5J4KA 3LW8A 1P72A 2O0JA 2XNSA 4GZMA 3B82A 1ZD1A 2E9SA 2YWHA 1UDWA 4KYIB 1KJWA 2OCAA 1XZPA 2BVNA 3CRMA 4JBYA 3TBKA 3QSYA 1KDRA 1KO5A 5JS7A 2ORVA 5KTYA 3QXHA 4ARZA 3GLGA 2GZHA 4U00A 1E98A 3HYTA 4A2QA 2CBZA 3BAFA 1N25A 4E22A 2P6RA 2ZRGA 3K53A 4OQLA 3WBKA 2F1JA 3PEVA 1AGPA 1TUEA 2F1HA 4E07A 1KMHA 4XD7A 3GLFB 4B73A 3TQCA 4GMDA 5JI2E 2OAP1 1M34E 1ZNZA 2VL7A 1O87A 2HT6A 1OPXA 4MYCA 3DZ8A 3MWLA 2CVHA 4NCHA 2QZ4A 4URZR 4CRWB 2IYSA 4NDZA 1N5LA 1QZXA 2G88A 4MQBA 5C18A 4PZYA 4F4IA 1ZNXA 4W5JA 3AB3A 3I4LA 4OI4A 4PR0A 2BCGY 4NU0A 1WDTA 2ZREA 2VPPA 2OUKA 1GVNB 2IYWA 5JS8A 1E2JA 2VSXA 3CWZA 3T1OA 1G7TA 1NVUQ 2A30A 2BM1A 2OBNA 3CR7A 2IL1A 4IW3B 5B57C 1G17A 1LVGA 1P5ZB 3H84A 1XFAA 3Q7PA 1FX0B 3RC8A 2H17A 2H57A 2VO1A 4A92A 2V55B 3VMFA 3ZD6A 5B64A 1G18A 1DBSA 2EFEB 2ZQ5A 4O0MA 1KI6B 4XVUA 1NVXQ 2PJZA 1KKMA 4PQRA 1T5LA 2GEVA 4F4CA 4F93B 3TE6A 1G3UA 1LF5A 2WJVA 4Q1EA 4BEJA 5F3WB 3BFKA 3K0AA 4AKGA 3GFOA 4JKYA 4L16A 3GJ5A 4RFSA 4EPTA 2ZRBA 2BHRA 1T0JB 2GBLA 3BIFA 4C0JA 1IXSB 2HXSA 2IEYA 2WAXA 1D5CA 1RC8A 2LKCA 4HB4A 3OE7A 1ZW6A 1KDOA 2HF9A 2ZXUA 1ZM2A 3AVPA 1R10A 2IC5A 3M1IA 1DPFA 4Q4HB 2PEZA 5CK5A 1EESA 1GL6A 5KSOA 4OYHA 2DPXA 2WJHA 1WBBA 4KLZA 1N3BA 2GJ9A 1A82A 1ZUHA 4BFXA 1CJKC 5KSZA 1U81A 3KX2A 3NEJA 4ZKEA 3K0FB 3PR1A 5HCIA 2IF0A 1M2OB 1Q12A 3QXJA 3K1JA 3QIAA 1P61B 4BWYA 3BXZA 1HV8A 4DUGA 4EJSB 1PV4A 4UXHA 221PA 2YOHA 2WM9B 1FMJA 2XNDA 3ADCA 1Z08A 5FR1A 4Q1DA 5GJBA 521PA 5FPSA 3T1QA 2IUSA 4KSCA 2B21A 4IOKA 2QMEA 1S1MA 4C4PA 1OXVA 2XTMA 2WKQA 3X1ZA 2C9CA 2ZS9A 2XZOA 2W6IA 5KNCA 5L3SA 1I4TD 1BS1A 1QVRA 5DHFA 1SQ5A 2F3TA 4PAQA 2ZSBA 1U90A 2XEXA 3IO3A 1CJMA 3CX7A 4HLDA 4ESHA 4G5OA 2VP6A 4A0FA 1E1QD 1TL7C 4RVCA 1DAGA 5AJYA 1MABB 1DAIA 3SJAA 1NSTA 2ZR9A 1RPZA 3ONWA 1TUIA 2Q3FA 1G19A 1N6RA 5JBQA 3L43A 2W6JD 2GKSA 5AK0A 4AKHA 4M1KA 5FPHA
chains in the Genus database with same CATH superfamily
5AVQA 4FWTA 1RWPA 1OAAA 5U4XA 1F9AA 4QMEA 3I3OA 1KEVA 2QRNA 4JBNA 1KGDA 2E1RA 1RLJA 3P2OA 1KAOA 2PX6A 5ALXA 3ZJ4A 2R8RA 2XOEA 4RD1A 2WABA 1I6WA 3Q5DA 3RF6A 1XLWA 3O1LA 1XCBA 4GRAA 2AVXA 1MAAA 2JFPA 2MJ5B 3K2BA 4HI0E 4M8LA 4R0QA 4NDAA 4RVNA 5FBRB 1GPBA 2VK2A 5G1NA 5BVGB 3I4VA 2QT0A 3G0IA 4LJYA 1K54A 2E2WA 5K3CA 3O8CA 5HDSA 1ZCAA 4NPCA 2NGRA 2IS2A 4KIUA 2L1MA 4N9LA 2OL4A 4GM0A 3UOWA 2D01A 2XLBA 3NC4A 3LBNA 4HB0A 5FV4A 4B0PA 2ET6A 2AV6A 3PFBA 1ZMBA 3LFTA 2JC3A 1WE4A 3VR4H 4BEJA 3IILA 3MUNA 1AK2A 3FYCA 1U2EA 1XZLA 2RG1A 3N2GB 1FBTA 2WWVD 3TZHA 5E6JA 1C7JA 1ZXLA 2OBFA 4E09A 5CLFA 4NS1A 3GFQA 3U6PA 1BTOA 2EGHA 2FWIA 3AF1A 1NFRA 3UH1A 2CMDA 2Q3MA 1XXHE 1NVBA 3B48A 3KNZA 4CN9A 1VOTA 4W4TA 2ZANA 2XCIA 1Z6QA 2GBLC 3DZGA 2P79A 1TYCA 4RAQA 3EZLA 3BHNA 4DM4A 3V4ZA 3PKJA 1XEAA 3QMWA 3PEEA 2XF8A 3E0QA 4IIDA 3O8OB 4Q4JA 2E6KA 3AF6A 4JI0M 4RSGA 4QNRA 3K5IA 4S3MA 4DA4A 1W6RA 1DTWA 4HMPA 3SMPA 1QPBA 1C80A 1EINA 2HM7A 2JNWA 4OY3A 2CUTA 3A9CA 3HY6A 3OE4A 1O7JA 3OIUA 4MWDA 2ZC5B 5KNCD 1YZ3A 1IMOA 4P16A 4YUXA 2GEDA 3ZV5A 3RVLA 1QQTA 5KQPA 5D5QA 2QRHA 1L1ZA 1RYYA 4J7AA 3TZLA 2ZJ2A 1CQXA 3LUGA 4HJRA 1EXDA 4QG7A 4INJA 4RZSA 5KO2A 1P5FA 2V0UA 4MR8A 3IIEA 5K0NA 3KOMA 3UAOA 4FUWA 2VF5X 3B60A 3UJCA 3FUWA 1Z09A 2HA3A 4P53A 4OFBA 3C3KA 3CZ4A 4O0LA 2JGRA 4D9HA 3BGWA 3IAS1 5DHTA 3TRJA 3VVBA 3SVLA 3WWPA 1TDGA 3S6JA 1OV4A 1GAJA 4FQ5A 2HJ9A 5FOUA 1LLDA 3MWJA 4LC0A 4P7GA 3SMQA 3GDFA 4MGHA 4UDOA 5KS2A 3QVTA 1VE1A 2Q99A 3NBUA 4UBMA 4JBIA 4DILA 2CZCA 4H9GA 2BGUA 3D8TA 1TT5A 4EI7A 1N6IA 2Q49A 4D0RA 1C4XA 5BUCA 3EXHC 3PNMA 2ZJYA 2DLNA 4A10A 4MVJM 1XTUA 3O75A 5TPZD 1WP9A 2RONA 2R84A 3B7QA 4HQKA 1M5TA 3D7NA 1MB0A 2C92A 4JUBA 1P1IA 4ZZ1A 1W5TA 3CW2A 3ZZNA 3HO1A 1NZJA 2PMFA 1HFEL 4MIYA 2HWKA 5DFYA 4DR1M 2VHZA 3N4IA 1ZJWA 2VEAA 2N42A 1VL8A 9GPBA 5DBEX 1UDAA 4AG3A 1V5EA 1OSNA 2QB5A 3MJHA 4HFNA 4S24A 4W7HA 5FA5A 4IFIA 3PUKA 4QGFA 1Y8CA 1TGUA 5EJGA 4C4AA 4AWXA 1YS2X 2NU8B 4KXCA 4KG6A 3T3GA 3AWDA 2HGVA 2MYPA 2W2NA 4WD3A 4IOLA 4Q0HA 2C8LA 1TKRA 5T8KA 3OECA 2G9UA 3WLIA 2VVTA 1W48A 3BRSA 4WE3A 2H52A 3I09A 2H29A 1N1DA 5AYVA 2YN4A 2ZE7A 4PPFA 3AL2A 4MA4A 4NYMR 4D57A 5ITWA 5DMXA 4KZ6A 3LTNC 5EIXA 3H4MA 1IYSA 2H1VA 2BM9A 2OG2A 4OHMA 1YACA 3OZWA 2AJBA 1AK1A 4E3MA 3FFBA 3ONDA 2PVSA 3CKYA 4G9GA 4QU5A 5PGMA 4B3XA 3CVXA 4DR1B 2QZ9A 5ITZB 3M6XA 4JLVA 1ABFA 3CN9A 1QPGA 4KMRA 2PGOA 5J2UA 3KETA 1KNXA 1TVCA 5IM5A 3WLMA 4PSDA 5ELLA 2HCFA 3M6FA 4HEA1 3BDIA 1W0CA 3S0JA 4LNHA 4FFPA 4JT9A 4C7MA 3ANXA 5C4MA 3E2IA 1CY6A 3PNKA 4AK9A 2DHRA 5SYNA 3AP2A 2YRXA 2IU4A 2DRWA 4KK4A 5JYFA 3DOEA 3C2WA 1NW3A 1BTLA 1P7WA 3EYWA 1GQOA 3A46A 3UATA 3WZMA 4R38A 2X0IA 2KDLA 3P7VE 3PTLA 2RGWA 2PJUA 4I5GA 4Q02A 3WK5A 4KVZA 4LXGA 1L0DA 3D9YA 5JEEA 4H0FA 5GM2A 5IWAM 5DLLA 4PFKA 2Y2QA 2J8YA 1OW3B 4HUQA 4BNLA 2XMPA 5A2QS 3FE3A 3ZY3A 1CUAA 4BFWA 3GCGA 3ENZA 3HKEA 2C5SA 3MXTA 1TMYA 5JSUA 2I4TA 2JJYA 4UQIS 1V4VA 3SC3A 2GZMA 2PFSA 3CKLA 3GJ7A 2GVDC 3LIDA 5U1PA 5AVWA 3LC1O 1FPMA 4WOPA 5FTKA 3CVWA 3V50A 3Q12A 4R83A 1OTIA 3UE3A 2ON6A 5D01A 1QS0B 1HH4A 3TMYA 5LQKA 4CJ6A 4FGJA 4Y3IA 2JLYA 4H3HB 2XA1A 3FYUC 4RTOA 1DKQA 1BOOA 1U65A 2KW5A 3DBIA 2L17A 1ZAEA 2AHOA 5MGNA 2W00A 2FY8A 3WTCA 4QY6A 3NZEA 2JA1A 6ADHA 3DBAA 2Y59A 2RGNC 3VHLB 3E9EA 4JENA 2ZU0C 3TLXA 3GD5A 4K0KM 5HIKA 1U5CA 1TAHA 4N0DA 1LDEA 4H60A 1U8ZA 3FOEC 5CJ2A 1LDBA 1H8ED 1N8TA 5JARA 4FWIB 2ZUFA 4K5LA 2ATIA 3LY7A 3Q8XA 3ZJXA 3NOQA 2AOXA 2B18A 1C4KA 1E6WA 5REQA 2QLFA 1P74A 2VKQA 1P4GA 4QUAA 3PIRA 3I9NA 4TTIA 4MGZE 3IDSA 1JECA 2CWDA 3KPUA 2E49A 5AVJA 3TIFA 4PO3X 4AR1A 2W4QA 4FOOA 2VI5A 4ISBA 4XB2A 1U8UA 4IJQA 1LZKA 3ENNA 4F5ZA 2Q6TA 1SURA 3KHTA 4JOCA 2CXSA 3DC2A 1N92A 2YV3A 4OPRA 2OORA 2EZ9A 3LFUA 3KB6A 3NAGA 3TLYA 1QIIA 4NBKA 2VZEA 1CERA 3IO5A 3SKVA 5JEDA 3ZE1B 2PD4A 3TWMA 1QKKA 4UVHA 5HQJA 2GCNA 1YZVA 5A06A 2XRNA 1ESNA 2ZRCA 1KDZA 1V9LA 2JCHA 4I1YA 1AH2A 3OIFA 4TTTS 3DF9A 1R50A 1CDDA 2HA0A 1CEQA 3CE9A 4WNAA 1E6MA 1AKYA 5F7ZA 5CEJA 3OQBA 1E8NA 1SEVA 3HMQA 2X0DA 2G7UA 3DAGA 4R6LA 2NUPA 3VU9B 1HFJA 1MHMB 4QDJA 4YJHA 4F2WA 1PZXA 4H6WA 4WZAB 5DE3A 3BMQB 1BROA 1F8XA 1M2NA 2NUPC 1S7GA 2ZJOA 4M8NE 3QBTA 2VRCA 4NG5A 4P98A 2XB9A 1YRBA 5BV1A 2OCKA 3VP4A 4C08A 3OURA 1KJPA 2V0WA 1KTVA 3JQBA 1GRRA 2PLFA 4LYDA 2Z9BA 5KNBD 3T4KA 3QUQA 4FGSA 4F6CA 1F5SA 2PYPA 1M6WA 1YJ8A 2C78A 3EJ6A 3PC2A 1WVMA 5EG5A 4IPTA 4HIAA 1VHLA 1MZVA 3HLTA 2JKFA 1BYIA 3D8BA 2XTNA 4K5OA 3MCWA 1QXSA 1J0BA 4JA2A 2FH5A 4KDCA 4LK3A 3QLTA 1XX6A 3E23A 3JWIA 2W2QA 2GLXA 3SEQA 2FZVA 3VPGA 2YL2A 4QIRA 1DKUA 3FOZA 2AA3A 3NBIA 3LAWA 4ZREA 1GKUB 4D79A 4B7FA 2BNKA 2JI4A 3GNLA 5AK6A 2UUAB 4WERA 1KI7A 3PXDA 4MLPA 3RRZA 4OQZA 2QR5A 4OONA 1HD8A 1RZ3A 1N5KA 1XNJA 4MGEA 4ZQGA 2ZM6M 1CJUC 4JOQA 3BCRA 4NZPA 3MSHA 4Y6SA 2BL4A 4QL3A 3UT5A 3WFZA 4CYMA 3BREA 5DX0A 5IC5A 2Y2GA 4D9GA 1TZ2A 1JIVA 1U2SA 4UTVA 1UGUA 4U0XA 3UV7A 4BNDB 1SRQA 1UBRS 3GC6A 4EB3A 4RKFA 1LK7A 2SHKA 2D2XA 4GHWA 3JZFA 2HNBA 5KOIA 1PJTA 3VDXA 4OGWA 4J1TA 2YZ7A 5B2FA 4WCVA 2NYRA 2H2GA 2XLCA 5CFQA 5FTNA 4NATA 5IRCD 3LUHA 3G2JA 1JQLB 5I01A 2X1HA 3EZ7A 1BLCA 3OMXA 2C8VA 2P69A 2R1TA 3GT3A 2HMVA 3QVJA 4RCVA 3SZ3A 4EX7A 3Q8KA 1GYQA 3U3OA 1NRIA 1OFUX 5EOEA 1YKSA 2XMGA 3W3AA 4NI5A 4WADA 2ZRMA 3WDMA 3DA1A 4CM8A 1KFKB 4P7FA 1AHIA 1TF0B 1R4GA 1VIYA 2PR7A 3R6WA 1NVWQ 3E48A 3KKLA 1DQZA 4MW7A 1C1DB 4B3SB 2BN4A 1NNEA 1F06A 1V1JA 2BKVA 2EOAA 2PD7A 3UB3A 5LN1A 6CHYA 4KPUA 3ZIAD 2Y2IA 4B35A 4L4UA 3W6PA 3IC5A 4O4JF 1NFFA 3EXEB 3LSYA 4G86A 4LRSB 4CZ2A 2HU8A 2G09A 4R0NA 5U4QA 1KYIA 1OD6A 3D1LA 3JZDA 4W99A 2AHRA 5EUMA 4MCHA 4JXXA 1RJFA 3SSNA 3K0CA 5JLJA 4NMXB 5KSCA 2PAAA 3TFQA 3TIGA 4E08A 3A26A 1JSLA 2GO1A 2R751 5EWJB 5B3AA 5CM2Z 5ANRB 2E7ZA 1SXJA 2QX6A 3IIKA 4QYWA 4U6SA 3U44B 1WYCA 1N33M 3F1LA 4HEA6 5EKDA 1GCOA 4B8YA 4OLDA 1R4MA 1KFBB 1RHQA 2QMUA 4HX5A 5F3DA 4BNUA 4FD3A 1Q0RA 1MO6A 2JFOA 3CNEA 3ICWA 4AZSA 4EBBA 5I7HA 3G0OA 3U44A 2WU3A 2PGDA 2UVQA 5FF9A 1YB6A 3OEHA 2IV2X 1YR7A 3R5XA 1U8FO 3WNBA 2BGRA 4NU8X 1Z9GE 3NVKI 2XZTA 4ZZ0A 5KOHA 1M6VB 3S81A 1GSHA 1VHDA 2VRCD 2C5AA 1H0SA 3PHGA 1EWKA 1T2UA 1V2GA 3H1TA 4GIBA 4R5MA 3WLQA 1T5IA 4RQTA 1V48A 2CNKA 4J0IA 2JXNA 1LZLA 1L2TA 1RYMA 2O3UA 2PHZA 3WMEA 1HM5A 4Q24A 1V5WA 5EWLB 4DW8A 2JIRA 1BYWA 4OFXA 3FPFA 3D7SA 4D9WA 1TEMA 3ZC7B 1E4YA 3D0QA 3LQFA 3K0AB 2RHLA 2XZDA 3Q3JB 4IS3A 4QVIA 3PZRA 1K8QA 2C9DA 4D4HA 2PWZA 3JPYA 1UC9A 3EA4A 4TKMA 2Z57A 2Q8QA 2OMEA 3SDZA 4WK4B 5EHGA 5H16A 1FFEA 1KIFA 2E37A 3CLRD 3EQ8A 4ID9A 4IIVA 2O2IA 4KQ6A 1NMYA 4RQAA 4FT4A 3W6OA 4R31A 4BHTA 2B95A 4Z86A 4YR7A 5IC4A 2ZOSA 4TYWA 4U7HA 1HLUP 1S8AA 2VGLS 1KQFA 1P2UA 1ZD4A 1GDDA 2J5RA 4FOSA 4PYLA 1TT5B 2BLLA 2JVIA 5DPMA 4TLNA 4OA5A 1J8VA 2AI1A 2KHHA 3DFIA 5AHOA 3ZN2A 3QPUA 4FCWA 1WKBA 2IWCA 3QE9Y 1PYYA 3Q6IA 4OQXA 4Q3BA 5JCXA 3T4TA 1N9KA 5GONB 3REFA 1GTVA 1UT6A 2G1AA 1ZV1A 1MV5A 1NRJB 2HJVA 3H5LA 3KVOA 4OO3A 3HL4A 4RESA 5LD2C 3RO7A 5HKLA 3A1EA 3CO0S 2YWRA 1WQ3A 4A8JA 2DECA 9ABPA 1TQ6A 4S2MA 3GLHE 3IBGA 5KYNA 1QMEA 4O3FA 4PXSA 3MINB 3RVOA 3DFZA 4A2WA 4BNIA 5IKMA 1YLAA 3UDFA 1JVBA 1G3QA 1TM5E 3A1VA 2B94A 3TV1A 3TRKA 3KW6A 1U7XA 2BMAA 2OP0A 1LI7A 1TA4A 3Q0IA 4NS4A 4QYTA 4LFUA 5F76A 2VDKB 4EL5A 5IK2D 3C24A 4GNUA 2RGCA 3IMFA 3RYCB 2IZOA 3PL5A 3EA5A 5DXFA 3ZKAA 1JH8A 2C4WA 1Q19A 3M0EA 3HC7A 5CA0A 2CNBA 1NN3A 1NW9B 2I7NA 1I2BA 2J31A 4K9LA 1RCTE 1QWOA 3G0BA 5J2UF 4F1WA 2JC7A 1P19A 2J3IA 4KJZA 3U7JA 1NE2A 1SEPA 3DP7A 3A4VA 4GZBA 1GUYA 1ZN8A 3EBLA 3ETNA 3IEUA 4XVCA 4J49A 2I4MA 4JB0A 1LSXA 2IYNA 1HFWA 3H5TA 3PEWA 5T7BA 1OX6A 1LCIA 1Q02A 1E5DA 2WW8A 3WS0A 3VR6H 3GYGA 4DNOA 2ZB7A 3B1WA 2MMGA 3N2YA 1KHTA 2VQ3A 4MQFA 4WGFA 2X42A 4L0LA 4F3TA 4BXOA 2HHAA 3FPJA 2O25A 1FIKA 2VOEA 5BPVA 3U2AA 3V3TA 4CIYA 3AVOA 5AI0A 5E7QA 4AM8A 2MIIA 2VIIA 4WMCD 1G7SA 4H7KA 2VF7A 3DTEA 2IWHA 4D9MA 4MGIE 4OI2A 1QDRA 3L93A 1AVTA 3V7FA 3E1KA 5JANA 3VDNB 2HTEA 3RFCA 1V7PC 5HR5A 3NBAA 3IG5A 3LVVA 3TJZC 1Z6PA 2XUDA 1Q3HA 3MWYW 4PPNA 3KJHA 3WRYC 5GVSA 3PQ8A 4TTPA 1ABBA 1L0FA 3L8YA 2J07A 4N6GA 4ITQA 1WE2A 3LK7A 5CAEA 3LBYA 1T8UA 2BUAA 4XGIA 4I66A 4TTVA 2UZ0A 3O4IA 1G5RA 1JB1A 4HH0A 3RNLA 1PT6A 4CG2A 1RYEA 2GCEA 3VDPA 2P3OA 4IDEA 3WY9A 2D1QA 4CVNA 4OYYA 3HHEA 3GH3A 5SZIA 5A4KA 4DIBA 3JARB 3E5RA 3SBEA 4LHVA 1ZX1A 2O4CA 3CNOA 2P6NA 3GNQA 3QBDA 2AFIA 2JGEA 3KOOA 4KIFA 2BR4A 1NZDA 4G24A 3VNQA 2EARA 3WLSA 2ZIXB 4FXPA 3PNVA 4KZ9A 3QYFA 2UZAA 1M2HA 3H0KA 2BJWA 2V7PA 1KE1A 3S8YA 2NU7B 1HLFA 1LDGA 3K4PA 1CEYA 4MXDA 3ZLTA 1EE1A 4IDBA 3ELYA 4O4HA 4FR5A 2Y68A 1YU9A 3EGCA 4M1WA 5LBRA 2ZM5A 5B5SA 1J0XO 3PXXA 2P2LA 3L7OA 3ZLUA 3N8IA 1DJAA 2C59A 1YULA 4H6XA 1SHLA 2YNMA 1AKMA 1PJ4A 2QRPA 5EMHA 5EJMA 3KT6A 3SM9A 3UUEA 4AN1A 4MVXA 5BWLA 3A9WA 4C30A 4OSOA 3URKA 1BDHA 4OI0A 1VIDA 1M7GA 5KTTA 3F3YA 4BVLA 3JWGA 3R7LA 2A0XA 4PM5A 1SBNE 1RHKA 2JFUA 4OP1A 2ZJ7A 2J67A 1Z22A 2CHUA 3BL8A 2NUPB 3LRTA 4NZYA 1C3VA 1IELA 2HZ7A 2OM2A 5GZ3A 2REOA 3VU9A 4MWPE 4CN8A 4GSLA 3ME5A 3RI3A 3WZ2A 1VPWA 3AQ4A 1XA4A 4ILEA 1Y0BA 2G3QA 1C50A 4KHPB 5B58C 3NBZC 3TBHA 2IEIA 5CNMA 3WGLA 5BVHA 4N1AA 4D4IA 4YPOA 1QQ6A 2ZUUA 4I8XA 1RW4A 2V8BA 1WZNA 3UPUA 1L3IA 4M1YA 3HNPA 2WVAA 4ZK2A 5K8TA 3OZEA 4YXWD 5JXGA 1U02A 2ZR0A 1ENYA 4KUGA 3EW7A 1EHIA 3H13A 1BOFA 4BLOA 3W68A 1BGVA 1KJJA 2OBXA 4NBVA 2VV8A 1KTIA 1GYRA 4MMZB 1JVNA 1FRZA 3C6ZA 1Z82A 4B7CA 3PE3A 5BYAA 4HAUA 1PSDA 1LEHA 1W25A 4ZVQA 4RX3A 5A8BA 1BMTA 1D0VA 2YOGA 3DMRA 2ZQYA 1I0ZA 1EE2A 3BKWA 1KVMA 3KR9A 3NXSA 3QU4A 5CXSA 2INWA 3KTAB 5BOVA 3HR7A 4CT0A 1SULA 1HNWB 1JFVA 4UJ5A 2FHSA 3DAPA 1JPVA 3K9PA 1P8AA 4F1IA 2AC2A 3KOUA 4NKRA 5CR9A 4URHA 5BO5A 5AB2A 3WK7A 2QTNA 1FIUA 4RDCA 2UUCM 1NKSA 3F6BX 3E7XA 5KU1A 3B6KA 4LNUB 2ZB4A 4WUTA 4GPD1 1LC3A 2H0YA 5DNYA 5CCEA 2FW1A 4LENA 2O8FA 1CSEE 1K57A 2OAGA 2P9JA 3PYPA 3GDWA 3JATA 5E2AA 2VWQA 3BFDA 4BPRA 4DJTA 2ZT5A 3QKSB 4LW8A 1D1PA 3RK4A 2ECPA 4LRXA 1S96A 3U6MA 1NA5A 2WE7A 3N3BC 4DPRA 4Q1VA 3DMNA 3P8ZA 3EE6A 3OZGA 3ZWCA 1NHGA 4QE3A 3OLXA 3I9MA 4FB4A 1D0LA 1KJ9A 2EKPA 3V4PB 1OYVA 4ETXA 3PQ4A 2OE2A 3G23A 4IHKA 3UTDA 4DR2B 4Q0JA 1JPNA 2ZK7A 2X71A 1IY9A 2VUSA 3AIOA 3T1YB 2PBRA 5F33A 3C4JA 2GPJA 2HI0A 3ABZA 4C2AA 3CEAA 2CFIA 3VO2A 5LKRA 3KOWE 4YLGA 4YMUA 3W2ZA 3F7MA 3L7BA 1QG6A 3GIWA 4FJ0A 4M9ZA 4PX5A 4CM9D 1X7YA 4A16A 5BSMA 3RRBA 1N1GA 4G5QA 1PJQA 2YJNA 3C8HA 3O4JA 3OC6A 5ARDA 5HJ2A 2IV7A 3MT9A 3V4SA 3WR5A 3HJFA 2YHUA 1JLLB 2YH2A 1GKYA 1S2DA 3JQ9C 1ZIOA 2XGNA 3QKIA 5AIBA 5HUQA 1GABA 4D0LB 4BQFA 3LVWA 4BN4A 4DXHA 3ADDA 2Z4SA 3T6PA 2BBTA 2IOFA 2ZIAA 1L0GA 1N9GB 4OXYA 4ZO7A 1BFDA 1JDZA 2PTGA 2DAEA 3FCSB 2VF2A 4G4QA 3OCZA 3UKOA 3STWA 2J3MA 4G0NA 1XOIA 1I4WA 2GN8A 3RRXA 4XBOA 2YW9A 4GP7A 1QLWA 2IELA 3H2KA 3RLFA 3ZG9B 3D4PA 3UKDA 3K6KA 1H3NA 4MH0R 2RH8A 2WTNA 3E9ZA 4IDHA 3H1FA 4QDUA 1XJ2A 4KENB 4GLLA 3SWWA 4Y0UA 1MVOA 3CT6A 3KXLA 2DBYA 4KXLA 1NXYA 5CEDA 4PLVA 4HV4A 4QTYA 1RP7A 2YVAA 5E9WA 5KAPA 4ZEVA 1ZDMA 4CLEA 3D8SA 3L4KA 4AN4A 4KITB 3L8HA 2FSFA 1J97A 1Z4MA 3M6BA 1I8TA 2LKDA 2X8BA 4HQOA 3ROXA 3E18A 4CR8A 5BORA 2C9OA 2CDNA 5T57A 2FZEA 4JY7A 1BSVA 3BH0A 4YGXB 3L7JA 2OD7A 5A7HA 5L9AA 1DJLA 3NHPA 2J09A 2Z5GA 3OZBA 3U4QB 1W36D 2ZTSA 4OB8A 1C0EA 3TQQA 5ICEA 1S4SA 3EZ9A 5H3LA 5A92A 1K7SN 1U3GA 3A3YA 4I2VA 1QMHA 3ABOB 1MKMA 3L8CA 4O02B 1PFWA 4L9EA 3FCUB 1OLOA 4LXYA 2HK9A 4WURA 3WYNA 5B37A 4GZLA 3QP5A 1BEUB 3QPBA 5CA1B 1AHNA 4FTXA 1TIBA 3OQIA 3RD5A 2G9VA 4LV1A 1CCWA 3KV1A 4PBTA 4D9KA 4DSAA 1U80A 1XB2A 1ISGA 2VBFA 4CKEA 1MQ8B 3A1WA 3K94A 2OQ4A 4RHUA 1DRJA 1HT3A 2OSVA 5KJEA 3V4VB 1LNZA 2EIXA 3C7KA 3VI3B 3D8RA 3WS2A 3B3JA 2I4OA 2EVWX 2OGUA 2G0NA 3DW1X 4TS4A 5CYFA 5DHUA 3WGVA 5FBZA 5I9LA 3L0ZA 2WGWB 3I76A 1E3SA 4ITUA 3S2SA 3UFXA 2J7KA 4C1BA 4LF4B 2WVHA 1E3MA 4ETMA 2EEPA 2GTIA 3BZUA 4RVAA 4PYNA 4QPRA 2COEA 4JI6B 4EHFA 4UFPA 1SUCA 5JSQA 4W9MC 1PTKA 2ODEA 3JQGB 3WYEA 3PXPA 1ANKA 3MS3A 2GZ2A 1Y5IA 2ZRFA 3UGTA 4JLNA 3ZWPA 3E9SA 4NMHA 1V1MB 3TTYA 4TLMB 1JMKC 5EQTA 3F6CA 1EGQA 3D5EA 3ZCSA 1D7AA 1U9IA 1WQ1R 1W5SA 3FUMA 4MWBA 3W5VA 1O4VA 3R3WA 4QO7A 5EMKA 1GJSA 1C7QA 2X01A 1RAIA 4MWTA 4TSFA 4ZAYA 3WGZA 4PYOA 5JY1A 3LLMA 4K9NA 5MFPA 2VPYA 3QLVA 5K20A 1J90A 1KZYC 3OM8A 4I99A 2YQ4A 3HHYA 3FJ1A 4K86A 1F12A 1TUBB 2DGDA 1N32M 4LZLA 4N39A 1Z62A 1AF7A 3C87A 4RIIA 1VCMA 3UXEA 4RGQA 1Q0TA 3R09A 1HNXB 1JIUA 5IWAB 4DUPA 3AEXA 3N5KA 1MQSA 3OPLA 3KTFA 3M70A 1DCMA 1KVSA 2J1LA 2X23A 1CPYA 1ZDPE 3BSSA 4YJ3F 1WW8A 5THQA 3VKUA 3BJNA 1F6WA 1Y1PA 2HDOA 1QQ7A 2XECA 2AC4A 3AILA 3IWIA 1B6GA 2A1TR 5JYOA 4G1MB 4WZZA 3WIBA 2QVLA 2JB9A 2VZ8A 1QORA 5CW1A 3HGQA 3RFTA 2ZJ1A 2Z83A 3LKBA 4NSRA 4KWHA 3IDQA 1TYEB 2X7JA 1SC3A 1KC1A 4MVWA 3VV4A 1Z68A 2IP4A 3EYAA 2XE8A 1ZMXA 3ECAA 2BFBA 2EZUA 3G0GA 2R5WA 3H4IA 4P2GA 3UK2A 4AYWA 4F4JA 5EIHA 5DP1A 3DZKA 4HNQA 1EFUB 2QN1A 1KE0A 2FK7A 2W1RA 3HYNA 4K03A 3D8LA 3G2YA 1ACLA 1Q7TA 1U04A 1UBKS 2BZ1A 1KDYA 3UG6A 4KZPA 1S4QA 3T35A 2IE8A 4DOMA 2HDQA 3KFXA 2O1EA 3BGVA 4YHHM 2N9UA 4KZBA 2HRDA 1R1DA 4J0FA 5I9MA 3MFYA 4KV7A 5LQJA 4BNWA 1QHHA 4R3JA 3KM0A 5TMNE 1I2SA 1K27A 1USWA 3AXSA 1V8BA 2R78A 4LQ4A 2PUAA 4MB7A 2XWPA 1ZUWA 2M6KA 5HKOA 3RJZA 1UKAA 2GRJA 1YLPA 2D5AA 4DY4A 2PL9A 2QSYA 4D0SA 4HYEA 5I7UA 5HEKA 3C8UA 4QULA 4H7DA 4A1OA 4DLWA 2O8EA 2B3TA 2BH9A 1FLAA 4P58A 4C6TB 3URMA 1JDVA 1MJHA 1XR3A 3PAEA 1ZJYA 3GU3A 1GGHA 4E14A 5ICCA 2AFHA 4FN5A 3LGAA 3S22A 1FP7A 2WSFF 3UNWA 3BJEA 4LRTA 3MBIA 3PR2B 4RA9A 2GFQA 3U5TA 5C3MA 4D80A 1A27A 4N1HA 1TYZA 4PPYA 4XUDA 1OFTA 1D03A 5LQNA 3IPLA 2J6CA 4HGOA 5H5JA 1Z4JA 4UNRA 1U3CA 5C1OA 4X66M 1DARA 1SOVA 4AXXA 4GR9A 4ZO6A 1YCFA 3OQOA 3WQBA 1IULA 3KZCA 3NQZB 4MV6A 2A9OA 1JKFA 1Z2AA 3ZU4A 3SQXA 1NHWC 1M0TA 4JQSA 2TMDA 5KPTA 3DS8A 1TB4A 1KO8A 2OOSA 1UF9A 3OZIA 4HBZA 4HP8A 3ZR4B 3W67A 1UXHA 3VFFA 3H1AA 3I6IA 2Q41A 2WD8A 2RI0A 4NULA 4S2UA 2P5UA 3E4OA 4IOJA 1G8AA 1M1YB 1YR3A 4Y18A 2R6GA 3F4BA 3MEQA 3SYLA 3AEKA 3TI9A 4DN6A 4EG6A 5LWHA 1GZDA 3ZJUA 1FX1A 1QVAA 1DS6A 1IXRC 4IJUA 5C1BA 3HSYA 5D3MA 5DO9A 4ETNA 2UUBB 4R8RA 1MT0A 4MWOA 4ZW6A 2I6XA 1A3CA 4BAGA 1MJ5A 4P2BA 3A6FA 3VAYA 3LLSA 1CP2A 1C41A 1C9EA 1R37A 5JG7A 1U0OC 3V7NA 1TO6A 1F8GA 1M6NA 4DMZA 1WXEA 2A9VA 3NHYA 1EQ2A 3BWXA 3CTPA 4HB2A 1P9WA 1YFJA 4RGYA 3JR3A 1ISIA 1BVSA 2ID7A 3Q0EA 4S2NC 4OP2A 1Y37A 3ZE8A 4Z3KA 3T1VA 3DLBA 4HAWA 3AYXB 5J23A 2FLWA 4KHZA 3ZV6A 1YBFA 2H1SA 5CLHA 1L7VC 2UV8A 3VAAA 1GFIA 4H6JA 3GPCA 4KGDA 4J1NA 1IWOA 1FCOA 1JP7A 2RB5A 4MZNE 3HLCA 2JBWA 3CEJA 5JZSA 4MNTA 4HAYA 1K8XB 3DV9A 4YRAA 1K08A 4MBHA 2HO5A 1LI0A 1JDBB 2FRVA 3C7CB 3ZHOA 1N2IA 4TKVB 3R3YA 3I64A 3HUDA 1N2BA 3GJQA 3I5AA 1BDBA 4RPJA 1QGUA 1S89A 4B6JA 1RZRD 1ZC3A 3O1JC 3VKHA 3I0NA 2NQ8C 5HARA 1C0LA 3SN6A 1GGFA 3E1GA 1OQYA 1G16A 1U0LA 1AU9A 1TJ4A 1CDEA 2ERYA 3ULFA 1T8YA 4OB6A 4F2LA 4Y6RA 4ZVLA 5L51A 3KVWA 3O9ZA 3REQA 2P35A 2IUEA 3C3XA 4TUWA 5B58T 3TJZA 2PH7A 2WA2A 3A1UA 5BN4A 1ERQA 3EWKA 2JP7A 2X58A 4R3DA 1QYXA 1U0JA 3GL9A 3NYIA 1J0DA 1OTYA 3QKSA 2CJFA 4NESA 4QHSA 1DDGA 2VPXA 2CW5A 4O25A 1ILWA 2GPSA 1XZ8A 3U4IA 3L5KA 2KX6A 3NBXX 3H82A 2VF8A 1EE8A 3SSBA 2OTCA 2R8PA 4FGZA 3BE8A 3NH9A 1PS8A 2BFEA 4Q4EA 2PZEA 1MC4A 3H18A 4Y2PA 5C53B 4A3SA 1ZRNA 3NRCA 3V8PA 2H4JA 3BFCA 4CNQA 3O90A 1KK3A 2IT1A 1YIOA 3I37X 1A9RA 1ZUNA 4MB2A 1T24A 3HDTA 5DWQA 5E0KB 2F5NA 5HIIA 4DCGA 1XPRA 1ADFA 3AUFA 2YXEA 2HYIC 1PU2A 3R6DA 2Z3XA 4JQCA 4Q3EA 4Q9DA 2WAYA 4R8KA 5FOWA 4JSYA 3KU1A 3L6UA 2G5CA 1NPYA 3C30A 2YXBA 3IUYA 5DTJA 4D99A 3A3NA 3K92A 4E6WA 3E2LA 5H4HA 1U1IA 1SXJC 1NSYA 1O97C 1OBVA 1SFRA 3DEFA 3ZHHA 1XA1A 4XUXA 4AJNA 2G08A 3R8FA 3BJZA 1DOAA 1I3OA 3G9XA 3KVYA 4YV1A 2EXXA 4LA4A 3IXMA 5DXAA 3W6ZA 4DVGA 1IN8A 2HCRA 3DW3X 4IBXA 1AX9A 1WDLA 4PC6A 4CQJA 3RGPA 3ITEA 5FLYA 2Z1DA 1GCAA 1TVKA 1M67A 2J5QA 2D8AA 3DR5A 3KCNA 4N48A 2DPHA 3ZEAA 5FQJA 4QARA 1I2ZA 1Q7GA 1H93A 3ICVA 5ALUA 4DWVA 3W77A 3VAZA 3ZS9A 5EIWA 4AC9A 1TS7A 1KOUA 1L4UA 3SG0A 3SXUA 4ZW5A 1ESMA 2HXGA 1P60A 4LWZA 4AY4A 2XTJA 2XOKD 1CFZA 2P9TA 4OP3A 4Q1AA 1OIZA 3ZWDA 4CQMB 4RPIA 1QIJA 4G84A 3DDHA 4BZWA 1VHMA 2VNJA 3LY5A 3H5RA 4YROA 3AR3A 1T5HX 1YJXA 2A0WA 1CQJB 1JHAA 4W9RA 2XVXA 2WFLA 5D5PA 4A5OA 4GMFA 4JUIA 1PG2A 5C32A 1FW8A 3ISTA 1FNDA 3BXPA 1NXVA 3QE2A 3UYLA 2YZMA 5AW8A 1WXDA 4JUFA 2ZC4B 2AR9A 3AI7A 1PT7A 4RKWA 4BJ1A 2BTEA 2LWXA 4XX1A 4UEYA 3PPIA 1PK9A 3ZNNA 2XBLA 2DAGA 3HU5A 4IXMA 2Q2OA 3PVCA 1Y82A 3G2ZA 4HNVA 3UOGA 3H11B 2GB4A 4MX8A 4RANA 3IEVA 4S1TA 4LY3A 4PS0A 1ZZEA 4ECAA 1BZAA 3GPDG 3NV7A 4OHPA 4QHYA 1ZN7A 4BO9A 1FFGA 2QRVA 2ZC6B 3A0RA 1RLTA 3KYCB 1MABA 1H1TA 4O29A 5AW0A 3ZDBA 5EIAA 1E9AA 1WCXA 1H5XA 4R3BA 4E6XA 3SM3A 2WLSA 1XZQA 1XWWA 5LYJF 5FBVB 2ONKA 1SIUA 1VB6A 2VXCA 1Q0UA 4IEIA 4MCWA 1LSJA 2OLKA 2GFIA 2G9QA 1BVUA 1QTQA 4EENA 6AT1A 1JGTA 1ZM4A 2AVNA 5LZ7A 2WADA 1YR9A 3I9JA 2JLSA 3J7TA 5FWDA 4BMCA 1AGRA 1TTHA 3PR3A 4JBWA 1M73E 3DVAB 1OC4A 2I3BA 2LZ0A 3E61A 4LUCA 3LUAA 4Q39A 1Y1RA 3L1HA 3VGJA 5C80A 5ESRA 1I7NA 4QQ8A 3ZVTA 1KI3A 4I46A 4M0UA 4R3WA 2DWNA 2EUCA 2A33A 1U4GA 5EM0A 2P77A 2YC2C 4Q18A 2O9BA 4I3IA 3QLUA 4CFSA 1DFHA 2DTXA 2FWNA 5AO9A 4ZJYA 4BX8A 2WHYA 1FSGA 2JGNA 2VQEM 5FWXA 1DO2A 1VHWA 5IEJA 1MPXA 2I7TA 2O7RA 2WD9A 2W1TA 3S29A 1DP4A 2Q9CA 5JMTA 3TLIA 4CHTB 1PNQA 3OFND 4F5WA 4MV8A 3TH5A 2OP1A 3TRFA 1UR5A 5FADA 3KR1A 1SKAA 2JFZA 3K6SA 2NP6A 2IXDA 1LSSA 2PR6A 4F6RA 1QBGA 1D6JA 1L5KA 3C4PA 5E1BA 5HRCA 1NF3A 2CFRA 1UP4A 1L8AA 5JQWA 1L2DA 3DCIA 4HH1A 4BUZA 4B3RM 3ZXUB 1E5QA 2XE4A 1JYSA 3TAUA 2R66A 3EULA 3ZHBA 4DQKA 3AUKA 5CA1F 1E0AA 2G25A 2G17A 1F48A 3OLYA 3VISA 2IHNA 1FQWA 3QU9A 3P2KA 4X24A 3TGWA 1FW6A 1Y4ZA 3EVAA 3VI4B 2A0YA 3ZWXA 5FQ9A 3T3DA 2XXJA 2D74A 3II6X 4PVDA 4QU9A 4R05A 4UDNA 4ZU6X 4UAVA 2VDVE 3WDSA 3IJ5A 3MTIA 4QXOA 5JV5A 4DV2B 3DGEC 3FZNA 4C7OA 4B3SM 3Q7QA 3M4NA 3NTLA 4KC0A 3E21A 1EGMB 3O26A 3ZCTA 4DHEA 3GUCA 3C98A 4JXGA 2W7TA 3EBPA 5AK3A 3UWDA 2DWQA 1UM9A 1Z2CA 1AQ6A 3QVOA 3QXGA 1FDOA 2JE5A 4RTJA 4QGAA 1YUBA 3BD7A 2CEKA 4EV4A 3DZ5B 3W4IA 4OOMA 1FP1D 3EZGA 3FDIA 1RR6A 4K87A 4GLQA 3QG5A 1DTWB 3LBIA