4II7A

Archaellum assembly atpase flai
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
512
structure length
504
Chain Sequence
SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGEIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FlaI ATPase
publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
total genus 156
structure length 504
sequence length 512
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ii7A05
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ii7A02
3.30.360.100 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ii7A01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ii7A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ii7A04
4LSGA 2J1LA 621PA 2CNWA 3QY0A 2OE2A 3KTAB 4IW3B 2O5VA 3ND8A 4QBIA 4FMCB 4F4JA 1VCMA 4H1VA 2Y8EA 4A15A 2UVQA 4IXMA 3SYNA 4R98A 3KB1A 5JJKA 3LFUA 2C96A 4O3MA 3QI2A 1XTJA 1W36B 1D6JA 2OEPA 1SQ5A 1WP9A 1ZNZA 2ZRFA 3I62A 1P5ZB 1QHGA 1XF9A 4HZIA 2CK3D 5KNBA 2DCUA 2ZSAA 3QIAA 5CYOA 5BYKA 3REFA 1UEIA 4P4SB 2F9MA 3ZVMA 1Q3TA 3A1TA 1NLYA 4DCSA 1TUIA 4NYJR 4DC9A 3NC0C 2C03A 2FSHA 4HUQA 1AN0A 1R0WA 2BWJA 4PFSA 4RSGA 5FPSA 1FL9A 1KI2A 4Q47A 2C78A 1KI8A 3CPHA 1KO8A 1DAHA 2FFQA 1ZC4A 2JDID 4HAWA 4Q1EA 3V4FA 4QGGA 2R6AA 4WXRA 4MYCA 5DHFA 2XB2A 2OLKA 1BMFA 1KHTA 4MUBA 3VR5A 3EIEA 2IW3A 2YNMA 2FU5C 1QHIA 2EU8A 1E2KA 3CZQA 2REXB 2H92A 2Q3HA 1C1YA 4MRSA 4LGMA 4U00A 1L7VC 2ZRDA 3CNNA 1WMSA 4LRWA 4ABYA 3AKYA 3C16C 3K53A 2A5FA 4U5XA 3QXCA 3U4QA 2GXAA 2BBOA 1UBGA 4UNSA 2KE5A 4TLBA 1DAMA 4E5UA 3MWLA 2OO7A 4K8OA 1T0HB 1E0KA 1Z5ZA 4BFXA 2CLDX 3WRYC 5HTKA 4AG6A 3AVXA 1NN3A 1YJ5A 4TMTA 2HV8A 4Z8XA 3PUYA 3GPLA 4PHGA 4QC2A 3GEEA 2FMXA 2IWRA 3FHTA 3P1JA 4Q48A 1AS2A 5CK4A 3SE0A 1UKVY 1MABB 1TUEA 2GJAA 3KFVA 3RS0A 1KI1A 3QSYA 2NOAA 4EDHA 4Z1MD 3IILA 2ONKA 3FE2A 4M1MA 3QKSA 2HEIA 1G17A 4DCVA 2HXYA 2Z5FA 4L8GA 3CPEA 3WBJA 4HB0A 3ZGXA 1KMQA 1G20E 1H8HD 4LYFA 1ZYUA 5EXSA 2BC9A 1A5TA 2W0SA 2YZ2A 2VSXA 1PUJA 4KBFA 1FQKA 3KUCA 1RRFA 1IY0A 3GJ4A 2O8EB 4HLQB 4A0RA 4E22A 2MMGA 1T9HA 2Q9AA 3RAPR 3PENA 1P3JA 1HURA 3RWOA 3VFDA 2GEDA 1JXOA 4KXFB 1DG3A 1M6NA 4RY2A 2BBTA 2C2HA 4QRHA 3L82B 5KNDA 1R7RA 2QP3A 1GIAA 5FTKA 4I4LA 2JJ1D 3SBEA 2ZVQX 3LVRE 4LV6A 4KFRA 5C1BA 2J87A 1HEIA 2BMFA 4Q1FA 1NLFA 2UZIR 1N25A 1ZMXA 2BOVA 4P4TA 2VSFA 1IXRC 4PSKA 2GCOB 4EJSA 3FTQA 3M4YA 3UMRA 4E07A 3SDZA 3EIQA 2W6JD 4GPTA 5L3SA 1M7BA 4W5JA 4XTCS 4POAA 3AQ4A 4HLUC 2ZJZA 1Q57A 3MWKA 2A5YB 4JL8A 1D9XA 1AS3A 4X8HA 1S9DA 3WMFA 1G5TA 4LUCA 3OE7D 2F7SA 5EE3A 4EPVA 2DFKB 3B1YA 2ZE6A 3OIVA 3AP1A 1N5JA 4KV9A 1GITA 1UFQA 4Q9KA 1NRJB 4Q02A 1VIAA 2ATVA 2HT6A 1GNRA 2MSCB 4Q9IA 4AYWA 4M21A 1Z83A 4JLVA 3CF2A 4DT1A 5B58C 3CPJB 1IQPA 2AHOA 2IX3A 4LJ7A 1AK2A 4AKIA 1AKYA 1QDEA 2IYQA 3ZVRA 3K70C 5EE5B 4KVGA 2YOFA 2OCAA 5SZKB 4O0MA 2PT7A 4A92A 3TSOA 5FTMA 2QU8A 3IDQA 3BH0A 1GL9B 3RHFA 4DWJA 3UPUA 1T3LA 4S2EA 2QTVB 3LBIA 1RIFA 3FMOB 3SEAA 3FYHA 3K70D 3KZ1E 1XTSA 3NC1C 2ZM5A 3ZD6A 1FUUA 2QNRA 1TMKA 2OCPA 4BLPA 1U8ZA 3FWYA 2QGNA 4TL8A 2NO0A 3K0CA 5F9FA 1NN0A 1XEFA 4B47A 3TLXA 4TLDA 4RKEA 1G6OA 4PTLA 2NO9A 3U44A 1T6NA 2RCNA 1S4QA 4TL9A 5BN4A 3K70B 2C04A 4P3YA 1E1RA 1KJWA 2QPOA 4M1TA 3TAHA 4OQFA 3PXGA 2UZ3A 2WKPA 3TUZC 3Q72A 1HY3A 4DCNA 3AP2A 3NDBB 5JWRA 2IYZA 4XTRA 1GNPA 2J7KA 3GLHA 4PX9A 2NO7A 4WZAE 1NIJA 1HYQA 4R7ZA 1T5IA 4FW9A 2BMEA 2HYIC 2I4IA 3I72A 1R0XA 4YXWA 4B33A 4YMTA 3LNCA 3VKWA 1T5LA 4PC7A 4XH9B 2XEXA 3K9LA 5AUOB 4FCTA 2LCFA 1QF9A 2JCSA 3KUDA 2ZAMA 3EG5A 4OQNA 3W6NA 4UJ3A 3QXJA 1G291 2ZJ5A 4HZUA 1E2GA 2P5TB 2GXSA 1XJ0A 3K0FA 1MO6A 1NVVR 4FINA 1BH2A 3ZIAD 2ZRNA 1M2OB 2ZIAA 3K0AB 4PO8A 1IXZA 4MGYR 1YZUA 4DKXA 1G64A 4D26A 2BHRA 3QF7A 2RH5A 4BZQA 1JB1A 1UKEA 2DWQA 3MD0A 1FZQA 2HF9A 3GJ7A 4ZV4A 2O0HA 3BXZA 2FWRA 3HYTA 3MFYA 1OF1A 1G9XA 2JJ2D 4Q4LA 3X1DA 2IEZA 2OFXA 4MKIA 5CDFE 2WWYA 4QJ4A 3CKLA 2DPXA 2G0NA 3A4MA 3OAAD 3CIOA 5FBVB 5DLQC 4IDOA 5FTLA 1F48A 3ND9A 4DEYA 4LCBA 2OESA 4PHTA 1DOAA 3W3AA 1MR3F 3B1ZA 4BLQA 1W7AA 2HYDA 4KITB 4MA4A 1P2UA 4L4UA 3B60A 3W3ZB 1HE8B 1U0LA 2Q9BA 3EZ7A 4QHTA 4DDUA 3AUXA 4M2LA 3TVTA 1PLKA 1XD9A 1JPJA 1JJ7A 1SVLA 2I3BA 3EZ9A 2XZOA 1P2TA 2GDJA 4V0MA 5G53C 2EFHB 2QQEA 3EWAA 3ZZUA 4OQMA 1IOZA 3IIMA 2BMJA 3LAWA 3LO5A 2E1RA 4V0KA 3QBVA 3UIEA 4X8OA 3A4LA 2J0VA 1QVRA 1E79D 3PIRA 1A1VA 2ZXUA 1GRQA 5FOUA 3NXSA 3GLGB 1G41A 3QBTA 1XWIA 4G1UC 4HDCA 4WXPA 1XEWX 1YR8A 2OLJA 3UKDA 5EZ6B 1FX0A 1WQ1R 2ORWA 2C9OA 2W00A 3OZXA 1ZNWA 3U61B 3ICQB 1GTVA 2OFWA 2JIZD 1Z6GA 3IHLA 2GXUA 2J3EA 1LS1A 3G5UA 2NQ2C 4MGZR 4DCUA 1CP2A 3ADKA 5JZVA 3GLGE 2ZUBA 1XMJA 3TGPA 4B73A 2ZU6A 5C46F 1R8SA 1Z3IX 2PX3A 3LLMA 3BAFA 1YVDA 3R9IA 1ZUNB 5HKKD 3AKCA 4R71A 4GOJA 4FD2A 1RW4A 2V7QD 2GF0A 3FKQA 3QPWA 3ASZA 2CEAA 2YWEA 1XMSA 1DPFA 4Q1DA 1N3BA 1G7RA 1EFCA 4ACBA 1OPXA 1AGRA 4FN5A 4OI1A 2QMOA 3U3OA 3J81k 1NNEA 2JAQA 4JKIA 5LDDC 3VKGA 1W4AA 1NIPA 4V02A 3S1AA 3W9YA 4NYIQ 3CNOA 4BPBA 1Z0FA 5L3QB 1GG2A 4KJZA 4UNNA 2VHQA 3KKQA 4PHFA 1U9IC 3O8CA 2ORIA 1L4UA 4RD1A 1UM8A 5K8TA 1VCNA 1R5BA 2HJGA 4TL7A 1AM4D 3GJ3A 2ZROA 2EWVA 1D2MA 4PXAA 2ZS9A 1H8ED 2WWIA 1QHNA 4G5RA 5A0FA 4C30A 4F91B 5E4FA 2V6JA 2ZYWX 3H84A 5HPYB 3R9WA 2ANCA 2O0JA 3LXRA 1FUKA 1QZXA 3EWSA 3TR0A 3ADBA 1G19A 1ZAKA 2RGBA 1GNQA 3I32A 4HUTA 5FL7A 3FKSD 3UG6A 5C4GB 1Q22A 1LB1B 1M7GA 1RE0A 2RGEA 4LV5B 2LKCA 4QBGB 3KQNA 1S1CA 3NHBA 2RGAA 5EUQB 3C5CA 4US1R 4PZZA 5FR1A 1ESNA 5BN5A 3P32A 1J99A 3CZPA 3WYGA 5FOSA 4JIMA 2FPMA 2ZTSA 4LBZA 2AXPA 4QBFA 5E7IA 4CEJA 2H7VA 3MCAA 2NIPA 4FMCF 3EASA 4R9UC 2D7DA 3RSOA 2ZPTX 1KMHB 4XD7D 2ZI9A 5SZJA 2J7PA 1US8B 4F92B 3LW7A 2FNAA 4A36A 4TYPA 2C95A 2YV5A 4ARZB 2G0TA 4KBGA 3CUEF 2ODBA 3RS3A 1CU1A 1E4VA 4RZ3A 1E2JA 1YQTA 4I1OA 2VP0A 1E0SA 4IVPA 4BLRA 4Q9HA 2K5UA 4OQLA 3O8DA 4NH0A 2J41A 4KYUA 4D4JA 1NY6A 4RZUA 3AVUA 4L16A 2J0QA 4M8NE 1SXJA 3B7GA 1EESA 1P60A 1U99A 5BW8A 1R5OA 5LBIA 1XD2B 4IEEA 1OXTA 2FE4A 4RKFA 4NKRA 2W6IA 2FZLA 2RHDA 2AL7A 2V54A 1NF3A 4UXHA 2WM9B 4ZCLA 3SHFA 3TSWA 4F7WA 4C7OB 5ELXA 1X8KA 4D81A 4PC6A 5DE3A 4C4PA 3KXIA 1PZNA 2CXXA 1XTQA 1DG1G 2GJSA 2QPTA 3LQQA 4DLUA 5DGXA 4YMVA 2JLWA 5FR2A 3H86A 3AKDA 1TEXA 1E2LA 2A5JA 2HXSA 4RD4A 5H70A 2QT0A 2XJ9A 4NL4H 4QNMA 5JCPA 4BZPA 2XXAB 3OEHA 1JR3A 1Q12A 4NHOA 2F1RA 3TRFA 4PPNA 5JFGA 5FBRB 3B6EA 2IYWA 3BERA 4DUGD 3NBFA 4F4CA 4PPGA 2FSIA 1QG2A 5JJIA 2ZUCA 4P4SA 1QG4A 1P9NA 5KU1A 1W1WA 4KHZA 3VHXA 4JVMA 1P61B 3GEIA 4LPKA 1E99A 5KPDA 1JEEA 2C5LA 2A30A 1M8PA 5FUXA 1II0A 4DDWA 1Z29A 4LOAA 2IEYA 3KJHA 2YHSA 3GLIA 1KK3A 2FJUA 1UPTA 4URUR 3U3KA 1E2DA 2QZ4A 2VL7A 3RNLA 4QKQA 4X8MA 5CJPA 2H17A 5A5GA 4O25A 3TUIC 4W5WA 5IHPA 3NBZC 1NL3A 3KQUA 4Q5IA 4XVUA 4A0FA 1L4YA 4P31A 1JEDA 2ASEA 4A82A 4AYXA 5FL3A 1XCPA 1KO1A 1ZRHA 3MAAC 2IT1A 4L5BA 2QP9X 2XNDD 2P6NA 4H1UA 5TVKA 2RHMA 5LD2C 4M9SA 1SVIA 1UADA 3R8FA 2VF8A 4H9GA 3RRYA 2CJWB 2R62A 3LBNA 2IUTA 1E2PA 4NYMR 3A58B 1KOFA 4LHZA 2AFHE 2VHTA 1A4RA 2TMKA 4IVQA 1KNXA 1M1YE 2RAPA 2GTPA 1G6HA 4MYTA 3A1UA 5JSZA 3AVTA 2RGGA 4DRZA 3U7EB 1ZUHA 3UANA 2N1BA 2XSZA 4Y0VA 4JJZA 1XCMA 1WF3A 5JEEA 3UG7A 4GDFA 4PQYA 5DI3A 1LNZA 1XXHB 5CIWA 1R10A 4CYMA 1VYVA 4DIEA 1RPZA 4US2R 4QHYA 1QHYA 2PZFA 2QAGC 1EFRD 2EW1A 4TTPA 1IN7A 5LD2B 4A0HA 3BWDD 4B3BA 5GADl 1SULA 3MLEA 2QM8A 2XTZA 4OI0A 4XSHA 3BE4A 4UJ5A 1N0WA 3DKPA 3HU3A 1UEJA 3D3QA 3PV0A 5AJXA 4Q1CA 5KO2A 2Z83A 3W34A 4RZ2A 1A82A 1JQLB 2PZEA 2AFIE 1S96A 2FEOA 4JL6A 4WOPA 1ZJ6A 4A8JA 5JWHA 2WTUA 1NVUQ 2R65A 2WWGA 3SJCA 3A1VA 1CR1A 4G01B 3BRWD 4LC0A 1R4AA 1XU4A 3QF4B 1W48A 3NG1A 3W8NA 2DB3A 5EQTA 4A6XA 3LX8A 4PC1A 3HPRA 3L0SA 2J59A 1QVAA 4JBWA 3BC1A 1T0JB 3CRVA 1NKTA 4HDQB 4RFSA 1Z2CA 5M04A 1IBRA 3DVLA 2QAGB 4EPXA 3AH8A 2J5XA 3OF5A 2YWHA 2JASA 4KYIB 1E2QA 2C98A 1EFUA 3HR8A 3TAUA 4DIDA 1N5KA 1OKKD 2F43A 2A9KA 3LLUA 3HPQA 4M1WA 5JS7A 1PV4A 4NZYA 3B78A 3RS7A 5HZKA 1A2BA 2H8KA 3SU8A 1IN4A 1XJCA 2HLDD 2PMKA 3K09A 3A6PC 2DWOA 2OAP1 2EYQA 2NG1A 2QQ0A 1K5GA 5J5CA 2GZAA 4W5HA 1N0UA 2IYXA 3I5XA 1EX7A 3BH7A 1QHHA 4XVRA 4D2IA 4BWYA 4J0QA 4AKEA 1VYUA 1O87A 2WSMA 1XPUA 2VHCA 3A4NA 4OHZA 1WB9A 1NG9A 1F2UB 1F6BA 4PAQA 3U7HB 3OEHD 1JR3D 1FTSA 3THYB 1XEXA 3R7WA 1KI9A 1DO0A 2VHJA 4RD0A 4YMUA 2WBLC 1KDOA 3Q9LA 1ZM9A 4Q7LA 5FFMA 1PUIA 4OHXA 3AF1A 2ZETA 3IO5A 3M6AA 1TQ4A 1MOZA 4RD6A 5FH9A 2WKRA 3AB3A 2ZQ5A 2VQSA 1KKLA 2GILA 1IONA 2Q6TA 4NBSA 3EPHA 1LF5A 1WXQA 4ASUA 2OAQ1 5HZHA 1SKQA 2R6GA 1KSFX 5C18A 2PX0A 3U6KA 3AF4A 1KTVA 4D4LA 2IS4A 1VPLA 1XDBA 4YLGA 2VO1A 1G5PA 2PZGA 2QBYA 4LYHA 4BRUA 2Q3MA 2WAXA 2IC5A 4Q1AA 3V00A 2QENA 3W5IA 1JR3E 4EPYA 5DN6D 1BKDR 2C9CA 3CRRA 2B21A 5FOVA 4MQBA 4B48A 821PA 1BO6A 3HU2A 3SOPA 3JVVA 2ZE7A 3L8ZA 5EE1A 4DB2A 2G9NA 1P75A 3CX6A 1P62B 5C2JB 2QE7A 4I1VA 3O8BA 4Q4JB 3NEYA 3DDCA 721PA 3GD7A 3IO3A 3GFPA 4YDHB 4CF7A 4Q1BA 5TXGA 1U94A 2VEDA 3U3MA 4DSNA 4Q4AB 3EC2A 4BFTA 2ZSDA 1P6XA 1QBKC 3A1WA 3X1WA 2FFHA 2PCJA 3RS4A 4LZZA 5HCNA 2CCKA 4KU4A 3MMPA 4V0LA 2P0EA 5F98A 4BE7B 3KB2A 4FMDB 2C99A 2VPPA 3K1JA 1G8PA 4HSEA 4EQ6A 3VU9B 1W0KA 4EFLA 5TMPA 1CLUA 4M22A 5FOXA 4AG5A 2XJ4A 2P5SA 3Q5EA 5K8UA 1RJ9A 2VIIA 5HCIA 1J90A 2BMDA 2BV3A 3A1SA 3Q8XB 4B6FA 3MJRA 1DAEA 1T91A 1G16A 3Q5DA 2KBEA 2W0MA 1D5CA 4BQSA 4DLRA 2ZRMA 4JLNA 4OK3A 3V9PA 3EPKA 5F2EA 1CJVC 1TPZA 4LJ4A 1O3YA 1OYYA 2G6BA 3C15C 2ZS8A 4Q66C 1HTWA 2F3TA 4QL3A 5LB4A 3AVWA 1HT1E 2R2AA 5EXXA 1NBMD 1GM5A 4ESVA 4JSYA 3BOSA 3SC3A 5CM9C 5FUWA 1I4DD 2O0KA 1HQCA 1T8TA 3OFNA 4DDVA 4PSVA 1FNNA 4KCGA 3BGWA 1LF0A 1AIPA 1OH7A 2AWOA 3H0KA 4B35A 5GVRA 5TV2A 3RLFA 5JI3E 4TMXA 4XVQA 4GMXA 2H18A 4C0HA 4QG7A 1U0JA 3B13B 1OH6A 4Q03A 1FW6A 2X2EA 1W0JA 3K0EA 1NVXQ 2GBLA 5KSYA 1YHNA 4D4MA 1E1QD 3W90A 4BFYA 3CR8A 4NE2A 4BFWA 1UJ2A 1OIXA 1P2VA 2KBFA 3GJ6A 1E9BA 1LVGA 2IXGA 2BCJQ 1RRCA 1G8FA 4S35A 2KJQA 1E6CA 3GLFA 1KI6A 1NBME 2OBNA 2WJYA 2XAUA 421PA 2CNWD 1DAGA 4PQFA 4ZI3A 4B71A 3RC8A 3HP1A 4KLNA 2R6CA 3MRSA 1TADA 1G18A 1Z0AA 2F1HA 4CEIB 4WVFA 2A2ZA 3THXB 3GP8A 2QORA 3T34A 5SZHB 1Z06A 2CHQA 2F1JA 3LW8A 1F2TB 1KZGB 2QN6A 3ECCA 4HLCA 1G3QA 5CIQA 3IEVA 1KI7A 2IYVA 2ZR9A 1BYIA 1LY1A 2JJ8A 1ZC3A 4TT3A 3RS2A 1IN5A 3FPAA 4DLSA 4B76A 2R6DA 2RB4A 3WYAA 4YMWA 4BZXA 2XTMA 2GK7A 2V3CC 2GHIA 3E2IA 1EFTA 4XIGS 2IYLD 2X2FA 5JS8A 221PA 3N2EA 4B2LA 4QFMA 4ASUD 3U3RA 5GJWC 1JAHA 2OM2A 4IXNA 2ZYVX 4PSAA 1BMFD 2GK6A 3NBYC 3ZD7A 1ELOA 2V55B 1RVDA 3QE0A 4HATA 1CJKC 3WNCA 3EA5A 2YKGA 1W4CA 2ZI3A 3P4XA 3ICEA 4DLYA 3I8XA 2BCGY 2RMKA 4B74A 5KSZA 4HUQB 3QEJA 2WMNB 1GDDA 4A2WA 2V1UA 2VHUA 3D7MA 4ZDKA 2P6RA 5AJWA 5JI2E 3VR3A 4LYJA 1PLJA 5LPNA 4NU0A 2ZRBA 3RVBA 3IHWA 3BORA 3CH5A 1G8HA 5EP2A 4B2PA 4JLOA 2VP4A 1JNYA 1IJEA 4RZXA 2AXNA 2CVFA 3AKEA 2QTFA 3H1TA 2FFBA 3K9GA 3GJ0A 5FBQB 2IYUA 1SHZA 3VAAA 4HB2A 1CKEA 5KUTA 2OBLA 4D82A 1JPNA 3CR7A 4UXJA 3ZH9B 5FOTA 2ZRKA 4Q9JA 1HUQA 1KJYA 5DH9A 5EP3A 3UWKA 3PEWA 1ZM7A 5K8LA 2WKQA 2R44A 2VTKA 2W2TA 1TNDA 3LQRA 4KFSA 4Q19A 1L2TA 1TF2A 4DLXA 4CEHA 2O8BA 3ZZ0A 2IXFA 2HT1A 1Z0KA 2FA9A 1KK2A 4LHXA 3KXKA 1AS0A 1IY2A 3NHAA 4P32A 2BKEA 5BWMA 1MRNA 1ETUA 1COWA 3EZFA 2R6FA 2VP9A 1TU3A 3X2SA 3BS4A 1UKYA 3HJNA 2IS1A 4EJSC 2J9RA 2FH5B 3QKSB 3BIFA 2B8WA 3AVOA 1G7SA 4LBVA 2MSEB 2ZSFA 3VR6A 5DSZA 4QM7A 3SBDA 3LBHA 3WMGA 2OBMA 1JALA 3GCGA 4QNRA 3N70A 1XFAA 4MYHA 3MWYW 3ETLA 2ZE5A 4BASA 1P2SA 2NO1A 5AWFC 1S3GA 4ZKEA 1MO5A 2QRNA 4A2QA 4Q4HB 1IAQA 1KO4A 2YVUA 3B5JA 2WWWA 2PEYA 4LBWA 3SR0A 3AVVA 1JBKA 2PLFA 4JLPA 3TSZA 3BD9A 2F1IA 5IRCD 1XNJA 1NLZA 4FCVA 1ZBDA 3L8YA 3TW4A 3CF6R 4JBXA 2F55A 2WHXA 3X1XA 1I4LD 2O8FA 1H65A 1PLLA 2OT3B 4UQOA 5EZ5A 5P21A 1ANKA 4TLAA 1NVVQ 2NZJA 2WSSA 4P0TA 4EJSB 2CBZA 3UXMA 2AR7A 1YE8A 2AKYA 3PEUA 4IDPA 4ZDIA 3F5FA 3DPUA 4LJAA 4URWR 4CRWB 3RABA 3FGNA 4ILEA 1TL7C 2F3RA 3F8TA 5L3SB 5TARA 4NYIR 1KKMA 3FDIA 2GCPA 4JVLA 4ON9A 2GCNA 2JLSA 1Z07A 1TU4A 2FGJA 4JT4A 3DO6A 4IOLA 1Z6TA 2CL0X 4G3XA 3B85A 3IBGA 1OH5A 1N6HA 2FGKA 4QHSA 2AX4A 3DZDA 4ERNA 3QPUA 2PEZA 2O8DB 4K81B 1KY3A 2W83A 1LV7A 1TEVA 2ORVA 1XBTA 3K0CC 4JLKA 2IF2A 1GL6A 3FMPB 3IPXA 4DT1B 4HAXA 4NTZA 3THWA 2AK2A 2ZITA 4BGDA 5GJCA 1I4TD 5D3QA 1E69A 3TQFA 3SHWA 3CH4B 4TMWA 5DO9A 1OXVA 2GZHA 2QMHA 1II8A 1CRPA 1YZQA 1W2GA 2LWIA 3IGFA 4PC2A 3CF0A 3RWMB 2ZI5A 3NKVA 1V5WA 2ZRCA 3C14C 4KFTA 1Q1EA 2ZUDA 4O2LA 1KYIA 3QG5A 1W4RA 4OHWA 3BB1A 3SFVA 1JR6A 4V0NA 3WP1B 2D74A 1JAIA 4GZLA 2FPKA 1VECA 5KHOC 1QRAA 4IDHA 5FPTA 5J4KA 3C5HA 2ZSBA 3PVSA 1E1RD 2OV2A 3GQBA 1E9AA 3I92A 2YYZA 1Q1ZA 1T8UA 3N5CA 1FFHA 1KSGA 3BJIC 1KZ7B 4QJ3A 1WRBA 3R20A 5DIFA 2HDNB 1FP7A 2KB0A 2PL3A 1HV8A 1XXHA 2WWHA 3CWZA 3DZ8A 3TUJC 1IHUA 1SVSA 2VLIA 4RVCA 5CLLA 4DSOA 1XEWY 2ZJOA 5GJBA 3KX2A 3U44B 4TYWA 2FF7A 1EXMA 4YXWD 1E2IA 4KO8A 5IK2A 1MRSA 2VA8A 3I5YA 4C0QC 3KJEA 4BRWA 1KDPA 1ZIOA 2FEMA 4RD3A 4ZIRA 4URXR 5TDHA 3ZS8A 3H2YA 2JLYA 2BBWA 4IVRA 4NCKA 3GLHB 4CZ2A 1VIYA 2OZEA 2W2XA 1MO3A 3VMFA 4JLAA 3Q7PA 3I8SA 4BFZA 2D06A 3EA0A 1WDTA 4DDTA 521PA 1P4SA 2PLRA 4JLBA 3IUYA 3KKPA 3B1XA 1BS1A 3GLHE 2X1VA 1JECA 3WY9A 2IK8A 1VG1A 1U98A 2ZAOA 2ZI6A 4P4UA 3K9HA 1N6KA 2RKOA 4HZUB 2RGNA 5G40A 1M7HA 3PJRA 3K0FB 4IOKA 2CCGA 5G3YA 2QAGA 3U7GA 3C4JA 5CJ2A 1J8YF 4TQ9A 1AQUA 2QTHA 1FNMA 4EIWA 2V4ZA 2BM1A 3VNUA 121PA 3ZQ6A 3KKMA 1B23P 4M53A 3A8TA 1NG1A 4C0JA 1HQYE 3NIBA 3KTAA 3V4RA 1XTKA 1HE1C 1NP6A 4GP6A 4M1OA 2GVZC 2ZSEA 3UMFA 3EPLA 4DVGA 5DNYB 3LY5A 3MWJA 4MITA 3QVVA 3REGA 2ZVPX 4B3GA 1DO2A 3H4MA 3TJZA 2QA5A 4TSFA 1OJLA 1XTIA 3U5ZB 2P3SA 4LI0A 2QSYA 1E9RA 5IDVA 3EX7C 4M4SA 1GFIA 5JRJA 4I81A 3QPVA 3FFBA 3U3JA 1E9FA 1P73A 1GKYA 1WCV1 1KSJA 3VNVA 1SVMA 3IQXA 2VP5A 1Z0IA 4TYYA 1XCGB 4EAQA 3M0EA 2Q3FA 2BVNA 1C4OA 1OYWA 3IKJA 1WBDA 2FOLA 1D9ZA 1Q0UA 1RYHA 2B7BA 2DFLA 3ZYCA 4M9ZA 3RS5A 3WRXC 1M74A 5AJVB 4B6EA 1DELA 1OH8A 1N6NA 2CK3A 3K9NA 1U8AA 4FMDF 3NVAA 4V0ME 4JVNA 1OT3A 2GXQA 4OHVA 3DL0A 1E2NA 2HUPA 4BFVA 2DFNA 4TTRA 4ZKDA 3QKUA 2Z43A 2VRWA 3DHWC 3X1YA 1KSHA 1DARA 3KL4A 2H5EA 5DYGA 1MT0A 3QJYA 1Q3HA 1HA3A 2NGRA 2RGDA 1Z0DA 1NSFA 2JDIA 3FB4A 4NDZA 3TK1A 4A4DA 5JLJA 1IN8A 1ZVQA 1Z28A 5KSOA 3KQLA 1CJMA 4KSBA 1RRGA 3C7KA 2KSQA 3L2OB 4DJTA 1XB2A 2DBYA 2W58A 3I3SR 5SZIA 2XZLA 2QMUA 4AURA 4Q00A 1GP2A 4C3ZA 4DBLC 4PAMA 4DXAA 4EPWA 2IYSA 1S3SA 3FFAA 1LTQA 2VH5R 4OQXA 4LY6A 1BYUA 2D4HA 2BKUA 1S8FA 2ZYTX 1TX4B 1MABA 4OJKA 2JATA 4MH0R 3KXLA 4NCIA 2AN9A 1GZSA 2ERYA 4HAZA 1OW3B 1Z08A 2N42A 1E3MA 4DLTA 3S1AB 5H68A 1AA9A 3B82A 3EC1A 4A2PA 4CVNA 5KSPA 2JLVA 2RGCA 2QEQA 4E09A 4M1SA 2DY1A 4HDOB 4KLZA 1XZQA 4AC9A 5C4MA 5FL7D 1TAGA 5L3RA 1XTRA 3C41J 1G8GA 2EVWX 3PCRB 3BB3A 4IOMA 3B9PA 1YU9A 8OHMA 3B9QA 4XOIA 4Z1MA 1N5LA 5IK2D 4ZPXA 1FMJA 1L8QA 2O8EA 2PBRA 5JEDA 2KI5A 5FPYA 2GZDA 3AGQA 1RFLA 3D6TB 3N2IA 2CLCX 3GMTA 3Q7QA 3QNUA 4II7A 2NPFA 4BLSA 4OI2A 1GSIA 2YOHA 4HB3A 1LFDB 2WV9A 1N5IA 5FUVA 1CF4A 2VBCA 3U6BA 4KI0A 1KI4A 1G3MA 4OJQA 4ZCIA 1DBSA 3SJZA 1KNQA 1WE2A 2PH1A 3FMIA 1OXXK 5KOYA 2IA5A 3SN6A 2WJIA 3AVPA 4HEJA 4NP6A 2Z4SA 5GVSA 3HWSA 4MRRA 1FPMA 2DR3A 2J7PD 5D3MB 5DYIA 3DEFA 2GCOA 4NYMQ 1KY2A 4BEBA 2G88A 3K0SA 4QGAA 1VG9B 3T35A 3NBXX 1E9EA 1CR4A 3RRMA 3FMFA 1EK0A 1IM2A 4TMVA 2IWHA 3DM9B 3VTKA 1JI0A 4KODA 4KAXA 4LJ6A 3W6PA 2CDNA 3GJXC 3OEEA 4UNQA 2JJ1A 1E2FA 2GESA 2RGXA 4PR0A 4US0R 2O8CB 4C0BA 4MYUA 4GMDA 4EPRA 1U2RA 3GEHA 4OL0A 2HCBA 5H8WA 1S9HA 4IEIA 1DADA 2ODWA 4CT4B 4LYAA 3WBKA 1NJFA 1SXJD 2AK3A 2YOGA 5FTNA 4TYNA 4ZCMA 2XTNA 1XX6A 4ITRC 1X6VA 2W6ID 4JKYA 1A2KC 4URYR 2NPIA 1PVOA 3SS8A 4CEIA 2X77A 2YWFA 2ZJYA 3OE7A 1NKSA 2Q0HA 2ZRPA 3THXA 4IDQA 2UKDA 1OHHA 4JYBA 3A37A 3TR5A 5KDDA 2IBMA 3EZ2A 1OB2A 1ZU4A 1Z6YA 3KJIA 5KTYA 1F2TA 1FOEB 4TTQA 1W36D 4G0NA 1NN5A 2ODNA 1G5RA 2YJTD 4MRPA 3T06B 4E03A 3QOFA 4HLUA 4HAYA 4TZ6A 1NJGA 1VG0B 2IXEA 2JLQA 3B8HA 2QG6A 3AF2A 3VR2A 3TKLA 2MMCA 2XGJA 4JJKA 4HAVA 5FOWA 4DHEA 2BEJA 4EFNA 1SXJE 4I99A 4OYHA 4URVR 3QKRB 1Q20A 2IYTA 2P67A 1YRBA 4A1FA 1ZCBA 4JVSB 4HLDA 3QXXA 1DEKA 2CE2X 2X8AA 1ZD9A 3QEOA 4WW0A 3GJ8A 1T3SA 1GRRA 2W2VA 3ZVLA 4CIDA 2JLXA 3T5DA 3I4LA 2OXRA 2BBSA 2GJ8A 4LPSA 4TN1A 1OFTA 1AGPA 2ZR0A 1RRPA 2OSBA 2BJVA 1IN6A 3KQHA 3U2QA 3DMDA 3T5GA 2OHFA 4PO9A 1R0ZA 1W49A 1N6LA 2B8TA 4A9AA 2XITA 1GOTA 1HT2E 3RDPA 3BB4A 3VHLB 2A5DA 3AGPA 5JCZA 2QPAA 3CRQA 3GLIB 2CVHA 1U0HC 3PEYA 1G21E 1NN1A 3AP3A 4L15A 2NTYC 3OESA 4MKFA 4NCHA 2ZU0C 2GKSA 5KDOA 4WBSA 4CDGA 1UAAA 2Z6VA 2JGNA 4G5GA 3GLIE 4G5QA 4Y0AA 1Z22A 1B0UA 2N46A 4TMZA 3TIFA 1Y3AA 2WJJA 2JEOA 1F3OA 3SJBA 4N0EA 2ZRJA 5FUYA 3R9XA 2XSZD 1UBFA 4F38A 4NYJQ 1U81A 1N6PA 2J46A 4HI0E 3K0AA 3LD9A 2CHVA 4AY2A 2QSZA 4C0SA 2I1VB 4ZI2A 1LW7A 4OK6A 5CDFA 1T4GA 4IFEA 3PEVA 3NTUA 5JHGB 1YRAA 3IPYA 4DB4A 5JSZB 1R2QA 4A8JC 1CIPA 4R2HA 2OILA 2GJ9A 1GAJA 2O52A 3QXHA 1J70A 2GRJA 5FI0B 1KO7A 2H57A 3ZIAA 3LA6A 3EARA 4B3CA 3L43A 4X8LA 2WIBA 5DI3B 3DM5A 2EFDB 1M34E 1S1MA 2FN4A 2FDCA 2CLSA 4PO1A 2BM0A 4C2UA 1NI3A 3CWQA 4TQAA 3MUFA 3VX4A 2DFTA 1DVRA 4LC1A 4Q4HA 1GRNA 1TF5A 4XWKA 1KI3A 3O8RA 4V03A 2JLZA 2JJ2A 4MKHA 4ZO4A 4DSTA 2REBA 3IQWA 3SFZA 1J8MF 3KDSE 4B3XA 3K09C 2ZJBA 4BUJA 1E4YA 3AEZA 2J0UB 3OAAA 3PUXA 4W9MC 4FI3C 3WHLA 4DLVA 4W7SA 2QAJA 4A8JB 3HU1A 3IEUA 3OEED 2NMVA 2IHBA 4I1SA 4GP7A 1TTTA 2FZ4A 3PG5A 4JZKA 5E95A 4LHYA 1DAKA 1OE0A 2GNOA 3CX7A 1GWNA 3P26A 4D80A 1E96A 1IY1A 1G4AE 4PANA 3ZJYA 2V1XA 3DKVA 3GLGA 4ACAA 3JVUA 1VKJA 3AVYA 1ZW6A 1OIVA 2E9SA 2FX3A 4AD8A 4RFVA 5FBLB 2AD5A 5CLQA 3TBKA 1R0YA 2VSOA 1CULC 4RFSB 4U02A 2V6IA 3E1SA 3ONWA 3QVUA 4XSGA 2QMEA 4D25A 2XB4A 1P9RA 4TZ0A 4GL2A 2ZRHA 3FHOA 1CR0A 4UNRA 1YZGA 1E79A 2Z4RA 1UDXA 2IYRA 1Q21A 2MSDB 3OIUA 1OHHD 1VYTA 2F43B 2GVDC 4TYQA 2O8DA 5TB5A 4C0AC 5E7MA 4WA7A 4I1UA 5J40A 4B44A 5HR5A 3SI7A 3ZVNA 1R5NA 3SYKA 5IF9A 3L0IB 1QHHB 2IF0A 1G7TA 1DTSA 2WOJA 1GVNB 3KFXA 1AZSC 4QM6A 4DLWA 5AJYA 2FPLA 5B2ZA 3IBYA 2JIZA 5J47A 1DE0A 2I1QA 1KK1A 2QUZA 1GL7A 1E9CA 2CCJA 2WJVA 1DAIA 1BOFA 3WP0A 2WIAA 4CGZA 1SVOA 4PC3A 3X1ZA 5L3QA 1KDRA 1W47A 1XEXB 3R7WB 4AWXA 4A0GA 5AK0A 5KYKA 2EQBA 5HKKA 2ONJA 1TQ2A 4AKGA 3HDTA 2QT1A 2V7QA 3G82C 1VHTA 4F4IA 1OXSC 1MH1A 2HCJB 2C77A 3WMEA 5JHHB 3MSXA 1OIWA 5B30A 4B3DA 1E0JA 2EFGA 1FP6A 2ERXA 2R8RA 3G0HA 1AJEA 2ATXA 3BK7A 4LDJA 1II9A 3T61A 1OV4A 5FBWB 3T12A 4L9SA 4D0NA 5A4JA 1YR7A 1F5NA 3FHCB 2GAOA 3OHMA 4LK2A 4TQUS 1ZM4A 2JA1A 2QE7D 4D4KA 1GUAA 2OG2A 4KVAA 2PJRA 2QBYB 4IDNA 5AUQA 5HE8A 2WICA 4B32A 1D8TA 3EW9A 4Q7JB 4C9BA 1LS6A 1ZNXA 1H8EA 1K5DA 4HAUA 4MGKR 4N1AA 3RC3A 5L3VA 2D62A 1UBEA 3U4QB 4B2IA 1G1MA 1OLOA 5AUNB 4GRAA 2A78A 3NWJA 4JSTA 4LV8B 3SNHA 4EKDA 1U9IA 3M1IA 5BYJA 3FKSA 3UWOA 5BXQC 2BIFA 2Q21A 5JJLA 2AWNA 3T1OA 3ZQJA 3MJHA 4GT1A 1RZ3A 4PHHA 4QBHA 1W0KD 3U7FB 1KMHA 1YKSA 1YR9A 1IJFA 4LBYA 1US8A 2YINC 1RYFA 4EPTA 2GWHA 2ZJ2A 2ZE8A 3GJ5A 1N2CE 2H16A 3K8YA 4ARZA 3EXAA 4LJ5A 2QROA 1MO4A 1SHKA 3VX3A 3LX5A 4K46A 3CW2A 4JLJA 2BJWA 2IHYA 3CX8A 3WNDA 5CK5A 5AUPB 1ZIPA 2B92A 4GI7A 4EQ6B 1S0UA 3I1FA 2XX3A 4XD7A 2GEUA 4PPFA 3E5HA 4Q7MB 3D31A 2G83A 4MRNA 3MGCA 3F3YA 4R2IA 3LWNA 2IL1A 2GBLC 1RJ9B 5J4VA 2JLRA 3Q85A 3OFND 1XD2A 2WOOA 1X1SA 4OK5A 4TLEA 4C7OA 3ZS9A 4B43A 1N6IA 2ZJ8A 5KPJA 2P2LA 4BLOA 1XMIA 2EFCB 1CRQA 2IYYA 4TL6A 2FV8A 2YWGA 3RRNA 5CB8A 4JYCA 5G3ZA 2IUSA 3I73A 4FWTA 1Z8FA 1XMVA 1JQJC 1AQYA 3OIWA 1W0JD 3P20A 3QQ5A 3NEJA 1X86B 3SQWA 2XXAA 1UF9A 4XWAA 4YMSA 2WPDA 5E3HA 1G3IA 1N0VC 1Q1QA 1XZPA 1ZM3A 4O2RA 4CW7A 2ZRGA 4BLTA 4GNKA 1CXZA 4XWOA 3AM1A 3LXXA 4YDSA 4M1YA 3WXMA 5E7JA 3Q3JB 1EWRA 2KWIA 1RC8A 5ANRB 1X1RA 3T1QA 4A6PA 2YC2C 4M9QA 2J0SA 3CM0A 2QGZA 4BEJA 4BFUA 1VDZA 2QM7A 5JWOA 5J4HA 5GJVC 4AI6A 2J45A 2ZJAA 3LRPA 4Q18A 1NSTA 4URZR 3I61A 2QP4A 2WJGA 1W5TA 2PMDA 5EP4A 4M0LA 4DUGA 1P72A 3DMNA 1W2HA 2WVJA 4HB4A 5AR1A 5IT5A 3PUVA 2F9LA 2GJKA 1ZCAA 4ZDJA 1OFUX 1I2DA 1E2HA 3UATA 2A5GA 2XZPA 4XJXA 3GLFB 1Z6XA 4JT2A 1KI6B 3CB4A 5F3WB 1ZD1A 1N6RA 1UBCA 3OIYA 4JS0A 1SGWA 1VCIA 3B1WA 1MKYA 2HJVA 3NH9A 3PQCA 4TT3D 1D2EA 1E2MA 4WAUA 1TF7A 1GILA 1NMXA 4QXAA 2EWWA 3FVQA 4YQFA 3PFIA 4YONB 2CJWA 2VP2A 1BIFA 3GLFE 1A7JA 2WZQA 4B34A 3NH6A 3PITA 1WA5A 5LB2A 3GFTA 1OFIA 4JLMA 3KKNA 1EX6A 1TQDA 3KKOA 4JBYA 4RCYA 1ZD8A 4KSCA 5JECA 1T3HA 5DHAA 2XNDA 4Q7KA 1X3SA 3LV8A 4MRVA 4TMKA 2PT5A 5FTJA 1CBUA 5EXTA 1U8YA 1OSNA 3RSLA 3FOZA 1E9SA 2C8VA 3UMSA 2ZR7A 1SZPA 1NMYA 2E87A 2GAAA 4D0GA 2D3WA 4RJLA 3AF0A 3PUZA 1KGDA 4L9WA 5JRZA 1RKBA 3TNFA 3L0OA 1XPRA 4GBMA 1NVWQ 1Q44A 4MKGA 4PZYA 2IS2A 2GF9A 2CL6X 2ZANA 4JL5A 1FTNA 4V0OA 2IUUA 4QGFA 5BN3A 3KQKA 2ODEA 3THOA 4Q9LA 3W5JA 4IRUB 5EXPA 1VG8A 6Q21A 5L8VA 1KJZA 2WWFA 2XOKA 4PQRA 2CE7A 2FSGA 2HF8A 5CYPA 1EFRA 3P4YA 1E2EA 2QRZA 3BH6A 4PAOA 3T1TA 5D3MA 1J2JA 3QF4A 2EYUA 2V8OA 4UXIA 4EFMA 4U7DA 4Z8YA 3T1VA 3QUSA 4GSYA 4AIIA 1COWD 4WIAA 3SQXA 4GOXA 1G3UA 1V43A 5HE9A 1OB5A 4C2TA 4RD2A 3IIKA 3CRW1 3RYTC 4Z51A 5DI9A 2L0XA 2QL6A 1IXSB 4UKDA 2O8CA 3L0PA 1UDWA 2AD1A 2VF7A 4UNPA 1KAGA 2WWXA 3W8RA 2WMOB 2AKAB 4CEHB 2O8BB 1XJQA 2B7CA 4NMMA 2ZYUX 1JXMA 3KJGA 2VP6A 3ADDA 3HYRA 2D2FA 2ZEJA 3TVDA 1OFHA 1G8YA 4NCJA 1CJUC 4GZMA 5BQ5A 4AKHA 2OUKA 2Z0MA 3PUWA 2BEKA 1CR2A 1Z47A 3EAQA 3SZRA 2QI9C 3U60B 2VYFA 3TW8B 1QHSA 1YZLA 3TMKA 1OKKA 1PJRA 4D0LB 1P9WA 2A7QA 3QG1A 1F2UA 3ZZTA 2G3YA 2G1JA 3AUYA 4AK9A 2WPDD 4KFUA 4DCTA 3THYA 2C9YA 2HLDA 4AYTA 1Z2AA 3BBPA 4OBEA 1KIMA 2DYKA 5AJZA 4DLZA 2WSSD 5B64A 4LHVA 1KDTA 4PPQA 3GFOA 4PZLA 4ZDWA 3BFKA 3WNBA 1XPOA 1EWQA 1W46A 1C9KA 4N0DA 3EPJA 1CEEA 3DOEA 3CONA 2LKDA 2R9VA 2ZI4A 3JZMA 3AV0B 2B6HA 4TLCA 5F9HA 3QKRA 3CLVA 3SYLA 4MUAA 3W6OA 3HR7A 2ZRIA 3JZAA 4NONA 2ZREA 5FPHA 4IHQA 1SVWA 2O8FB 4DEXA 1YZTA 3O47A 4NCNA 2P65A 1ZM2A 4Z54A 1E0AA 2ECKA 4JLDA 1SVKA 2IS6A 4OI4A 3AVQA 1CTQA 2CHGA 1KAOA 2QY9A 1Z63A 4Q21A 4QGHA 2ZI7A 1J7KA 1FX0B 1XD8A 2NO6A 1ZINA 3EIHA 3CO5A 1GKUB 1YZNA 5CM8B 2OXCA 2OCYC 5UKDA 3BFVA 4MGIR 3VR4A 1Z6AA 1EGAA 2PJZA 4FMBB 5H1YA 3EZ6A 5FPKA 3IIJA 2EFEB 3SJAA 1SKYB 1KK0A 2BDTA 1N6OA 3TE6A 3RRZA 4YC7A 2X19A 2OFOA 4Q4JA 1NY5A 2D2EA 3R8CA 1KO5A 3AF3A 3VQTA 4OHYA 2G1KA 3VKHA 4QJ5A 3ZDQA 1HH4A 4ESHA 4MDEA 4MDFA 3A36A 1Q1BA 5FI1B 5DN6A 3THWB 4Q4AA 4HYYA 2JLUA 2CL7X 2DHRA 3D8BA 4GFDA 5EP1A 1SKYE 5J4YA 2DWPA 1AKEA 2FG5A 3QENA 3TQCA 5JMTA 1CJTC 1II8B 1FQJA 2GETA 3CNLA 2A3RA 3CBQA 4B3FX 5KNCA 1D2NA 1ESMA 2ANBA 3ASYA 3VU9A 2H1LA 2WJHA 1E98A 3CRMA 1OXUA 1W4BA 2ZRAA 5TY0A 4C0LA 4IJMA 1E32A 1R6BX 2G77B 4OKSA 5CB6A 1G3RA 3WYFA 1I2MA 5CITA 3QXSA 2P6UA 2Q9CA 1QHXA 1CS4C 2WAYA 3F0TA 1X8JA 1ZUIA 3MG9A 3NDPA 3E70C 3WHKA 2OCBA 4IFBA 3B2EA 2F6RA 2ZRLA 5J4LA 1MV5A 2CMKA 2ZS7A 4M1KA 4N3NA 1K8RA 1ZNYA 1DS6A 4EUNA 1H8HA 3LVQE 4LHWA 4FXPA 4LJ8A 2RGNC 3ZLJA 2FSFA 2XOKD 4CT5A 1F60A 5JBQA 4LX0A 1G4UR 1E9DA 4C0KA 1E94E 4BECA 4TWZA 5G41A 4B75A 1AZTA 3LDAA 1ZP6A 2NZ8A 4F93B 4G5SA 4ZIRB 5DISB 1GKIA 1SXJC 1YR6A 4LJYA 1XXHE 5K8IA 1VCOA 4RCZA 1FMLA 3BFXA 1W44A 4FIDA 1G7CA 1ODFA 2J0UA 4NPHA 4DSUA 1WBBA 1W5SA 4CEJB 1DAFA 1NBMA 1S2MA 1U90A 4JMPA 1ZU5A 5EJEA 1YZKA 1Y63A 2GEVA 4IOJA 3UK6A 5KDLA 2D7CA 4BFSA 1EFHA 5B57C 4G5OA 4WZ6A 4P33A 3TH5A 1K6MA 1R8QA 3DOFA 4M9XA 3PR1A 4FCWA 2GA8A 4QOSA 5EE9A 5EUMA 1NMZA 1TQ6A 2XNSA 3RANA 1W36C 2W6JA 4LJ9A 4IKEA 1EG7A 1VHLA 1VTKA 1ONBA 2YC4C 3B1VA 4WZBE 4D6PA 1VMAA 4GOKA 1X8LA 4FWIB 3T15A 1E1QA 3QKTA 2REOA 3C8UA 3P27A 1JJVA 4Q01A 5EE0A 2PCLA 2FFAA 1XRJA 3LH5A 4TSFD 1Z0JA 3VR1A 1SXJB 1XP8A 1P7CA 2SHKA 3ADCA 2V9PA 4DZZA 1UKZA 4LWZA
chains in the Genus database with same CATH superfamily
3X0DA 3KTAB 2HU8A 4GI5A 1MBLA 3PNMA 3HA3A 5JJKA 4YMLA 2WY2D 1D6JA 2O3TA 3KYCB 1P0CA 2C4VA 2E5WA 1WR1B 4L5IA 4OGWA 5CYOA 1UEIA 3PX2A 4NSNA 1UOOA 1RXYA 2C03A 3SZMA 2WMDA 3TXYA 4R7LA 1C29B 3WGLA 5CH5A 3QP6A 2A5FA 2FP4B 3ENQA 3WO0A 3QVMA 1QIFA 3L7DA 2JZOA 1ZN8A 3MJVA 3O8LA 3UMEA 5A62A 1G20B 1F4IA 4JYAB 1ZIYA 3BKXA 4L8GA 2RAFA 2GNPA 4CNBA 2W0SA 3I64A 2QLMA 3VP1A 4RNCA 4IIYA 3RAPR 1O9HA 1GTG1 5DBIA 1JYSA 3K8QA 1D3AA 2NSLA 4I4LA 1K55A 3PRYA 1NT4A 3OG9A 4K9LA 1ZMXA 4AY5A 4OF4A 1L0DA 4L9RA 1TAUA 3T8DA 4IHJB 1FCJA 4ENWA 2DCMA 3TM5A 4ZCQA 4Y0TA 4IIXA 2PSDA 4X84A 2AZ4A 2AHOA 4CUZA 5AB2A 3G88A 2WJ4A 3ZVRA 5DPEE 3T41A 4F3CA 2YOFA 4DA8A 4TS3A 3KM0A 4R6XA 2YY5A 1QP0A 1GAQA 2W2NA 4CLCD 2VQEB 2OMEA 3ES9A 3E9YA 3FMOB 3WNVA 3WVNA 1W76A 3F5DA 1V11A 4B84A 3FKEA 3F2PA 2Y71A 1EA7A 3HFSA 1V16A 3RS8A 1XEFA 4B47A 1JVJA 4ZQHA 1JB9A 3PIDA 4TLDA 3F5SA 3K70B 5JXWA 2QPOA 4PBRA 4KYVA 3X1KA 1OOEA 4DDYA 4R7ZA 1S1YA 2ZMFA 2BMEA 3NTOA 1O5OA 2X40A 3PHIA 1T5LA 1Z56C 3L7CA 4F2HA 4BWFB 3RTEA 3QXJA 1MC0A 3U2AA 1XJ0A 1DEOA 3J81A 3CHWP 5AO9A 1M1NA 4BNXA 1GZ7A 3ELYA 2Q28A 4NJMA 4DR1M 1AOXA 2PBYA 2XTAA 3HYTA 3ZWPA 1W2WB 1G9XA 3O7MA 3X1DA 3L28A 1JE0A 5DLQC 4GLJA 3L6OO 2WEKA 3W3AA 3VU1A 4KITB 2HDWA 3ZNPA 4GU5A 1IUKA 1KL6A 1N4OA 1BZYA 1VOTA 4UTZA 1YB4A 1NWZA 3QBDA 3NI2A 4W8HA 3U4IA 4MIYA 2JPDA 1YMQA 1TT5B 2HOQA 2VDQB 2GZMA 1YU6A 3V4LA 5EZ6B 2WVHA 2W00A 2QN1A 4CBVA 1RC0A 5AT1A 2C20A 4KZ8A 4MGZR 3ZX5A 4RY8A 4H7EA 5F1GA 1RQNA 1OWPA 2ZU6A 3EVNA 4DRYA 1UAYA 2Q5OA 1JKJB 1EM6A 4XXHA 1RW4A 4NMXB 1JEOA 1YDEA 5K0BA 4QUGA 3CXUA 4FGWA 2FTKE 3PLRA 4UNNA 1NX6A 3KKQA 3SNKA 4QUEA 4EO7A 3B47A 3MWGA 3S2FA 4ZOLB 4PY2A 3TR0A 3HH8A 2JBHA 1BS2A 3ZY3A 1C8LA 5HQ3A 2PHYA 4F4UA 1M7GA 2Z2YA 1E89A 2PSHA 4G0MA 3KQNA 4NEHB 1YCDA 2IY7A 3NONA 2XSSA 4KFCA 2Y68A 2FPMA 1FTGA 2VXOA 1QQTA 1A5ZA 2F48A 1R5LA 3TSAA 3LW7A 1ZXLA 3DL4A 2AC2A 3RS3A 3S7QA 4RZ3A 3UMYA 4BMCA 2AZMA 4C6RA 1HYBA 4S2MA 5PNTA 1J2UA 1UH5A 1JKFA 1D2AA 3UGQA 4RKFA 4RVSA 1MFPA 1VHDA 4KR6A 3IEXA 1UL1X 4RA6A 3EGXC 2GAJA 3OEHA 4NHOA 1J09A 4DUGD 1TAQA 4F3TA 5JJIA 4RS3A 2O20A 3BF8A 5KU1A 4KHZA 3EP8B 4JROA 3LGSA 1BEZA 3W05A 4UHJA 1E2DA 4MTCA 1J5XA 2H17A 4KEAA 3O4FA 3VVBA 3ENVA 1XK7A 5SYAA 1F20A 1R0SA 2EATA 1EEXB 2DF8A 1GD1O 1RRVA 2H0AA 3SQLA 1W5DA 4DNOA 3AOEC 1VP9A 2PK3A 1C8VB 5EV0A 3ZFZA 4NR0A 1K57A 4DRZA 1G28A 4HNAB 2NUAB 5I9BA 3GZNB 2ZYGA 4WFIA 3PQ4A 5EFWA 1QHYA 4UBOA 4WUTA 2EW1A 3T4XA 4O02B 3MLEA 2QM8A 1YASA 4YCJA 2GGSA 1KR6A 1N0WA 4UJ5A 3DPSA 3VGPA 4C3OB 5ALOA 4BO0A 4LC0A 3RUAA 2HPBA 3NAZA 5EZQA 5KJFA 4EVQA 4AJIA 5DM4A 5TVGA 3I83A 3WYDA 3TAUA 1DHTA 2J33A 4M1WA 5JS7A 5JNLA 3PGJA 1XJCA 2O59A 3T4PA 2EYQA 3FU3A 3NASA 2C3OA 2IU4A 4G23A 1YIDA 3VH1A 3PNOA 3II6X 5BMVB 3D9YA 3VV4A 1XO1A 5KREA 3AW9A 1E61A 3H17A 1YULA 4LRXA 2I6GA 3MBOA 1WR8A 3VKVA 4Z9AA 1UJCA 4NXGA 3UF0A 2WKRA 1WUJS 4XW2A 2I2DA 1SELA 1QIGA 3ZIDA 3ZW7A 5GLCA 4O5AA 1OGIA 4OP8A 3J7AS 1V39A 3CLKA 1G5PA 1YBFA 2Q4EA 1GSOA 2WAXA 3T3MB 2YXNA 1R9NA 1XK6A 1DCKA 3GQ4A 4MUKA 3KGDA 4C07A 2UXBB 1D4AA 2FZCA 5C5KA 3AHHA 2V7PA 3ZWDA 4KZ5A 3VM6A 1L3IA 2VEDA 2R1TB 1WDMA 2AZDA 2P0EA 2XMQA 2ZQCA 3WG9A 4I5FA 5FTWA 4YT4A 2J3QA 5IBCA 5K8UA 2JRLA 3QWAA 1LL5A 3GRVA 4P5EA 5HCIA 2ZDGA 3DV0A 1DMSA 4KXCA 1T91A 4A73A 1D5CA 1U4GA 4PXYA 1ZISA 3DEHA 4L8FA 2G6BA 1U2PA 3O3CA 5IT9A 3BOSA 2GPNA 1I4DD 4ND6A 4EHIA 5IX8A 1L6RA 6REQB 5TV2A 4O01A 3T1RA 1VFPA 1W87A 3Q81A 1FW6A 3FVRA 1WCIA 4D4MA 4AQYB 5PGMA 1U1EA 1ZGAA 3VPDA 4OLBA 4IF6A 3RC8A 2FF5A 3LCRA 2V7WA 2ZLBA 3TTWA 2NUBA 2FEKA 5CIQA 3EIWA 3PHCA 5TR7A 1QMPA 1U6IA 2VKSA 5AW3A 1SOMA 2O0MA 3H13A 3N2EA 1GNTA 1ZMBA 2PKEA 3OZGA 2XBMA 4DLYA 4A2WA 4LF8B 4RLQA 2J3TD 4UMEA 2ZSKA 2A0KA 3WWCA 4LYJA 4EJFA 2BEUA 4ENUA 4K03A 3TLAA 4P87A 4H1WA 3DR5A 3DW1X 1FTYA 3ZH9B 1RWWA 2G70A 3I9NA 5EP3A 5DH9A 3T74A 2WKQA 1OTDA 4XMTA 3KCQA 5KTMA 2CXUA 2HM7A 4L0MA 1UUFA 2IXFA 3L46A 3O1LA 2Q2WA 3ENWA 3BIFA 4KYTA 1X9HA 1NW4A 3MRXA 3UKJA 1IAQA 4TUWA 4KQRA 4EW7A 3ETJA 3EOBI 4JX9A 1MAHA 1L5ZA 1MXFA 3AEQB 4UQOA 1ANKA 4O4IB 3WK5A 5KYUB 2FJPA 4HS9A 1NVFA 3T87A 1S2DA 3C3BA 2AMFA 1O07A 3FXPA 3DO6A 3P94A 2OWHA 1Z6TA 3IBGA 3OJLA 1THMA 2HDHA 5JH7A 3K0CC 4X1LA 1U7PA 3BFCA 5C8YB 2W6ZA 1I4TD 1R15A 3SHWA 2EIHA 4GHAA 3RARA 2L19A 4WMCA 2OGSA 1JR6A 2WHEA 2F3QA 1GTL1 3C5HA 2ZSBA 5JIBA 1A8SA 4PLVA 4GIBA 4XMXA 3K5PA 3R20A 2QUBA 1FDUA 4O2AF 3TUJC 5KOJB 4NOOB 4DSOA 2KX6A 1YR1A 2IIBA 1QV9A 5SY6A 2WU8A 4WECA 4GMFA 4URXR 4EY8A 3IDAA 4L5YA 4ZVRA 5JFTA 1UDAA 4COKA 3FGPA 5CXQA 2ZQDA 4I19A 4JLBA 1IEQA 3P9KA 2YJNA 3EW7A 3X2FA 2ZIFA 4YAEA 3KR9A 4HZUB 1MJGM 4IOKA 2CCGA 1IBMM 3C4JA 5ADUS 1AQUA 3I7JA 3HL4A 4MVJE 2OCDA 3NIBA 5CBPB 4BKPA 1I1OA 4FVMA 4Y7CA 1FU8A 3N2NA 3UMFA 4DVGA 2OMKA 3CPTB 1W8DA 3TJZA 3DOJA 5EHNA 1S7GA 4Y1RB 3IPRA 4LI0A 4DA7A 3PR6A 3OOYA 1RYDA 3OPYB 3U4GA 1DRKA 3H2BA 3L9WA 4EHAA 1Z0IA 2I65A 4M8SA 4TYYA 4V3CA 2BVNA 3IKJA 2FOLA 1LHYA 5F3RA 3AFNA 3MT9A 4XD2A 4TUYF 4KLRA 3ANNA 3RTYA 3K9NA 5KX5B 4AF6A 4F6RB 3EJ6A 4K9PA 2AOXA 3BJEA 2ZYDA 4LNHA 3KQLA 3C7KA 2KHHA 1B8NA 2I1WA 1THGA 1BYUA 4MWEA 1NXSA 3FFTA 2ICAA 5KVAA 4Q9NA 4ZVNA 5J7EA 3L1UA 1O0SA 2AH5A 2X5JO 2DY1A 4BIMA 1MC1A 3L7MA 3BBZA 5CCXA 3B9PA 3J80S 4EGQA 2RB5A 1FA9A 4LYEA 1H69A 5JEDA 2OYCA 4YASA 1ZTUA 4UBIA 2OPFA 3F1LA 1Z4JA 1WE2A 1OT9A 3OHSX 4BJ5A 4BEBA 3ZU5A 3I2IA 1JI0A 4C0BA 3QV1A 4C3UA 2ODQA 1DADA 4NRVA 2LUOA 4EAAA 2JD0A 2YWXA 4JX8A 1C7EA 1X6VA 3K20A 1H3NA 3V3TA 1XZNA 4UUBA 1OHHA 5KDDA 1QIEA 4F11A 5KTYA 3VAYA 3AETB 4FHFA 1VG0B 3N87A 3TKLA 4BMWA 4Q6WA 4EB0A 2X3FA 3DYVA 2CE2X 1ZD9A 2AFRA 3PBNA 4I8DA 3BJZA 3OE4A 3VHXB 2HF7A 4KZAA 4NRDA 3GLUA 2CVHA 2F1OA 3GEMA 4TXLA 2RC6A 4XIIA 5EZYA 1P31A 3GLIE 4Y0AA 1T5HX 1KPGA 1F3OA 6PFKA 1VLJA 3P9XA 1GTRA 4OLGA 4CQJA 2PVCA 3K0AA 3LD9A 2QSZA 4D97A 4D9JA 4ZI2A 2EA9A 4DB4A 3TOCA 3MJFA 4KUHA 2H9AA 3PBSA 3ZKWA 2YVKA 2BTOA 5IULC 5JXIA 4Z0HO 3OOWA 5BUCA 1NZDA 3GDHA 4NJEB 3VX4A 2MJLA 4OQHA 3L6EA 4Q4HA 3FPCA 3HRKA 2QIPA 3CURA 5EM0A 3RYIA 3PUXA 1GU7A 1U1FA 4FI3C 4DLVA 3I2YX 3DP7A 1Q3CA 4ZTUB 2VDNB 3FZGA 1DAKA 1GWNA 2I4LA 2WKWA 1P1CA 1XIVA 3AUFA 1DFGA 2QMEA 4XSGA 2C5BA 2I2FA 3AKZA 2XD9A 4KMRA 1RWBA 4U63A 2ZL1A 4N8SA 2J85A 5IF9A 4LV3A 3IUMA 1G7TA 1VPEA 1AZSC 2E3JA 2HMWA 5KSWB 4B31A 2XUAA 1GL7A 3EGOA 3BCSA 4OUKX 5DGTA 1QQBA 1SVOA 4PC3A 4OQEA 3QOWA 5AW4A 1EAYA 3KYBA 5HKKA 4AKGA 1VA4A 3KU4A 4MJXA 1LSXA 2EKLA 4B7UA 1IOWA 4NAHA 3E7WA 1E3WA 1PWEA 2R8RA 4NZ8A 3CLTC 3FUMA 1OC4A 3W79A 3GT0A 5LQSA 4L9SA 3BQ8A 3OHMA 1XZGA 3FHCB 5HFJA 4LK2A 2E7ZA 2JIOA 4JC5A 2XA7S 2UXDM 3S29A 1EM8B 4LDNA 3RC3A 3VR0A 1EH5A 3EHEA 3U4QB 4HBUA 4XWWA 4IVNA 1SOAA 4FFOA 1PWGA 1K8XB 2BLSA 4YQEA 1GEEA 1KMHA 2EP5A 5ALSA 4P3NA 3WGZA 5HKLA 3GJ5A 2ZE8A 4JD5A 4J16A 5CW2A 3C3EA 3PUUA 3AUUA 5JY6A 2ZLYA 2Z8YM 3KBBA 2XBUA 5EUBA 2NZVG 5AVVA 4XMVA 3HJAA 3Q85A 3ZH2A 5MC7A 5K8VA 1L3CA 4BLOA 1FSYA 2EHDA 4MAFA 3R4KA 3I73A 3SQWA 1TOAA 3BX1A 1XZPA 5IW8A 1Z45A 4OFBA 4XWOA 4IYJA 2KWIA 2JFWA 2DLNA 2J0SA 2UYYA 1YMSA 3EDOA 1I5QA 2R4JA 4BBAA 4IR7A 4KUGA 3ETNA 2PMEA 3K9WA 4HB4A 1B0ZA 2GJKA 5K51A 1OLSB 1UBCA 4TT3D 3PQCA 3HUEA 4WDRA 3M6MD 3EGDA 3NHJA 3T5CA 3U4DA 1BD3A 4LCEA 1PG2A 4ZMRA 3N2KA 5KNLA 2C9BA 5FTJA 1ZEMA 3N58A 5AXDA 3ITDA 2FKAA 2GD2A 2EO2A 1SZPA 4Y7PA 1NMYA 5LP6C 2POQX 2YZKA 1EINA 1XPRA 4UTRA 5LOVF 1B76A 4ZXFA 4J2HA 4Y2PA 3HBNA 4LY3A 9LDTA 4IV0A 2PDRA 4EBLA 3CUTA 6Q21A 1YFZA 3IJ5A 3PI7A 2QRVA 2WLTA 4AIIA 4GOXA 2RGRA 2PAFA 3KSBC 4BTVA 1H22A 2YHAA 3BRWA 4UNPA 2Y2MA 3N39C 2O8BB 4OP1A 1JU4A 5KMGA 4K2AA 2VQDA 4DQKA 4MB2A 4OQZA 4F1KA 4WADA 3IBCA 3QG1A 4FFBB 5DSTA 5BSGA 3OZRA 3C8CA 2I29A 5I4KA 4ZO9A 2NU7A 2C29D 5LJIA 5I94A 3ORRA 3N0WA 2OCGA 3A27A 3D4NA 3A1FA 1TVMA 4ZAMA 3EWNA 3B20A 3AT1A 1Q7GA 4BQRA 2FPIB 4QUHA 4NOLA 2C31A 2YH2A 4Q3AA 3EIHA 3G9XA 2WP8J 3OQVA 1EGAA 2ZFUA 2HHHB 1TLTA 4GLBA 4HBZA 3TQRA 2UUAM 3R8CA 2XE6A 3AF3A 3BREA 4NDNE 1HH4A 1KY4A 4ESHA 4DWVA 4H57A 4R1UA 2FWMX 4B3FX 5IVKA 1WYCA 3LCVB 3OM1A 1TRKA 4Z6YA 1E32A 2H9IA 4ZDXA 3GQBB 2ZRLA 1VJRA 4LMBA 3TJMA 3UK7A 2LVBA 4FXPA 1F60A 4GOOD 5HS4A 4DJ5X 1EVIA 3EUFA 3RVSA 5HUQA 1JWAB 1MAVA 5F73A 1AKVA 1ODFA 3CLHA 2CFIA 1J25A 1Z88A 4WN9A 5FI7A 4WZ6A 1R8QA 2GZRA 3KV3O 2YN4A 1IVSA 3W04A 2GFQA 3DJYA 3HFRA 3WDLA 1UBSB 3I9FA 3B1VA 2O5CA 3ZCVA 4FWIB 3G2HA 3BYZA 1JE1A 5GLDA 1QRUA 2ACKA 1Z0JA 5FEGA 4FB5A 5EVIA 4U0JA 4NEQA 1C30B 2R6HA 2EKZA 621PA 1V5EA 3AERB 4FMCB 3L8EA 2B2NA 2VAMA 1NUQA 4AY6A 5DCYA 3PWTA 4JP3A 5D01A 2PYRA 3BLSA 5KNBA 3IG8A 2DCUA 4FOOA 2YYYA 3FNQA 3M4NA 3LVFO 3KS9A 3SASA 1P81A 4QXMA 2FFQA 2A9VA 4ND3A 3Q15C 4MYCA 1K54A 4OLFA 3O31A 4OTZA 2IW3A 2X4IA 2EP7A 4MO9A 1PM5A 2J9OA 4MA5A 3B8EA 3SBXA 4PGFA 4YAWA 5LA6B 3WRYC 4AG6A 4DA6A 2FWJA 3HVUA 1NUAA 1H2FA 1WMFA 1XDGA 3WB9A 1B1CA 3C87A 4IGAA 1YCGA 1OQYA 1C3OB 2Z5FA 1KMQA 2JAWA 1JLHA 2XB8A 4O29A 3KUCA 4PINA 2KQUA 3VFDA 2GEDA 4RY2A 3OOJA 3QVSA 2JVKA 3O3MB 3N2LA 1LQUA 1HEIA 5E1DA 3ZU4A 4PSKA 2L09A 3DB2A 3FTQA 3SDZA 5DXAA 2YZGA 4IUKA 4GPTA 2ZJZA 2YIDA 4W6QA 4X8HA 1PEYA 5EE3A 4IWNA 1CCWA 2KMLA 2X6RA 4Q02A 3QFCA 1UWKA 5A2GA 4IFIA 2AG0A 4HDMB 4G0YA 5F69A 4ZAFA 1TECE 3TIIA 3NTQA 2LTAA 3ROFA 3CIAA 2PBZA 4FQ8A 5K6RA 1CETA 3RHFA 1LRJA 3V6LA 2J6BA 4HNTA 2ZZNA 3IIIA 3ZK9A 5A1JA 1ZCFA 3VMAA 2HZ7A 4OMDA 3G0OA 1KY5A 1J0AA 4PNPA 5A02A 3MDJA 2W6OA 2VQFB 1ZOIA 1KJWA 2WKPA 1J9GA 3MS3A 2WSLA 3OU2A 3GLHA 3FWNA 3D8NA 1U3GA 3SE6A 4Q4EA 3R4CA 3I72A 2BWBA 4YMTA 1OT6A 4YV0A 2XEXA 1IHXA 1NRFA 1JSCA 3MCVA 5DYWA 3K9BA 3QW4B 4DV7M 1D2HA 3FB1A 3FGDA 2ZJ5A 1NF9A 3VKFA 4OXYA 2FSPA 1IXZA 1LLDA 4H27A 4D26A 2A0XA 4AN0A 1PBNA 3THSA 2P11A 2FWRA 3HE3A 1WP4A 1ZGHA 4HEHA 3LY4A 2JJ2D 2OQ2A 4E3JA 4RPKA 4QJ4A 4PM6A 3CKLA 2OO3A 2G0NA 5FBVB 1BVHA 3LRXA 4D98A 4PHTA 4HY3A 4J90A 4BLQA 1P2UA 4EYOA 1JPJA 1DIOB 3DT9A 3ELDA 1ZK0A 4WEOA 5FWAA 3CMZA 4DR7B 4JENA 4F5ZA 1RPAA 2CSXA 1DI0A 2OCXA 5FSRA 3NXSA 5GQSA 3HJCA 3FULA 2YVQA 1SXPA 2Q0QA 2FS1A 4WZ5C 1TIBA 4BNDB 1V7ZA 4ONEA 4HTAA 3SS3A 4TXMA 2YVLA 3C97A 1YVDA 4FD2A 2QPNA 2XPZA 1N3BA 2PSEA 2VVTA 5TGFA 1OS0A 3T2JE 1O1YA 1A2QA 3W9YA 5A1TA 5L3QB 4JV5M 3HHZA 4I6GA 5KKNB 1H1TA 2AQHA 1TO1E 3GJ3A 5KYYA 2GCIA 3H84A 5DVZA 2GPAA 2YASA 1Q39A 4HUTA 3IP7A 3E0QA 2QX4A 1KDVA 4WNAA 3KWLA 4POOA 3A2LA 3C5CA 1PE5A 1TTHA 1FY2A 1J99A 1DV1A 2BGLA 4YWJA 3KOZA 5L10A 3PDIB 2G3QA 4M6WA 4YQYA 4TMFA 1O4WA 5CB4B 4F92B 3P0HA 4BATA 4GN2A 4MCIA 1CU1A 1NW6A 3DCJA 3S4XA 1TQHA 2PGIA 4D4JA 2Q5IA 3UAVA 2NP7A 1XD2B 2WSBA 1ULBA 2FZLA 1JU3A 1PRBA 2YJZA 3AKDA 2I91A 4N7JA 1KZYC 1KEKA 2QT0A 1OTRA 1N1EA 4X1IA 1JR3A 4PYQA 4LRUA 4GC9A 3BL8A 2MHCA 2OV8A 3A25A 1P1FA 2CVQA 3UHOA 1E99A 3FD9A 4IDCA 1DIRA 2IEYA 2JFHA 1UPTA 4FSFA 1NF8A 2ZC6B 2B98A 2VL7A 3SXUA 1UBTS 2EXBA 4W5QA 1NW5A 5EL0A 1ZRHA 3ZE6A 3C45A 4L5BA 4FEGA 2ZIWB 4LK3A 2TMNE 2R62A 1TLFA 2IUTA 2P2SA 3MS6A 1MXOA 8ADHA 4BOYA 3OMLA 1W8YA 5ALFA 3VTAA 1DC4A 3DJFA 3KJNA 5J2UA 3DMHA 1L0FA 1SBNE 4GBED 4M9RA 4IQ8A 3HZZA 3QK7A 2AYXA 2Y0BA 1E3UD 1E7WA 3G2LA 3UG7A 1VYVA 2OK8A 3RODA 5JPDA 1PYOA 1Y1SA 2HR1A 3P7UE 2PU7A 1I2BA 1N9BA 4CM3A 4ZJ2A 4B3BA 3UMGA 4RU1A 4OI0A 1X80A 3PWZA 3H82A 3ZGLA 2R87A 3JALA 2DT5A 5DFXA 3FN4A 3U0BA 4WLUA 2OFFA 3QHPA 4DXDA 2YFHA 5HIAA 1GQOA 3A1NA 2EDCA 2XV1A 2QYSA 4Q0MA 3DTKA 2RONA 4IZHA 2PYIA 3Q7RA 2YWHA 4L0QA 5KSHA 3JAMA 1FE8A 1CC1S 4N92A 4PYJA 3RIXA 1M54A 2FPGA 2YDYA 4XX0B 3DEIA 3M1LA 5HKBA 3TDNA 3RYFA 5LMNB 1CUYA 2VHCA 3DWIA 3V7YA 4NENA 4Y2UA 1WB9A 2OXTA 3E9NA 1UPFA 2JJMA 4LJKA 3UPNA 4OHXA 3M2KA 4NVRA 4OLAA 1P7WA 2Q6TA 1PZXA 1WXQA 5T5QA 3IXGA 2BH2A 3H11B 3FUWA 2HH9A 2PZGA 3A0VA 2YZMA 3HNOA 5LNK1 4QPEA 1JRLA 1VEGA 1BLCA 3KVNA 1AHPA 1QX4A 1MW9X 1VE5A 1QO0A 1XTBA 4F8YA 4BJ3A 1QP4A 2WE8A 2XBLA 3E98A 1MDFA 1A0OA 4TGLA 5F12A 2PT9A 4HDRA 1DEHA 2JKZA 3L8DA 3D6HA 2P2NA 4KPFC 4NG4A 4UEWA 1CJVC 2GPTA 1SIUA 3C15C 1MJFA 1GM5A 4DDVA 3ANLA 2PUAA 5BO5A 4CMKA 3WS5A 1P4GA 1U0JA 3RFUA 2ZYHA 1LSSA 2PKWA 1H6AA 5KSYA 3DVAB 4MWPE 4NE2A 3QLVA 1OIXA 1HS6A 3EXEB 3LC0A 2IQ5A 4TM8A 1OBHA 5F3WA 2WJYA 5IDYA 4OSOA 2PX5A 3TEJA 4HSGA 2A2ZA 3GXOA 2NQ8C 2MSWA 2QORA 3DMFA 4OA5A 3FBTA 4ZHQF 2Y59A 5KZHA 5JZBA 4N7RA 3I39X 1Q0LA 4DLSA 5ILQA 4NV1A 2EKFA 4RANA 4OQYA 2IYLD 5JS8A 221PA 2Y1LA 5A9RA 4N82A 4OH0A 3L01A 3O4HA 4JUCA 3ICEA 3K31A 5K0EA 5ERYA 3WIBA 1YUNA 5AB0A 2VHUA 3CJMA 4R4SA 1ZKMA 4M4XA 3PWKA 2ZRBA 1XNHA 4B2PA 5IXYA 4OAOA 1J1ZA 1L5YA 3MAJA 1JMYA 3M5CA 1I2SA 4TS1A 1WA9A 3RTGA 4YP0A 4Q9JA 4UUOA 1JFFB 1GPMA 2XT6A 1N92A 2KW5A 1TF2A 4GOND 4DXCA 5K03A 3ZDFA 4YFMA 4AZ3B 4K6HA 1V92A 2FMTA 2VP9A 1TU3A 1S0WA 1K75A 3LIPA 3VSCA 3LBHA 1ZHHB 2Q46A 4KR9A 4RM2A 2QRNA 1U8FO 4G0OA 5I51A 3KKKA 4II3A 1KE2A 2G80A 3CS3A 1Y8GA 1ZBDA 5HS6A 3CF6R 2F55A 4R2LA 3W2ZA 5EZ5A 5ULLA 1T9CA 2ZWOA 2PQMA 3E8MA 3K4HA 2WI0A 4F3LA 3NRCA 5ARDA 1CY1A 4GH5A 2REQA 4AN1A 4EEPA 4HEFA 2AJ8A 4JLKA 5TRTA 1EVEA 3Q9NA 1ZRSA 1QTIA 1SCBA 1JR4A 4K5QA 2N9UA 3OCUA 2QMHA 2KM1A 3E2KA 2GAIA 4E2YA 1FJGM 3KKEA 3G9UA 4NARA 2CYBA 2BGWA 2O2IA 4KFTA 3D4PA 4WK0B 3EEHA 2ZKLA 2RHHA 3PJEA 3U9WA 4FDVA 4GZLA 1F38A 4XGRA 3F6CA 1T29A 4L85A 1W85B 1FFHA 3O2JA 5EINA 4RETA 1YB7A 4MW9A 4DJAA 1N3YA 1U9JA 4ITVA 3PT9A 4TKLA 1A7AA 4F5WA 1MRSA 2WP0A 1T1BA 1ZIOA 1BA3A 1S6YA 4RD3A 4OM8A 4DARA 4PM7A 3ZS8A 4Y17A 4LRYA 2Y79A 2XHZA 3Q7PA 3EEYA 4QDZA 4D4GA 3EXHC 4Q12A 2XGMA 1HMPA 9GPBA 3RIHA 1P4SA 2Q9NA 5F6AA 2JI8A 3V80A 3OZHA 4XQEA 5BSRA 4B6OA 2ZAOA 1CUAA 3DXFA 2LP4Y 3OJXA 1GR0A 4FNAA 4X20B 2RHCA 3F6EX 5FDSA 5DWDA 3CSDA 1KKKA 2B0JA 4C4YA 1E62A 1L7PA 2ST1A 3EVTA 1KAHA 2K4MA 3K0BA 1YVRA 1E25A 4BNKA 1HE1C 2GVZC 1EX1A 1DO8A 2I22A 1GFZA 3W2HA 1EMDA 1EI9A 1DO2A 1Z8NA 3GVBA 5K0LA 3BXWA 2ZPAA 2GZSA 2OHGA 5IDVA 2JIRA 4FGSA 1Q2QA 3PNBA 1KSJA 5IFKA 4TROA 1C4OA 2DFLA 4FKZA 3UW1A 4B6EA 1DIHA 1V8FA 1U8AA 2A2LA 4FDTA 4HC4A 3PUHA 5TBMA 2NYUA 5ALTA 2NGRA 2M60A 1IEWA 3TK1A 5T57A 1IN8A 3JR3A 2DNSA 1RRGA 2KSQA 2BEVA 3ONEA 4EPWA 1GP2A 2Q5CA 1NXPA 2IYSA 3W4JA 2K87A 2BUCA 3VOSA 2ZG6A 1UDRA 2DR0A 2WFLB 3Q2IA 1RMQA 2WIJA 4XYEA 5H7XA 1FDWA 4CVNA 2ONCA 4Z2AA 3HM9A 5L3RA 4O2BA 5T8KC 3CEPB 5E4TA 4W1QA 2BNKA 4A5RA 5K3AA 2E8IA 5EWMA 2AQIA 3GPPA 1OMOA 3AGQA 2XCIA 3IOEA 2C5HA 4HB3A 2JGDA 1J8DA 3RT1A 3KLMX 4NNOA 1G3MA 1M0EA 3I23A 4KX9A 4Y9UA 1FPMA 3N7TA 3ZE1B 2P4EA 3EEFA 2YHUA 1MX5A 1MTOA 3PHJA 3TM4A 4KODA 2Y9MB 4EEZA 4UNQA 2O8CB 2DZNB 2QTWB 4GMDA 5H8WA 1SXJD 3KW6A 2HL7A 1RXVA 4RJJA 2W6ID 3WGTA 4URYR 3T4QA 4QQRA 4M0DA 1G63A 2CKDA 4PLGA 4DUPA 1TLLA 4R1PA 1F2TA 3OZFA 3V1YA 3BK1A 4YRGA 1NBWB 4E11A 5EQDA 4DYVA 4D8VA 3A1CA 1HVBA 3L40A 3FTXA 4I99A 1SHVA 4XDHA 2D5LA 1DEKA 4NWIA 1URPA 1X1EA 1GRRA 5AI6A 4UA6A 5G0WA 2UXDB 2ZR0A 4O4HF 1RRPA 4XFDA 3I58A 1ZG3A 2BP7B 1JG6A 2B8TA 3WLIA 3QP8A 2IHJA 3AGPA 3IS3A 3ZCUA 3GLIB 1N9LA 4HJ4A 1EDDA 4LTNA 1REQA 2H5SA 3PCTA 2R59A 2ZU0C 3NS7A 5ALEA 1B0UA 1MNQA 2ZRJA 1XF1A 2W70A 4B4ZA 3IWOA 4FS8A 7ABPA 3TQSA 1SJ9A 2CHVA 4NESA 1YS6A 4AZ0B 1WKVA 4BP1A 1LW7A 3PEVA 3TPFA 2OILA 4XM2A 1GAJA 2YFKA 1J70A 3PYPA 3UT5A 4Y18A 1NQAO 4GGPA 4AJJA 1S1MA 2R6ZA 4C2UA 3W4IA 4EABA 1JFVA 3WADA 3L4BC 4QHPA 3FKWA 2HDQA 5E6UA 4LF6M 1ZPDA 4GOGA 1OZ0A 4CLQA 4AR1A 3O8OA 2QVLA 5JAZA 4ZMSA 1VG5A 2XKKA 1H2WA 3RKUA 3ZGNA 4K6FA 4UUMA 1E96A 4DR2M 1KEUA 1AK9A 5KQPA 5F4BA 4Q4IA 1R0YA 3MGGA 5T6BA 1Y6JA 4BKQA 3TZKA 1YZGA 4MI1A 2VYVA 1LX6A 1PJ4A 1PQPA 2OGUA 4KIFA 2IF0A 1HFEL 2QUZA 3TS1A 1E9CA 4D92A 2CZCA 5FAKA 3DCNA 1W47A 1LSUA 3WHPA 3L25A 3IXLA 2X23A 2WA2A 1MH1A 1V8OA 4CCYB 2HK7A 3PQDA 2QHKA 4H3HB 2PV7A 4L9EA 3H7AA 5ITRA 1U2GC 4S1TA 2Q5EA 1PZEA 3OJFA 3UE6A 3PKIA 2PYPA 1OBVA 3SZ3A 4YGXB 3CLTD 2F5OA 4NFSA 4Z7IA 2NXWA 3AUKA 2A78A 4HOYA 3FFWA 4NH4A 2BIFA 2CNDA 3K96A 1G0OA 1O54A 4PHHA 3ZDRA 3QX7A 4QYIA 3MN1A 2L18A 3N75A 2X4AA 5MGNA 5L95A 3F92A 1RIIA 3HUUA 2AI2A 4C7OA 3INGA 3TRHA 2DI0A 1Z8FA 3WYCA 5LQRA 2R8ZA 4YAUA 1M6VA 2HA3A 1RC1A 4L7QA 5HKOA 1CNEA 1N0VC 3KR0A 3F98A 3ESDA 2E0IA 2DHEA 4FKEA 3TBHA 4Z99A 4MTLA 1VDZA 5G4YA 1QDRA 1NSTA 1MNAA 5HNKA 1DINA 2Q5FA 2QDKA 1YL7A 2EKQA 3LYLA 4MV0A 3PUVA 1J56A 2EG5A 3CB4A 1D0SA 1LRLA 4Y6RA 3ILXA 2IPLA 3UOGA 5DT2A 1JMKC 1QZEA 1GILA 3OPQA 1TCCA 2EJBA 1FJHA 4YQFA 4L6IA 2CJWA 1Z7GA 2WZQA 1J49A 2DVMA 5LB2A 1FXWF 1T4MA 3NT5A 1OFIA 1QV7A 3AHEA 1UMDA 2Y4NA 5E0OA 2R5FA 2J9PA 4P6VF 4DRTA 3QU5A 3O3NB 3OH8A 2N75A 1MH9A 4GRDA 1SC3A 2FY8A 3PUZA 4DKJA 2V8FA 1Z35A 2PMBA 3WSVA 3I6YA 4FT2A 5CA0A 1SDNA 1FTNA 1YCFA 3RG2A 1H5XA 2IUUA 3KV1A 1PI3A 4HPWA 4QUKA 4Q9LA 5T3YA 4RVUA 5EXPA 1W93A 5L8VA 1V71A 4WOKA 1L5MA 3V32A 1EFRA 3WGJA 4KQ1A 3MCWA 1QRSA 1JENB 4DMGA 3H5LA 3T1VA 2BEWA 1ERMA 1FVOA 1CJFA 4F2WA 3G35A 1CUCA 3IXBA 1T5BA 3O5YA 3T9FA 1CY2A 1YAHA 2NUTA 5LDHA 1OA0A 5BQ5A 1G6AA 5K6TA 4QYMA 2I87A 4M8LA 3WQHA 2CVZA 3BBPA 3VU3A 3FPBA 3H2GA 4ZDWA 4F3KA 3NHPA 4BP3A 4C2AA 3S8MA 1W46A 1NFQA 3SYLA 4A5SA 4CIBA 4QARA 3X44A 1SXQA 2FQWA 2P5YA 4DEXA 2A9PA 3FROA 4R3AA 4MOWA 5KWVA 1U2ZA 1KORA 4QGHA 1Q7EA 5B53A 1MIHA 1ZXBA 3EY4A 3BGOS 2NU6A 1MPXA 1EX9A 2X19A 2OFOA 3LZ6A 4OHYA 5L7WA 4ZI7F 2VPIA 3H8JA 3E5MA 4KZ6A 1CJTC 3F7MA 1D2NA 2DFDA 3T1SA 2YVAA 3C6ZA 5IJ9A 4BD1A 3L6DA 2WJHA 3RLIA 4XVHA 4Z4CA 4BX2A 3ODGA 1O95C 2OA0A 3KE8A 1XHLA 3E70C 2OCBA 1GPKA 2FSVA 1PT8A 3QYAA 2RGNC 3F1OA 2ZB3A 2J80A 2ZUEA 1MZUA 4PE5B 1KFKB 1BCRA 4F93B 3D3NA 4G8BA 2E4XA 4LV2A 1H4TA 5DISB 4PNEA 1ZNQO 2MJ5B 4OUDB 4H6VA 2CZQA 1CQXA 4XUGB 1CVIA 1SUIA 1WBBA 1NBMA 2QVXX 1ZHOA 2PZAA 5B57C 4W5OA 2FHPA 1J1IA 2HLPA 4JCCA 1JQBA 1V7CA 3PQ6A 2ODTX 1CJSA 2AC4A 2FMKA 3SBOA 1GABA 3C3CA 4R9SA 2REOA 5L8PE 3LH5A 4NICA 4V39A 4CMCA 3HJTA 5C9ZA 1V1JA 2XPYA 1V5FA 2OE2A 1QRTA 1L1RA 3K9CA 4NMWA 2WKHA 4IXMA 5K9ZA 4EI9A 5H16A 4F21A 3ZQKA 5ISMA 2FR8C 1P3Y1 3K6RA 5C37A 2J3IA 1CY8A 4PFSA 3VO2A 1J3WA 3AG6A 4OU4A 4G2TA 1KC1A 4MRSA 3Q1KA 4LRWA 1WMSA 3I1YA 4X6LA 2P8JA 2BBOA 2NVOA 4UNSA 2KE5A 4TLBA 3GNSA 2G7MC 4IUDS 4QQKA 1WIVA 3SSAA 2FMXA 1AS2A 3OY2A 1OTBA 3IILA 3ZHUA 4DMKA 3VA7A 4HB0A 4ENPA 5F23A 5CEBA 5IDXA 5KAMA 4R9NA 4B8YA 1IY0A 3BL5A 4HLQB 4C22A 3IOMA 2VJAA 4RGYA 1P3JA 3DHEA 3HXPA 4M0FA 1W59A 4OHK<