4II7A

Archaellum assembly atpase flai
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
512
structure length
504
Chain Sequence
SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGEIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
molecule keywords FlaI ATPase
total genus 156
structure length 504
sequence length 512
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ii7A05
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ii7A02
3.30.360.100 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ii7A01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ii7A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ii7A04
1XX6A 2ZI5A 5DI9A 1G21E 3WMGA 1M8PA 2G0TA 2ZSAA 4OK5A 2ECKA 2J9RA 3PENA 3Q72A 4MGZR 4PZZA 4LYFA 5DE3A 1GTVA 3B6EA 2Z5FA 3TR0A 4BZPA 1ZINA 2FEOA 1DE0A 3DKVA 2EWVA 4KV9A 1RPZA 4RD3A 4JMPA 2ZRLA 2ZU0C 2CEAA 3CONA 5EE5B 1PLKA 4C3ZA 2BMJA 5JEEA 4GI7A 5DO9A 4ZCMA 1D2EA 2QN6A 4YDHB 4ZKEA 3BH6A 2ZE7A 3RS3A 3R7WA 2JIZA 2JJ2D 4IEIA 3IBYA 5JHHB 2EFCB 3DOEA 3IO5A 4O2RA 1WP9A 4B32A 1YJ5A 1ELOA 3T15A 2XOKA 1KOFA 4MUBA 3QG5A 3VAAA 5H68A 1MABB 5KDLA 1QHNA 2ZAOA 4N3NA 5FI1B 3SZRA 4DCTA 2QP3A 4HB2A 5JRJA 1G6HA 3HR8A 3N2EA 4RD0A 3X1WA 2AR7A 1US8A 4V02A 1NSFA 4MUAA 2OCYC 2EYUA 3WBJA 5L3VA 1GM5A 2QPOA 1LV7A 2BM0A 4NCKA 3T1OA 3TUJC 4DCSA 4DKXA 4ZDIA 2BMEA 1YZNA 3EZ6A 1IOZA 1D2MA 1EFTA 4RD6A 5IK2A 4MGKR 2XZPA 3MMPA 2FF7A 5EP3A 2OEPA 3B1YA 4FINA 2Q3MA 5DI3B 1ZIOA 1N0VC 2ZRKA 4D26A 2R65A 2BMFA 2C9OA 3KB2A 2JATA 2BM1A 2QUZA 1KO8A 1KMHB 1JNYA 1Q44A 1XRJA 1E2GA 3EIHA 4PZLA 5JI3E 3B60A 4M4SA 4Z54A 1JR3E 4QBHA 5HTKA 4HZUA 3QF4B 5FL7D 1U98A 4YQFA 4NHOA 1N6PA 2ZRCA 1S1CA 1G19A 1NF3A 2OAQ1 3FHTA 3GJ5A 3U61B 1MRSA 3NG1A 5FUYA 4KBFA 1CJUC 4NL4H 4AKIA 3IBGA 4KO8A 2BV3A 521PA 3TW8B 1L8QA 2IF0A 2P65A 4AYTA 4G1UC 2R6DA 4DEXA 3NWJA 1V43A 3TH5A 3X2SA 4JLDA 5CK5A 3FHCB 2FZ4A 4OI2A 4DDWA 3KQKA 3VR5A 1H65A 4YONB 2GESA 3L8YA 5AJXA 1XXHA 2XJ4A 2PX3A 3CH5A 2QPAA 3R20A 1OYWA 4Q02A 3OE7D 1NY5A 1U0HC 1WDTA 3GD7A 2QE7A 2WOOA 2ZR0A 4F93B 1D6JA 2BBTA 5GVRA 4PHFA 1T6NA 1AA9A 1S3GA 2WHXA 2NO7A 3B5JA 3SU8A 5KO2A 4TYNA 4NTZA 4QGGA 4M9XA 4V0NA 1FQKA 2DYKA 2P6NA 3OF5A 4F4IA 2F43B 3I5XA 3WHLA 2BBWA 2F9LA 3CWZA 3R8FA 4IDOA 5IF9A 4UNPA 1O87A 4Z1MD 2WWFA 3BAFA 4B47A 2QT1A 1OIXA 1LB1B 1LF0A 2QT0A 2ZJBA 1IBRA 3LQQA 3I8XA 5HCNA 3R7WB 5L3SA 3CRQA 4YLGA 2QRZA 3GPLA 1R6BX 3RDPA 2GTPA 5C1BA 1CRPA 2FGKA 2ZS7A 3UKDA 2FN4A 3I3SR 2ZUDA 4ZI2A 2F3TA 2REOA 2RHMA 1T0JB 1NSTA 1IJEA 3W8RA 5LB2A 1BIFA 4PQFA 5FOVA 4DLSA 2PT5A 4LC0A 4DXAA 1YZGA 1GUAA 1MV5A 4BFUA 4AIIA 4PQYA 1SVOA 2HT6A 4BEJA 2XAUA 1ONBA 2IYXA 3Q7QA 2D3WA 1CP2A 4Q9IA 2BCJQ 3QXJA 1G3QA 2ODBA 1U90A 2ATXA 3CH4B 3QI2A 4A0RA 3K0FA 1XFAA 3AUYA 2IEYA 2OT3B 4BRUA 1XTIA 4PC7A 4I99A 2G6BA 1MOZA 3MWLA 2XTNA 5EE0A 4E09A 3A36A 3NHBA 4NH0A 4Z51A 5EE9A 1P62B 2WICA 4A0HA 3BB3A 3QBVA 2YWEA 2OM2A 3MUFA 5FR2A 5G3ZA 4CIDA 2ZETA 1ZU4A 2IUTA 4BRWA 5JWHA 4ITRC 1SXJA 3K70C 1EGAA 1RRFA 3B1WA 2C9CA 3B78A 1DAMA 4MYCA 2CHQA 1KJWA 2IYWA 5FOUA 5FUVA 5AUNB 3LW8A 1KO1A 4TLAA 1QHIA 5JRZA 4WAUA 1IJFA 3FPAA 1OE0A 1XWIA 3TUZC 2GBLC 4ZDKA 3U44A 3MLEA 4OHWA 1PUIA 4O25A 5KSOA 4DDTA 1W36C 3VNVA 4PO1A 3A1UA 2Z83A 3GJ6A 1OHHD 2BOVA 3ND9A 1DAKA 3KKOA 4GFDA 4FWIB 2AFHE 4MH0R 3L0IB 5G3YA 4Q1AA 3AP1A 4KFTA 3AF4A 3C41J 4KCGA 4GDFA 2C98A 4Q9HA 1NIPA 1ZW6A 2JAQA 4YXWD 4JBYA 1ZUHA 1OH6A 1YHNA 2WKQA 3C5CA 2ONJA 2YNMA 4M21A 1G5RA 1E2NA 5D3QA 3DM5A 4QM7A 1XD2B 1DEKA 3K0SA 3AF0A 2J46A 2PJRA 2OXRA 5FOXA 3NH6A 2GCPA 3KQHA 3ZD7A 4BLRA 4QBFA 1CBUA 2LKDA 2W58A 1ZJ6A 2C03A 4MKGA 4Q9JA 2IUUA 3DL0A 3RHFA 1FUUA 5E95A 2C77A 3FWYA 1XJQA 5FR1A 3TSWA 4LHYA 2A3RA 2JLYA 4F7WA 2UKDA 1JQJC 2HYIC 4QJ5A 2FGJA 1R2QA 4X8HA 1AM4D 1E9AA 4Y0AA 5BYJA 5SZKB 3T06B 5B64A 4F92B 2JLRA 4BLPA 3U3MA 1Q1QA 3GFOA 4MKHA 4NDZA 1MKYA 1COWD 5FBQB 1Q57A 3B9QA 3HPQA 3FYHA 2QL6A 4LGMA 3AUXA 3W3ZB 5JWOA 3P26A 1YR7A 4E07A 3N70A 4FN5A 3SS8A 1B23P 1AS3A 4IDNA 5JJKA 2K5UA 4LHVA 4JVMA 4J0QA 3GLFA 1II8A 4CEJB 1Z0KA 3M0EA 4JT2A 4WA7A 4NYIQ 4EQ6A 1CR0A 2QE7D 3AB3A 3F3YA 2DFTA 2RGNA 3LXXA 4C0QC 3QE0A 4II7A 1S1MA 1Z0IA 4LHXA 4CVNA 3TE6A 5CLQA 1E94E 2GEDA 3K53A 1OB2A 4A6XA 5GJBA 3IHWA 3RRZA 4HYYA 3T1VA 3KFVA 2QEQA 4PANA 5G41A 4FMDF 2ZEJA 3LRPA 4ASUA 5A5GA 2E87A 4MA4A 2IK8A 2C04A 4I1SA 4L16A 1N6RA 3ZVRA 4EPVA 1DAEA 1Z06A 2C99A 2OCPA 4TMKA 4DBLC 5F98A 5DN6A 4L9SA 5FTLA 3U44B 1DOAA 3EC1A 5FPSA 2G88A 1W46A 2ZI6A 4LBZA 721PA 2FSHA 3IO3A 4MITA 1XBTA 2QBYB 4DSUA 2FPMA 4IDQA 2WJYA 1HYQA 3CRRA 1QG2A 3A8TA 5EP4A 5FL7A 1KDRA 4A2WA 3G0HA 1WRBA 4G01B 5EZ5A 1SVKA 1W4BA 2BMDA 2QAGC 4B76A 4A2PA 2MSCB 1SZPA 2G1KA 5EE1A 3U2QA 3ADKA 3OFND 4FMDB 1AZTA 4UNRA 2PEYA 1VIYA 3TMKA 3GMTA 4AKEA 3A6PC 1UKVY 3QJYA 5AUPB 1WBBA 5D3MA 3LWNA 4XOIA 4XSHA 4CF7A 3R9XA 3THYB 4RJLA 4AD8A 2NZ8A 4JKYA 3S1AA 1ESNA 1NRJB 1QHYA 3RNLA 4LK2A 4HZIA 1E9EA 2HLDD 3NDPA 4GOJA 3SR0A 1OJLA 1D2NA 2CHVA 1N5KA 4HDOB 1G7RA 1ZCBA 1QHSA 3VR2A 4XWAA 5DGXA 2QTVB 2J7KA 2X77A 5KPJA 4E5UA 4EPXA 2GAAA 1X8JA 2YV5A 4JLNA 5J47A 3CWQA 5KOYA 1UDWA 4AWXA 2P6UA 3RC8A 4DC9A 3BH7A 1BYIA 4PPGA 1VPLA 5LPNA 1KO4A 4CT4B 3X1DA 2IL1A 1G8PA 3EPLA 1JR3A 1KMHA 1NG1A 5FOWA 3HU1A 3TVDA 1IXRC 1QBKC 2VHUA 1E0SA 2A2ZA 3NTUA 3M6AA 4DB4A 1OFTA 2GDJA 3U7GA 1E2IA 1JAIA 3KTAA 3KQLA 4OI0A 2RGAA 2Q9AA 2ORVA 2OBMA 4BFXA 3GLHB 3A1VA 3L82B 4HSEA 4OK6A 2QAGA 3EASA 2CJWB 1YRBA 2HCBA 4PR0A 1BS1A 4KSCA 5JSZA 2O0HA 1KK3A 3RS4A 2XTMA 4CDGA 4MDEA 2ZU6A 4R2IA 2D62A 1N3BA 2FJUA 2W2VA 1XZPA 3WP0A 3FKSD 3EZ7A 3NKVA 4GZLA 3PQCA 4AK9A 2X2FA 5CIQA 4B3XA 3LX5A 5FBRB 4U7DA 1DPFA 2CK3A 1E1QA 1W44A 3TJZA 3VHLB 5J4KA 1EFHA 2WM9B 1T4GA 2WPDA 2CLDX 1IXSB 4JYBA 3VHXA 1U0JA 2ZREA 3GJXC 4FXPA 5DSZA 1ZC3A 4GP6A 4Q1EA 3AF1A 3AV0B 3O8RA 1Q3TA 5SZIA 4WVFA 2CCKA 2I4IA 4DLWA 4HZUB 2AX4A 2GNOA 2QPTA 1SHKA 3GLGA 2ZJYA 4GOXA 3FTQA 4LV6A 2F1IA 3W5IA 4W5JA 3FB4A 4X8OA 3IQWA 5UKDA 3SNHA 3CR8A 3KKMA 3FVQA 2HXYA 4QHTA 4GMDA 4CEIB 4JL8A 3SYKA 5K8IA 2ZVQX 4W5HA 3BIFA 2IYLD 3CPEA 3MRSA 1D5CA 4M22A 2WTUA 2J5XA 2RGCA 3SDZA 2ZRDA 1VHLA 3OIWA 4RSGA 6Q21A 1E2FA 2XB4A 5KSYA 2W6IA 1ESMA 1UJ2A 2O8DA 1KK0A 1ZD1A 4LHZA 2YJTD 4D25A 1M74A 3TLXA 3QVVA 4FIDA 4PAMA 1O3YA 4B44A 4OK3A 1TAGA 1GL7A 1OPXA 3JZAA 3DMDA 1SVSA 4KXFB 3KTAB 5FOTA 3V4FA 2VF8A 1KIMA 3UG6A 5BYKA 3KB1A 4PQRA 3WBKA 2G77B 4B3BA 1ZC4A 1XCPA 4TYPA 3RYTC 2N42A 4AG5A 1HEIA 2H1LA 1VCMA 1G8HA 4JVNA 1X1SA 1EESA 4ACBA 2IUSA 3TQFA 4FWTA 5FUXA 5L3SB 2EVWX 4Q4LA 1F6BA 1FMJA 2CXXA 1VIAA 4LZZA 4Q47A 4TQAA 2IS6A 1P2TA 2HUPA 5TY0A 2Q21A 2B7CA 4NYIR 1G3MA 2PMDA 1SKQA 4JL6A 1Q1BA 1P2SA 1YRAA 1E0KA 2IYYA 4URUR 4EAQA 4GZMA 4M9QA 2F43A 4JLKA 2R6AA 2OESA 2VH5R 1V5WA 2GCOA 4EFMA 2ZRIA 2WIAA 1X86B 2O8BA 3AKYA 2QGZA 1E4VA 4M1OA 4MKFA 1BMFD 4GNKA 3GLFB 3KQUA 5FH9A 4GRAA 2D2FA 2ZI7A 1G1MA 2VP4A 4LJ5A 4G5QA 4M1KA 1XXHE 5E4FA 2ATVA 4V0ME 4PPFA 5TB5A 4RZUA 4PC3A 3K0EA 3Q5EA 4RZ2A 1J90A 2CVHA 3O8BA 4PTLA 1XPUA 4TLDA 3A4MA 4A4DA 1R0YA 1D9ZA 5JLJA 4KITB 3A58B 1LS6A 3JVUA 1XD8A 5JBQA 1UEIA 3QVUA 2WWXA 5DIFA 3GLGB 1IONA 4D4JA 4MRSA 2ZE5A 5M04A 2ZI9A 4QBIA 4MGYR 4F91B 1N5IA 2QSZA 3RC3A 1AZSC 5EXXA 1EFRD 1OKKA 2HYDA 1Z22A 4Q4AB 3WMFA 3BRWD 3I73A 5FPKA 1QG4A 2EFHB 3FDIA 4TSFA 1FQJA 1BH2A 3WHKA 4B43A 3MFYA 5JHGB 1W49A 5KNDA 3IPYA 3OAAA 3CF6R 2AL7A 2X2EA 2NGRA 4XTCS 1RIFA 2FNAA 3VR3A 3ZS9A 1RFLA 4LPKA 1HUQA 4KI0A 3F5FA 3OE7A 3PV0A 2O8EA 1R8QA 3WRXC 3KKQA 5DN6D 1LW7A 1XMSA 3RRYA 4D6PA 1UBGA 2ZQ5A 1E9RA 1OIVA 1OIWA 2PZEA 3I62A 2IF2A 3LLUA 4KFSA 4R7ZA 4NKRA 5DH9A 1K5DA 1Z07A 4DCVA 1Q1ZA 2HDNB 3CNLA 3GJ4A 4POAA 1KAOA 1KJZA 5F9HA 5AK0A 2PT7A 1GVNB 5FUWA 3CX7A 2P5SA 2JJ1A 4XH9B 1X3SA 3REFA 1VG1A 2FSFA 4JZKA 2IT1A 1DADA 1KK2A 1E0AA 1Q1EA 4M53A 3TSZA 2XXAA 4BE7B 4Q01A 3P27A 2EYQA 1T9HA 3WRYC 4IJMA 5CDFE 1QHGA 4WZAE 2P3SA 2B8TA 4P4SA 4DLTA 3HR7A 4LV8B 4URXR 3QPWA 2O8CB 3FFBA 2WZQA 5C4GB 5CM8B 4JBXA 4DVGA 2VHCA 3BS4A 2HLDA 3VQTA 1W5TA 2CLSA 2A7QA 3R9IA 5JFGA 2YOFA 4CZ2A 2OLJA 3SFVA 4AY2A 4EJSB 4JBWA 1F5NA 1BMFA 1WMSA 3LX8A 3ZYCA 1II0A 2RKOA 4TL7A 4QKQA 5KSZA 3QNUA 3R8CA 3HDTA 1PLJA 2VL7A 4BFTA 1P4SA 2O8FA 4AYWA 1FZQA 3MCAA 2VPPA 4R9UC 1T8TA 2RGGA 2RMKA 3E70C 4PHHA 4DLVA 1PVOA 1S3SA 3SI7A 5P21A 3PR1A 2DCUA 2YVUA 3I72A 1R8SA 1WB9A 3FHOA 1CULC 2CLCX 4CRWB 3SYLA 2PCLA 1RKBA 1UPTA 4KU4A 3BFKA 2CMKA 4U00A 3C14C 2Q0HA 1QHXA 3LA6A 5JZVA 2PH1A 4CT5A 2JLUA 4QNMA 2I3BA 5D3MB 4EKDA 1TX4B 4KBGA 2WSSA 1P7CA 1TEXA 2ZYVX 3CRMA 4TT3D 1P9WA 2IHYA 3QG1A 1A5TA 4ZIRB 3K09C 3U60B 2IYVA 4A15A 1VMAA 2WMNB 2CL7X 2XNSA 4IRUB 2BBSA 4Z1MA 2F55A 1CJTC 1XEWX 2EW1A 5J4VA 5TMPA 2IYUA 1P2VA 1KK1A 3WYFA 3OAAD 4C9BA 5B30A 2NQ2C 2NO0A 1NLFA 2Z6VA 4K81B 3BBPA 4FW9A 3WP1B 4TQUS 1W7AA 1U9IC 1M7HA 2W83A 4LJ8A 4MRVA 5EP1A 1XTQA 3W6PA 4HAZA 1NN1A 3T1QA 1XCGB 3UPUA 4M8NE 2G83A 1TU4A 1YZUA 1XCMA 3KJGA 2RGXA 1W47A 2A30A 2CCJA 4C0KA 1GRRA 3QXSA 4NE2A 4BPBA 3AVWA 4TYQA 1KI1A 1HQCA 4IVRA 3CPHA 4C30A 1OV4A 3QF7A 1R5NA 1SXJC 2R6FA 4OJKA 2QA5A 3RS0A 1Z6TA 1XJCA 4JIMA 2GJ9A 4BLTA 1U0LA 2BC9A 4O2LA 1X8KA 3EAQA 2C9YA 2JEOA 3G5UA 1ZUIA 2BKEA 4GPTA 2NTYC 2GWHA 2Z43A 3AF3A 5H70A 4IOMA 3KXIA 5IDVA 3ZS8A 3SEAA 3SJAA 3GEHA 3H1TA 2QM8A 2HJVA 1SKYB 2ONKA 4NCHA 4B74A 3BB4A 3P4XA 5KHOC 5K8UA 2JIZD 4QC2A 1PLLA 1Z0JA 2GILA 1FNNA 2X8AA 1DAHA 2QP9X 3MAAC 1YQTA 3E5HA 1N25A 5CB6A 2GXQA 4WOPA 4C2TA 3BFVA 2CVFA 3BWDD 5FPHA 4QHYA 3CUEF 2P5TB 1CTQA 1KSFX 1R7RA 5DI3A 621PA 1MO3A 4P0TA 3RSLA 3WY9A 4QGAA 2VHTA 3GLIB 4DLUA 3CM0A 3BB1A 2XXAB 2ZRJA 2GKSA 4N0EA 4LI0A 2D74A 4NPHA 1L7VC 3LO5A 2WSMA 5FBLB 4BLSA 3KUCA 4R2HA 4Q21A 3HP1A 1Z08A 1FNMA 3HJNA 2FFHA 1NMZA 1KI8A 3L8ZA 3PVSA 3ZQ6A 3RAPR 2OLKA 1JPJA 1Z63A 1X1RA 4YXWA 4EUNA 3UIEA 3CKLA 2Q3HA 5DYGA 4URWR 2AK2A 2V1XA 1Q20A 1ZNWA 4TL6A 3KKPA 5C46F 3PUYA 3VKGA 4MRPA 1A2KC 4EJSC 2IEZA 1MH1A 4JLMA 1JI0A 3EA0A 2RHDA 4OQFA 4TMZA 4RKFA 4B48A 4JL5A 1OYYA 3GEEA 2Z0MA 3U5ZB 2HCJB 5LDDC 4FCWA 2ZE8A 3B7GA 1NKTA 3CX6A 4ZPXA 5AUQA 2EFEB 2V3CC 3PEWA 1B0UA 4G5GA 3A37A 2G9NA 3I92A 1IY1A 2GF9A 2F9MA 3DZDA 1I4TD 1PV4A 1XEFA 2ODWA 5FFMA 2A5DA 4IDPA 3TRFA 1OW3B 1XU4A 4M1TA 1L2TA 2QI9C 3CLVA 3TK1A 1OFUX 2B7BA 3OZXA 4UXJA 1NVVQ 3QIAA 5BW8A 2AFIE 3A4NA 4HB4A 1X8LA 5J4YA 3CF0A 1Q0UA 1G41A 1KI6B 4NZYA 3VFDA 1II9A 1SHZA 3BK7A 3D7MA 4Q48A 2XSZA 1Y3AA 2ZAMA 4HLQB 1UEJA 5CB8A 1VYUA 2VHJA 3IHLA 3GLIE 2PLRA 4NMMA 1ZP6A 4QFMA 4V0KA 4A92A 4IHQA 1XTKA 4PSKA 4Q7KA 4A2QA 3BORA 4EDHA 5CITA 4Q9LA 4G3XA 2W2TA 3EARA 1UF9A 2GXUA 2ORIA 2XZLA 1JXOA 3PEYA 1SVIA 1EFCA 5B58C 5HZHA 1JECA 3H0KA 5E3HA 3W3AA 2BCGY 3QUSA 3KQNA 4OHXA 1MABA 1YU9A 2DWOA 4LJ6A 4HUQB 4JVSB 4OKSA 5GJVC 4XD7D 2J0UA 4I1UA 1OHHA 2MMGA 4RVCA 1SKYE 2EFDB 1OT3A 2VQSA 3NVAA 3T1TA 4TYWA 4GSYA 1GOTA 2REXB 3IILA 1NLYA 3U7HB 2NO6A 2ZRPA 4KFUA 4TN1A 2ODEA 4PHGA 3RRMA 1GNPA 1G7SA 3VU9B 5JI2E 1E99A 5H8WA 4RZXA 2FG5A 5FPTA 3QEOA 4PO8A 5L3RA 1W2GA 3OHMA 2QTFA 4Q7LA 2Y8EA 4NU0A 2OXCA 3REGA 2JJ1D 5KTYA 2WWIA 3FOZA 1A1VA 4L15A 5E7IA 3RABA 1R0WA 2V4ZA 4A36A 4NYMR 2WAXA 2X19A 4CW7A 3O8DA 3FMOB 1M2OB 2O8FB 4OHVA 3THOA 3HU3A 1Z0FA 1I2DA 1KHTA 2XGJA 1KNQA 2NO1A 3T5DA 4PHTA 1NVVR 2PLFA 2CL6X 2RH5A 4XVQA 1KI7A 5HKKA 1WCV1 4LYJA 3QXCA 2GVDC 1AN0A 2OAP1 3UMRA 3GP8A 2FPLA 1W4CA 4DSNA 3B1XA 1VDZA 5IRCD 3JVVA 1CEEA 3B8HA 2AWOA 2DBYA 2PBRA 2WV9A 1HQYE 2YHSA 3O8CA 5IT5A 3WMEA 1F2UA 1YVDA 1P60A 1NKSA 3BD9A 2R9VA 3BC1A 3LBNA 4P4SB 4CGZA 4M1YA 5B57C 3OESA 2G3YA 4GOKA 4JLBA 4NCNA 2VP5A 1M6NA 2CK3D 1SVWA 2AXNA 3N2IA 2ZJ2A 2ODNA 4BFZA 2R6CA 1R5OA 2VYFA 1QF9A 4N0DA 2IS1A 2C78A 1IQPA 2WWGA 2WJIA 4XWOA 2D7DA 5EZ6B 3P32A 1FX0A 2OFWA 3VR4A 1HURA 1NL3A 1VCOA 4DUGA 4XWKA 1DG3A 5AWFC 1A2BA 3BGWA 1HA3A 4LDJA 4WXRA 2VSFA 3UATA 4OQNA 2JLVA 1J70A 3QXXA 5KUTA 2A9KA 5EP2A 3RWOA 1JXMA 1IY0A 4Q1CA 2VLIA 1Z29A 3BOSA 5GVSA 2KWIA 1AKYA 4ZDJA 2RGNC 3ZH9B 4OHZA 2C95A 4JJKA 1DARA 1W4RA 1ZD8A 2JJ2A 4V0OA 1P75A 4M2LA 1A4RA 4HAVA 2A5JA 4P32A 4U02A 1AQYA 2OCAA 4JVLA 3TVTA 1M7BA 2QAGB 3AVPA 1T8UA 3CZQA 5C4MA 4HAUA 3EPHA 3MD0A 5J5CA 1P9RA 1Z6GA 3UG7A 3UANA 2CHGA 1T0HB 3NHAA 1UM8A 4Q19A 1YZKA 1VYTA 1TPZA 2IS4A 4H1VA 1S8FA 1TF5A 2BHRA 4WZ6A 1UFQA 1E9FA 3K0AA 3ONWA 2GAOA 4S35A 1SVMA 4E22A 5EUMA 1KY2A 4FMCB 2YWFA 4D2IA 4YMSA 1E9DA 1CR4A 1QHHA 3EA5A 421PA 3WNBA 4GMXA 1OXSC 2ZE6A 1QVAA 4RCZA 4C0LA 4KYUA 3B9PA 1XEXB 121PA 2ZSEA 1XEWY 5FBWB 3TIFA 3UWKA 2IYRA 1TF7A 4NCJA 4ARZB 1JEDA 4IVQA 4QJ4A 3QEJA 1IY2A 1WE2A 3FMFA 2YZ2A 5FTMA 1KTVA 5FBVB 1J8YF 2FMXA 3LAWA 1TEVA 1Z2AA 3GJ3A 1HV8A 2QNRA 1E6CA 3VX4A 1E2QA 2KJQA 3A1WA 3TNFA 4G0NA 2ZI3A 2XNDD 1Z3IX 1YZQA 3THXA 3ADDA 3B1VA 2WOJA 4Q9KA 3THWA 2KSQA 3K1JA 1GNQA 3KL4A 1KSHA 1P3JA 3LD9A 3QKRB 1FPMA 4IVPA 4X8LA 4BASA 1T5LA 2F3RA 4NYJR 4C0HA 3AVOA 1FP6A 1JPNA 1BO6A 1RYFA 4PAQA 4MYTA 2FX3A 2WWYA 2GCNA 3FE2A 4YMUA 3UMSA 1N0UA 2QGNA 2JLWA 1U9IA 1MO6A 2DFKB 3RSOA 2WBLC 3TBKA 4D0LB 3QPVA 2H5EA 5J4LA 1SULA 2ZR9A 1BOFA 4C0AC 3K70D 3ECCA 4RFVA 4M0LA 4JLVA 4A82A 2OBNA 5TARA 1G4AE 2IBMA 2WJJA 8OHMA 1DAFA 1TQ6A 4P31A 1E2JA 4OHYA 4GT1A 5BN3A 1H8HD 4LBYA 1KI4A 2L0XA 4RFSA 2ORWA 4ZIRA 2Q3FA 2Q9CA 1Z0DA 5HPYB 2F1RA 2V1UA 2IX3A 1NMXA 1XDBA 3ASZA 1Z8FA 3ZQJA 2DHRA 3M4YA 3VR1A 2MMCA 1M34E 1KO5A 4CEIA 3ADCA 3OEEA 4UJ5A 2XTZA 4ZO4A 2BJWA 3MG9A 2D06A 4W5WA 3PEVA 2IS2A 1ODFA 3DHWC 3DO6A 4PSVA 2BVNA 1C9KA 4EQ6B 4A0GA 2CDNA 4C0SA 3DZ8A 3PIRA 4GP7A 1II8B 4MKIA 5G53C 4CEJA 4QRHA 2GJ8A 1RJ9B 3MWKA 1LTQA 3ZZUA 1AK2A 3GQBA 3KJEA 3QY0A 3C15C 2IYTA 4P3YA 2NG1A 1VCIA 1RC8A 3EWAA 3B85A 5EQTA 5HZKA 2XITA 1JAHA 4FCVA 4OBEA 4XSGA 4OJQA 3L0OA 2RCNA 2Q9BA 3GEIA 1E2LA 4RZ3A 1KI2A 1E2MA 4A1FA 2ZRGA 1G8GA 3AKEA 3QSYA 3HWSA 4NYMQ 4KLNA 4PX9A 1E2KA 1CIPA 4DLRA 1UBFA 2ZRNA 2IYZA 5JECA 4G5RA 1Z0AA 2ZS8A 3VKWA 2P67A 3KZ1E 1CF4A 2QORA 3W34A 1FMLA 4JLJA 2GVZC 4EPYA 1G5PA 3C16C 1HY3A 3IKJA 3TAUA 2NZJA 1GG2A 2ZXUA 1XMIA 4BZQA 4GL2A 2O8BB 3B13B 1I4DD 4DSOA 221PA 2KE5A 3BFXA 4IKEA 4NYJQ 4A6PA 2DFLA 2D2EA 2H92A 1VCNA 3F8TA 1U99A 1NVXQ 4OI4A 3GLIA 5KDOA 5AJYA 3KDSE 3UK6A 1TUEA 4QGFA 1W0KA 4EPRA 3QXHA 1KAGA 1EXMA 1ANKA 2VO1A 2C8VA 1NNEA 1QDEA 1E9SA 3OEHA 4PSAA 4BQSA 2W00A 3W5JA 3M1IA 1EX6A 3D6TB 4XIGS 5CIWA 2C96A 4TT3A 2YYZA 4Q4AA 4P4UA 2ASEA 2FV8A 4JLOA 4NP6A 1UBEA 1T3LA 2GF0A 1GL6A 4FMCF 3BH0A 3Q8XB 2BEJA 2HT1A 5J40A 3BE4A 1KDPA 3NIBA 3IIJA 1VECA 5LBIA 2J45A 4Q4HB 3DPUA 1M7GA 2QMHA 4KAXA 5FTKA 4C7OB 1ZM3A 4KODA 3AF2A 1N6KA 2IXEA 1F2TA 1ZM7A 3UMFA 3ND8A 3IIKA 1F2TB 1GRNA 1OH8A 1G9XA 4FD2A 1YE8A 1KY3A 3FKQA 3VR6A 3WXMA 4IXMA 1COWA 2LWIA 4NCIA 1RVDA 2R44A 3DDCA 4BUJA 5A4JA 2Z4SA 5DISB 2NMVA 3AKCA 2H7VA 2ZYWX 3ICEA 1S96A 2QMEA 1KZ7B 2GJSA 3Q3JB 5KNBA 1KYIA 2YC4C 3ZVMA 1F48A 1CLUA 1JBKA 1DO2A 4AC9A 3PJRA 2ZJ8A 5EUQB 1U2RA 2OG2A 2ZYUX 2V8OA 1NMYA 4Q1DA 4YMTA 1CKEA 3IPXA 1IAQA 1J8MF 1S9DA 4UJ3A 2P0EA 4F38A 4O0MA 3J81k 3K70B 3KUDA 4AG6A 2XX3A 2GK7A 4HAYA 5CJPA 2PMKA 3MWYW 1GP2A 3PUZA 5JJLA 4TL9A 3EXAA 2VSOA 1LVGA 1E0JA 4QM6A 3DM9B 2AHOA 2FPKA 1DAIA 4X8MA 1UADA 4JKIA 4AURA 2J0UB 3L2OB 1N0WA 3IIMA 4HUQA 2J0SA 3E2IA 1G18A 4RKEA 4CYMA 2GRJA 3SJBA 5DLQC 2UZIR 3QPUA 5KDDA 4WBSA 1P9NA 4QJ3A 2WWWA 3NC0C 5F3WB 3DEFA 4TTPA 4D80A 3AQ4A 3GJ8A 4HAWA 2HF9A 4ILEA 4B71A 5FTJA 4DLYA 3VNUA 2VTKA 2XEXA 5SZHB 2WJGA 4Q00A 1FTSA 1W0KD 1EX7A 2N46A 1SXJE 3IQXA 2H17A 3NDBB 3B82A 2F7SA 2VEDA 5EXPA 2BWJA 1LF5A 3L43A 3LH5A 3SBDA 1LNZA 4UNQA 1QHHB 1CR2A 2O5VA 2ERYA 3ZDQA 1G20E 1G6OA 1TQDA 1E9CA 1TQ4A 1NP6A 2SHKA 4LJYA 1UKZA 3CIOA 3K0AB 4IDHA 4M1SA 2R2AA 2QZ4A 1S0UA 4LHWA 3TKLA 3T35A 2OUKA 5EE3A 5HE9A 1QVRA 1TL7C 2O52A 3V9PA 4B6EA 2V54A 3K8YA 1DVRA 1JEEA 3DMNA 1GWNA 5K8TA 2LKCA 3TQCA 1P6XA 2AXPA 5BN4A 2ANCA 2QY9A 2FFAA 3A1SA 1I4LD 2BDTA 2YINC 2ZRHA 2QENA 4ERNA 3R9WA 4PFSA 3LY5A 3RS7A 1W36D 3AH8A 1IN4A 2GXAA 1XD2A 2W6JA 3QF4A 4ACAA 1KSGA 2AKYA 1W5SA 3CW2A 2PZGA 3BXZA 1AGPA 3A1TA 1ZM2A 1N6IA 2WAYA 1VKJA 3KJIA 2FEMA 3T5GA 4IFEA 4LC1A 3WNCA 3VTKA 4HB3A 4HLDA 1HT1E 4N1AA 3MJRA 1IN5A 4MRNA 1NBME 2V6IA 4B3GA 2RB4A 3W6NA 1G16A 3OIYA 4M9ZA 2V9PA 4K8OA 5DYIA 3SYNA 2QMUA 4RFSB 1JQLB 2ZJAA 1U8AA 3C5HA 1KDOA 4M1WA 3W8NA 1G17A 4E03A 1BYUA 3AP2A 2IXFA 3LV8A 2YWHA 5JSZB 1KKMA 3GFTA 3TR5A 2O0KA 2JCSA 2OO7A 2GA8A 1FTNA 3G82C 3TSOA 4PC1A 3K09A 3QENA 5FI0B 2VP9A 4DDVA 4XVUA 2HEIA 3Q85A 4LJ4A 4EIWA 4OYHA 4DLZA 2ZR7A 2FE4A 5CYOA 3U7FB 1E96A 3ZIAA 4UXHA 3VU9A 4R71A 1XPRA 2ZJZA 4P33A 4A9AA 4EFNA 4W7SA 2X1VA 1NVWQ 4QNRA 4RD4A 3ZJYA 1WXQA 4MQBA 2GETA 1AGRA 3ETLA 3AVYA 4WZBE 1A82A 2W2XA 1TADA 4BFYA 3B2EA 3Q5DA 2ZYTX 5BQ5A 5DHFA 4BFSA 2FSIA 4XVRA 1LFDB 1S9HA 2ZRAA 2CE2X 3V00A 1W36B 4LUCA 4Q18A 4ZDWA 3LXRA 1KO7A 2IWHA 4DT1B 3LBIA 3H84A 3KXKA 4LBVA 3GLFE 4PC6A 3Q9LA 4Z8XA 2J41A 4IEEA 4H1UA 5EJEA 1Z83A 4C7OA 2KBFA 2PCJA 1T3HA 3MJHA 2PL3A 2WSSD 1OH5A 4IOKA 4WIAA 2XJ9A 4A8JA 1R4AA 2ZJOA 5CLLA 3W9YA 1E3MA 2D7CA 3FMPB 4AYXA 3K9HA 1HTWA 5TXGA 2ZSBA 1KZGB 4YDSA 5JS8A 1RW4A 4HDQB 2OV2A 3GJ0A 1H8ED 4TL8A 1XB2A 4V03A 3EG5A 2ZRMA 2XSZD 2AKAB 2XB2A 2GJAA 2DR3A 2ZVPX 2OILA 1SVLA 2JDIA 2QU8A 1JR3D 4DZZA 1C4OA 2CE7A 3K0CC 3P1JA 2IXGA 2GZAA 3P20A 3DVLA 5FTNA 5IHPA 3IEVA 3FKSA 1E1RD 4URVR 2CBZA 3U3JA 2XOKD 3U7EB 1YR8A 4PPNA 4FCTA 3ZZTA 4C4PA 2GZHA 4DIDA 1FUKA 2BIFA 2OSBA 3AGQA 1L4UA 4LJAA 1NN0A 5K8LA 2IYQA 4DEYA 2AK3A 3PFIA 1Z6YA 2C5LA 1ZCAA 1KMQA 1S4QA 1G7TA 1E32A 1F60A 3V4RA 3E1SA 3NEYA 4G5SA 2HXSA 4ON9A 5E7MA 3VKHA 1N6HA 1VYVA 3EZ2A 5L3QB 4TZ0A 1AKEA 1ZD9A 3KX2A 4WXPA 3I61A 2GZDA 2YOGA 4Z8YA 1ZIPA 1JALA 1NJGA 2V7QD 1FL9A 1NIJA 2B21A 2ZITA 3I8SA 3VX3A 4ZV4A 2QQ0A 3IUYA 4TMVA 4D0NA 1MR3F 2YOHA 3K9GA 1WBDA 3WYAA 2FDCA 1AJEA 5JEDA 5F9FA 3QKSB 1YZTA 5CK4A 4TMWA 3SHFA 2OE2A 4NBSA 4KJZA 5CDFA 4L8GA 2JASA 2H16A 1LY1A 4XD7A 4MYUA 2W6ID 2ZSFA 5EXTA 1WF3A 2V55B 1VG8A 1GL9B 4QXAA 1Z2CA 5TVKA 4ZCLA 4JT4A 3ADBA 2LCFA 4YMWA 2JLQA 1UKYA 5HCIA 2OZEA 3AVVA 4TYYA 2W6JD 5JCPA 3BJIC 3RS5A 1T91A 2DB3A 4OQMA 2OCBA 4KHZA 3LFUA 1KSJA 4UNNA 1F3OA 2QTHA 1RJ9A 4Q5IA 4W9MC 2F6RA 1C1YA 4LBWA 5L3QA 3GLHE 4TWZA 2JLZA 2BEKA 1JJVA 2A5GA 3NBFA 1IN6A 1KI9A 4EPWA 1E2HA 1H8EA 2GJKA 3AEZA 1RYHA 3F0TA 2XZOA 1ZVQA 3RLFA 2VIIA 1K8RA 1UKEA 3N5CA 2KB0A 1E2EA 1HH4A 3EW9A 1G7CA 4TLCA 1OXVA 1A7JA 1GAJA 3LVQE 3AVXA 1KJYA 1RRGA 4JYCA 1TUIA 1MT0A 2BBOA 5KYKA 1TNDA 2ERXA 1MRNA 5BWMA 2A78A 2F1JA 1W0JD 1MO5A 5G40A 1U81A 2J0QA 2ZJ5A 1SQ5A 1P2UA 1NLZA 1XP8A 2XNDA 5SZJA 4B3DA 2ZPTX 1S2MA 2FH5B 1Q3HA 2JLXA 1GRQA 1XJ0A 3U3RA 4LYHA 2H57A 3QOFA 3SFZA 1U94A 3C4JA 2RGBA 2FSGA 1TU3A 4BLOA 4URYR 2ZIAA 1RE0A 3EWSA 2A5FA 2YKGA 2G0NA 4ABYA 3SQXA 5HKKD 4PPQA 5GADl 2P2LA 2VRWA 4LPSA 2DWQA 3PXGA 3ZIAD 1UBCA 1X6VA 4L4UA 3VMFA 4B35A 3W90A 2GHIA 1FP7A 1FW6A 3HU2A 1UDXA 3GCGA 1DO0A 3IEUA 2J59A 2O0JA 1XPOA 3LNCA 3KKNA 2OFOA 2YC2C 3PUVA 2KI5A 1NG9A 2FOLA 4A8JB 3L0PA 1P61B 1IXZA 1GILA 4TMXA 1SXJD 3SN6A 1G3IA 1G5TA 1GIAA 1ZM4A 4IOJA 3U4QA 1I2MA 2RAPA 4PZYA 3MWJA 3IGFA 3U3KA 3ZLJA 1ETUA 2R8RA 3DKPA 5FOSA 1OKKD 4ARZA 3IDQA 3OEED 1DBSA 3AGPA 3PUWA 5LD2C 4TZ6A 3EIQA 2AD5A 3AVUA 1E2DA 2J1LA 3PEUA 4TSFD 5AJZA 1XEXA 3LVRE 3RANA 4BLQA 1CR1A 1G291 4G5OA 1XMVA 1TMKA 1K5GA 1W2HA 1GZSA 1EFRA 1J99A 2WIBA 4DUGD 4NONA 5GJCA 3L0SA 1NN5A 3WNDA 4Q1FA 5B2ZA 1HT2E 5L8VA 5C2JB 4LV5B 3X1ZA 1N5LA 1M1YE 5AJVB 1E1RA 4KYIB 3CR7A 4D0GA 2F1HA 1OH7A 2A5YB 1KNXA 5JS7A 3CPJB 1GKIA 1ZNYA 4Q7MB 3AKDA 4HLUC 1G64A 1N6NA 2EQBA 2JDID 2GK6A 2G1JA 3OIUA 1E2PA 4BWYA 4AKHA 1XNJA 1GKYA 3LW7A 4HI0E 1WA5A 2B92A 2MSDB 3SJZA 2VP2A 2GBLA 4LYAA 4HAXA 2QAJA 4I1OA 4KFRA 3TW4A 3SC3A 2ZRFA 4RCYA 1OB5A 2WJVA 4A8JC 1ZU5A 1N6LA 4ZI3A 5A0FA 1DG1G 2WJHA 3I5YA 2E9SA 4B3FX 1Z47A 2ZUBA 3AM1A 1W4AA 2N1BA 3KJHA 2WKPA 4C0BA 3NC1C 3PCRB 1OLOA 5KNCA 4B3CA 1NN3A 1L4YA 1H8HA 1GSIA 4XTRA 5HR5A 4DRZA 4QGHA 3U6BA 2NPFA 1HE8B 1P5ZB 2J3EA 4TMTA 4WW0A 4B2PA 3PUXA 3SBEA 1OXTA 2CNWD 2DY1A 2FFQA 1G3RA 3QQ5A 4Y0VA 3I4LA 4H9GA 1OXXK 1AQUA 3W6OA 2R62A 1DS6A 2VBCA 1R0ZA 1VG9B 2CCGA 2V7QA 3LQRA 4KSBA 5ANRB 2JGNA 3ZVNA 2EWWA 5TV2A 4OQXA 3CNOA 4LOAA 4QHSA 1CU1A 1OFHA 4ESVA 4BZXA 2NOAA 2P6RA 1CJMA 1OFIA 1T3SA 4Q1BA 2PX0A 3OEHD 4QBGB 3U3OA 2PEZA 4JJZA 2ZM5A 4FI3C 2H18A 2Z4RA 5JMTA 3EIEA 1CJVC 3HYRA 4Q4JB 3C7KA 4UNSA 2VF7A 4TLBA 5LD2B 3D8BA 1TF2A 1D9XA 1SGWA 2DWPA 1F2UB 2HJGA 2IHBA 4AI6A 3BERA 4BGDA 1NY6A 1RZ3A 4XJXA 4MRRA 4LY6A 5LB4A 2J7PD 3X1XA 5CYPA 4K46A 2OFXA 1N6OA 3CF2A 4DLXA 3O47A 4DCNA 2DPXA 2REBA 1GITA 1GKUB 2DFNA 1FFHA 1E69A 1OXUA 4UXIA 2IWRA 4BFWA 1XMJA 4Q66C 3AVTA 1P73A 4URZR 3EPKA 1AS0A 3QKUA 4HLUA 1VHTA 4PAOA 1G8FA 2AN9A 2E1RA 4JLAA 4JS0A 4M9SA 3GFPA 1E79A 2WWHA 1US8B 4PXAA 3T34A 3MGCA 1XD9A 2B6HA 3PG5A 2ZRBA 1ZNZA 3SOPA 2VP0A 3AVQA 4BEBA 4TTRA 5TDHA 1VTKA 5FPYA 5AUOB 4BECA 821PA 1Z5ZA 1EK0A 3PITA 2QP4A 2TMKA 2H8KA 4DIEA 4I4LA 2FA9A 1LS1A 1W0JA 4UKDA 3TAHA 2UZ3A 3EPJA 4S2EA 3B1ZA 3EZ9A 4B2IA 1ZRHA 2IW3A 3CO5A 4B2LA 3ICQB 2IYSA 4DWJA 5KU1A 4MYHA 1W48A 4DB2A 4Q7JB 1DAGA 3QKRA 1Q22A 4R98A 3LDAA 2W0SA 1OF1A 2NPIA 3CNNA 3H2YA 3THWB 3K0FB 1XTJA 1ZNXA 2IC5A 3I32A 4US0R 5CM9C 3OFNA 4D82A 2EU8A 3K9LA 4D4MA 4BFVA 3K9NA 2JA1A 3Q7PA 1Z6AA 4LWZA 4L9WA 2QSYA 1D8TA 1DTSA 2RGDA 5AJWA 4B6FA 4ZKDA 1KI3A 3P4YA 2O8DB 2FZLA 2GCOB 4QL3A 1HE1C 5DHAA 1WQ1R 4RD1A 3UWOA 4PO9A 3ZVLA 4DT1A 2QRNA 3NEJA 1QZXA 2W0MA 2CNWA 1NBMA 4F4CA 2J87A 5KSPA 2QM7A 4EJSA 3THYA 2HF8A 4UQOA 1AIPA 2ZS9A 5CJ2A 4DCUA 4RY2A 2IA5A 4OI1A 1KI6A 5AR1A 4HATA 4Q4HA 4F4JA 4DHEA 1Q21A 3NBZC 4CEHA 2AWNA 3CRW1 2JLSA 2WVJA 1U8ZA 4ASUD 4LRWA 4DJTA 1N2CE 4US1R 1EFUA 1CS4C 4DDUA 1CXZA 5JJIA 2JJ8A 3AP3A 2ZROA 3LLMA 4Q03A 4TTQA 1U8YA 3KFXA 1NVUQ 3D3QA 2GEUA 1JR6A 2PJZA 3TUIC 2VP6A 4US2R 4QOSA 2I1QA 2YWGA 2MSEB 5GJWC 1J2JA 4YMVA 3CB4A 4DSTA 2VSXA 1PUJA 3FGNA 5ELXA 5BXQC 1KDTA 3NBXX 5JWRA 1YR6A 2WPDD 5H1YA 3THXB 1OSNA 1EWRA 1KKLA 1IHUA 1XXHB 1XTSA 3SHWA 4EPTA 1XF9A 4B34A 1BKDR 4IXNA 3NXSA 4V0LA 3SE0A 3I1FA 2EFGA 2OHFA 4TQ9A 1GDDA 2GXSA 1RRPA 2QG6A 5IK2D 1KGDA 3KXLA 3RWMB 4ESHA 4Q4JA 1R10A 2CJWA 1FOEB 2QROA 1E1QD 4MDFA 1ZM9A 3T12A 2KBEA 5F2EA 1ZUNB 1TQ2A 3FMIA 4KVGA 3TGPA 4KLZA 4ZCIA 3DOFA 1QRAA 5KPDA 1SXJB 4B73A 2PZFA 4PC2A 4P4TA 1YR9A 3QBTA 4FMBB 1J7KA 2ZI4A 2FWRA 4I81A 4B75A 4D4LA 2FU5C 3H86A 4JLPA 1AS2A 2O8CA 1MO4A 5E7JA 1YKSA 3QKSA 2OBLA 3EX7C 1NJFA 1ZAKA 2QQEA 1G8YA 4YC7A 3CRVA 1CRQA 1E9BA 2NIPA 1CJKC 3LBHA 1PJRA 3ZZ0A 2NO9A 2ANBA 2ZTSA 4KVAA 4V0MA 4D4KA 1R5BA 2J7PA 2CL0X 2VHQA 4HEJA 1IM2A 1IN8A 1NBMD 2BJVA 4IW3B 3H4MA 4OL0A 4HUTA 2ZANA 1NI3A 1E4YA 3GJ7A 5HE8A 1ZMXA 2WKRA 1JB1A 4LCBA 4OQLA 4LJ9A 5EXSA 3D31A 3GLHA 2V6JA 4GBMA 3SQWA 2AD1A 3UXMA 4B33A 3C8UA 1E98A 1RRCA 4AKGA 3CZPA 4RD2A 5BN5A 4C2UA 4JSTA 4O3MA 3A4LA 4JSYA 4I1VA 3MSXA 3QKTA 2VA8A 1EWQA 2RGEA 2QMOA 3T61A 2B8WA 4L5BA 1K6MA 4TLEA 3X1YA 5DNYB 1TTTA 2O8EB 1G4UR 1E79D 5JCZA 1Z28A 1FX0B 2J0VA 1P72A 3NH9A 1IN7A 1GNRA 1UAAA 1N5JA 4EFLA 3CX8A 4IOLA 2Q6TA 2R6GA 2UVQA 5C18A 3FFAA 1PZNA 1G3UA 1XZQA 1EG7A 2WMOB 2ZSDA 2C2HA 1ZBDA 3HPRA 2BKUA 3RS2A 2GEVA 4HDCA 3SJCA 3CBQA 4LX0A 3U6KA 3OIVA 3RVBA 3JZMA 1XTRA 2QBYA 2HV8A 1VG0B 3NBYC 4IFBA 1Q12A 3ZGXA 3GLGE 2I1VB 3RRNA 1DELA 3ZD6A 1GFIA 1R0XA 3WYGA 4M1MA 3EC2A 2FFBA 4CEHB 3HYTA 3U4QB 4D81A 2D4HA 4LSGA 5FL3A 4C0JA 4QG7A 4MGIR 1JJ7A 3S1AB 3EZFA 1T5IA 1ZYUA 1Z6XA 3K0CA 1YZLA 3ASYA 4HLCA 2ZUCA 5J4HA 1W1WA 4A0FA 4U5XA 4HB0A 4LJ7A 1Y63A
chains in the Genus database with same CATH superfamily
2C2OA 4GMGA 4H7HA 3QBJA 3ZDBA 3N2NA 2QTZA 1MZPA 2DKFA 3MJDA 1V1JA 4AW9A 1TDLA 3PHBE 3B7ZA 3I9V6 3PENA 3RQSA 2WNSA 2JL1A 4UEWA 3N5KA 5KPRA 4EHHA 2OGWA 1BHJA 4WL9A 1LDEA 1ZO8A 4X91A 2Z5FA 4IBOA 1ZINA 2Y59A 1DRVA 2CLEB 4KV9A 2EWVA 4X68A 4MV8A 1X80B 5FB3A 1RPZA 4FK8A 1OI2A 4YA6A 1CUUA 2ZRLA 1H23A 1PV1A 4K6GA 2KRUA 1B41A 1C4KA 1NDQA 2G06A 1TGVA 4PYLA 3SZLA 3G2OA 5FATA 1JSZA 3FM9A 3Q7VB 3UO8B 5IKMA 1H0HA 2QQFA 3ZCRA 1E61A 1Z62A 4GI7A 5GLCA 2QN6A 1EU1A 4XVCA 4FILA 2XF2A 4I9FA 1LLBA 3RS3A 3W79A 1L0GA 4G89A 3Q3VA 4M46A 4F3NA 1U7OA 1P7PA 2B98A 5JHHB 3RBZA 1X8XA 2HRZA 3Q9UA 5AICA 2PYRA 3DOEA 2GZMA 2Q2NA 1P4JA 1WP9A 2G76A 3N8HA 2XRFA 1LZLA 4JBHA 4YK7A 5EEGA 1J21A 5BUQA 2ZCJA 1KOFA 3TRCA 3CJMA 3HKCA 2JY5A 4PRYA 3VAAA 3IKTA 1MABB 3DOUA 5DZSA 1CUVA 1C30B 1WHCA 3Q9SA 4HB2A 5A3JA 1W79A 3G9XA 2FMIA 2BDEA 3FI0A 3R6LA 1GVNA 1E3UA 3K30A 3LHSA 3OMWA 4NU8X 4O4IA 5JUWA 1NSFA 3TSWA 2VJBA 3KLBA 1XU7A 3LS2A 3HUOA 1L7OA 4NJMB 5IYZF 4DNPA 5ERYA 5C8XA 3LM8A 3FIJA 2VYVA 5DFYA 2WYHA 4QUGA 5HJ2A 1K06A 4IBDA 3F98A 3SPXA 2JP7A 4FVMA 5D00A 4DKXA 3CPTB 1DIGA 2BMEA 1RAFA 2ZWPA 4ER6A 2A24B 3FHLA 1EFTA 1MT3A 3R23A 2RK4A 4KUOA 5HDSA 5EP3A 2KRKA 2ZLYA 1H4TA 2FF7A 4TXJA 1A1VA 3OLOA 5DI3B 1Y9ZA 3PNVA 1QQ5A 3ADPA 3Q7IA 2ZRKA 2BMFA 4JP1A 2JATA 3UEOA 2J3QA 4PZLA 1A4IA 1KIFA 4N4AA 3B60A 1B8NA 4ANRA 3EXHC 4KPFC 4Y2FA 4G1EB 2LB9A 3ZCXA 1BQEA 4M4SA 4CKEA 2Q41A 5KU7A 1GDHA 3O1LA 3WYNA 1GAWA 4WUTA 1E4EB 4P35A 5IBRA 5J2UA 5G0VA 2O5EA 4YQFA 3EK2A 4D9NA 3C3XA 3U1TA 4CM7A 1A0OA 3U3ZA 4I8XA 4JMLA 4ZX4A 3U61B 5A05A 1UIMA 3HBNA 4QXQA 1F7UA 3EXIB 4AKIA 3O4GA 4L28A 3DO2A 2QNJA 5HAIA 1KVRA 3W8KA 521PA 3SIXA 3WSTA 2Q1UA 1TCVA 1R4NB 3LR0A 2P65A 1UXIA 2O6LA 2V7PA 2HCRA 3AJDA 3GT3A 4G0QA 4NBKA 1T2UA 4YGYA 4C0XA 4JLDA 2F17A 2DP4E 3IXGA 2QUHA 3O91A 3I76A 4DDWA 3KQKA 3H42B 3VR5A 3L7JA 2IOFK 4UTZA 4YONB 1PU2A 1BDMA 3TLJA 3L8YA 4QVGA 1PIWA 4UUAA 1YBVA 1KZ9A 2DAIA 5GAJA 3B7UX 1HLUP 2QD2A 1TGUA 3SF0A 4EH1A 3IUPA 3Q2IA 3MF0A 1U0HC 4PHCA 4DE5A 4RMJA 4QJGA 2F9FA 4PPRA 2RG1A 1G71A 1D6JA 3RVRA 1LPAB 1K8YB 2XMRA 3KEFA 4NOKA 4F93B 3W5CA 3OPPA 1B0PA 4W6ZA 1AA9A 2WHXA 5LLTA 1Q7TA 3QTTA 3OD5A 4EBFA 1YLAA 4MLZA 4MWBA 1L5ZA 2VDVE 1G20B 1G98A 3DKIA 3H97A 4V0NA 2P6NA 2Z9BA 3OF5A 5HFAA 1TLPE 4F4IA 3T6PA 1XMQM 1Z5AA 3R8FA 4QU3A 1A8QA 1KZHA 2DRWA 5IF9A 4EESA 1F4LA 3KSZO 2PXXA 2WWFA 3BAFA 3H13A 5KSWB 1OIXA 5ICFA 4PLZA 4DKIA 1WJ7A 2QR2A 1XRRA 2AX3A 1XZGA 4OXRA 4QYIA 2QT0A 1OAKA 3PRYA 1IBRA 1IM8A 4JYPA 3LQQA 4N1HA 1EAMA 1L5HB 4F9FA 4GKBA 5IAEA 4X1KA 3P9RA 2DPHA 1WNTA 2QRZA 3C3EA 4YLGA 5TVOB 3IXQA 3ELDA 4EYOA 4A15A 5C1BA 1V5EA 4JXGA 2IY8A 4GU5A 2JCGA 4GX0A 5TRTA 5HWVA 4MBFA 2ZS7A 4DJ2A 2WUQA 3OLQA 3S6JA 3WIOA 3I3SR 2LHGA 5F7XA 2V7VA 5ES4B 5KVCA 4I50B 1CJFA 4B7FA 2VDBB 1RGYA 1EUQA 1CCWA 1DDOA 3NYIA 4BLVA 1SAYA 2KLIA 4BNDA 1ABEA 2MINB 3FMGA 3Q7SA 3QSGA 4L5AA 5LB2A 4REMA 5B3AA 2PT5A 2WVGA 3FH7A 4ND2A 4DA7A 2H9YA 1JEOA 3VSCA 4DL9A 3KVRA 2RH8A 4Z7NB 4AIIA 1SVOA 1L0FA 1JHUA 2ZUWA 4LYEA 4MHOA 2MINA 1NW6A 3Q7QA 2D3WA 1CP2A 4QOGA 3ZU3A 5AQ9A 3T8YA 2MH8A 3W1WA 3P2KA 4BJ3A 3LMMA 3TB4A 1WR8A 1PJLA 2I78A 3QI2A 3AUYA 1WZ2A 1MEEA 4R3WA 4KIGA 4PZEA 1MZUA 1BS2A 3B8EA 1NUHA 3EZ2A 1QP8A 2GFIA 2H0AA 1QJCA 2HK7A 3DT9A 5EE0A 5JBIA 4N9LA 2KLHA 3Q6NA 2OCXA 4NV1A 4QDZA 5EIAA 4A0HA 4JY7A 3EGCA 5KHLB 1E3QA 5F1KA 3QBVA 5FR2A 1M2HA 5G3ZA 1V16B 2VOEA 4CIDA 2ZETA 1ZU4A 5HAPA 2IUTA 4BRWA 5CA0B 2PN1A 2C0CA 3WYBA 4UU1A 2YMQA 2ZIUB 2NADA 4IBBA 2ZL1A 1EGAA 3CN7A 3ZE6A 3CHWP 1T13A 3OU7A 4M9CA 3B7RL 3B78A 3HV0A 1KOLA 4QG3A 1DAMA 1JTGA 2IYWA 3KB8A 4W8HA 3LY9A 1JKMA 4HSGA 4IV0A 1RXCA 3E27A 4TLAA 3UJ6A 3V1MA 4FYHA 4RADA 3TF5A 1HFJA 3VHXB 5IAOA 4N03A 3TUZC 3FYDA 3RAGA 1SCQA 4UC0A 4YAWA 4EHAA 4ZDKA 3U44A 2PGAA 4OHWA 4AJHA 1LNDE 1U4NA 2DHDA 1CG6A 4BNKA 3P2EA 1OHHD 1H1TA 1DAKA 3BIXA 1NNSA 5B6PA 1D0KA 4C89A 3TFQA 1DCTA 5HRAA 5C52B 4YTEA 1YS1X 4MEAA 4KFCA 4KFTA 4ZYTA 3AF4A 1WJGA 1EJ2A 1NZOA 3BPSA 1RQLA 5T41A 4OU7A 3RTEA 2JAQA 1ODKA 4JBYA 4HYQA 3PC3A 2VKSA 2HBQA 3U16A 3DUWA 5BSGA 1OH6A 3CMZA 4ALNA 4KO3S 1JI3A 2A9OA 3C6ZA 2A92A 4LRUA 5GQSA 5JS2A 5M19A 2P3LA 5B1EA 5CFRA 1EQAA 2B1JA 5JAOA 1CZLA 1L7MA 4MEJA 4OXXA 4BU1A 4FFPA 3TB6A 2BFCB 4B4XA 3V3SA 4NV0A 2B8EA 4TM7A 1DEKA 2F2TA 3UHFA 5ES3A 1ZUD1 2BELA 2OXRA 2WU1A 3C97A 3NH6A 4FZRA 3RFWA 3SHOA 3MZ0A 3VPSA 3UPOA 4BMZA 5JARA 1EXVA 1JU4A 1CBUA 1TJYA 2P1RA 1J25A 5ARCA 1H2XA 3L0DA 1P2GA 2IUUA 4D8UA 2F8MA 3DL0A 3WL7A 2VDNB 4QD3A 2B2XA 3QU9A 1CWUA 2C77A 5T4BA 3TBHA 4AZ0A 1UWLA 1QG6A 2MT9A 3VR2D 2NO4A 5HM8A 2JLYA 4AF6A 3CLUC 3A1EA 4LRYC 2LUOA 4IG4A 1OYOA 4QJ5A 5D84A 4JI8M 4Y0AA 2B4RO 1TW2A 3GECA 1U3CA 2B5OA 2NAFA 2ZYDA 4O5OA 4B3TB 3AU9A 2H1VA 1TH2A 1TDHA 3TXXA 3QNCA 1G38A 4PM4A 1ZMRA 4R8RA 3GN2A 3VNBA 4AXBA 4QDKA 4ENSA 2EGUA 3FYHA 3NM4A 1UAAA 3FAZA 4ZZ1A 1NNLA 3OQNA 1E3DA 4KZ7A 2A24A 1E1YA 2WD7B 4K9DA 1AS3A 3HDQA 4NOOB 3AHDA 2B18A 3AZPA 3KAKA 3M5PA 3PA6A 2K5UA 3IQHX 3FPSA 3CJTA 4LHVA 3DBRB 5HBRA 3DLHA 2XYVA 1L6IA 2YY5A 3DWZA 4GECA 3H9CA 1ZRMA 1C8BA 4JT2A 5LQNA 4JI7B 3MXQA 2FWJA 4FJ0A 5D6NA 1SC1A 5AYVA 2UWXA 5BV2P 2JKFA 1OQYA 2DFTA 2JAXA 4CGYB 2PUTA 2QR3A 1IVNA 3FPBA 2Q1SA 5EIBC 3WLKX 2Y1FA 2C5RA 1K6RA 5E26A 4FWGA 1PNTA 1NUQA 2DCFA 1RCFA 3R9XB 1O5IA 4LF9B 4QYXA 1IYOA 1U2ZA 2IZ6A 4UHKA 4BBTA 1QZEA 3PEEA 3N3BC 2Q1XA 2ZEJA 1HG0A 3LRPA 1ZW1A 3NUZA 4O2BA 4P80A 2YYAA 2IK8A 1Y1LA 2C04A 1N6RA 1A5ZA 2C99A 2PT9A 3K5PA 4RZQA 5I01A 4N3GA 2OQVA 4F3LB 3U44B 3EC1A 3RKSA 4X3CA 2B5VA 1W46A 2JG3A 1EG2A 1DKNA 4IINA 3KQQA 2ZI6A 3ZHZA 2FSHA 1PZHA 1XBTA 1PDWA 4DSUA 1CI8A 3FRHA 2FOIA 4WADA 4UM7A 3TL3A 2H59A 1F98A 5KNDD 5DHTA 2IHJA 5EP4A 3WGKA 3PXXA 2V7EA 4AO8A 4C6SA 3VP3A 4MEZA 1SVKA 5BR8M 2OR3A 4R1UA 2GSDA 3BIOA 2MSCB 3N2KB 5T3UA 1Z26A 2XCQA 3DZ2B 5L09A 1QGED 3IKVA 3H9UA 1XE3A 4CG0A 1T0IA 3ADKA 4EHKA 2X76A 2ECQA 2PEYA 3C1OA 4YS6A 1C3VA 1NVDA 1XB2B 3GLQA 1VL0A 4X7PA 1V3QE 2XE6A 3NGLA 5LSAA 4XBOA 2PX6A 4AKEA 3A6PC 3HHYA 3TXYA 3GR2A 1Y3DE 4YASA 3LZCA 5ERXA 4B3IA 3A3PA 3THYB 4MS6A 1LQTA 1IUNA 1TT7A 1DGFA 2AN4A 2NZ8A 2VRBA 4JKYA 2J6IA 3KZCA 3Q6IA 1W7AA 5EPHA 3RNLA 3HJRA 4ADSG 5KYTA 1H9BA 1A71A 4GJ4A 2GF2A 3A42A 3FV4A 3EA4A 4MO9A 4E5VA 4MWCA 4DXDA 3U4MA 2QYTA 1W52X 3NDPA 1NQOA 1AF4A 2DPLA 3QGOA 4M98A 1ZJWA 4P4LA 1N5KA 4U0KA 4UUMA 4JI6B 1QTIA 5KOHB 2ZBGA 3ESQA 3EDCA 1DIAA 3ANSA 4QB8A 1T1EA 1U65A 3Q4GA 4XWAA 3VR2A 4EI7A 4PVDA 3VKVA 3NPMA 3V8BA 4EPXA 5KPJA 3WLJA 1BXGB 3K3DA 3D3JA 3AR9A 4BJPA 3K1TA 2YV5A 1UR5A 1L3LA 2XADA 1ZL2A 3IVAA 4JLNA 4FSFA 3QEBZ 3O9MA 3HGTA 2P6UA 4ZOEA 2C29D 4G63A 4PPGA 3B70A 5CU5A 1VMIA 2B1RA 3ZXUB 3FVRA 1V25A 3GMDA 4MB0A 3NOUC 1JZSA 1BN6A 2R4QA 3BMCB 5AHXA 1PGJA 2BT4A 3DXXA 2IL1A 1CUXA 3DZIA 5IREB 3C3AA 3P0IA 1NG1A 3DTVB 3IH8A 3ZG5A 1KBZA 1RZRD 4P0PB 1I5OA 3PBQA 3U80A 1LNBE 4RHEA 2A2ZA 3PX2A 5FEMA 4EGJA 5DPEE 3LGSA 5LKAA 4DB4A 1JTDA 4GZ5A 3MRXA 4RZHA 3P7TE 4XNAA 3D0OA 1GZHB 1JAIA 1QNLA 2JLAA 4NOMA 1B6SA 3KQLA 1VXRA 3LSTA 9MHTA 1TA0A 5D51S 2Q9AA 3OPYI 1RWXA 3B38A 3OCLA 2ZWAA 2VK4A 3GRZA 3HKBB 4LIPD 3V39A 1YI1A 3BRQA 3EASA 4PFJA 3DPSA 4PR0A 2VDOB 1BS1A 1DMSA 5JBQA 1KK3A 2UXBM 1ISGA 2P6PA 4QNNA 4RGQA 3FWPA 3FXAA 3MB5A 4UU7A 3F73A 2G2WA 1TM4E 3DE0X 4HPXB 4DYDA 1Z6PA 3VDPA 3E2LA 3M81A 1T1AA 5JYEA 4FFMA 3FKSD 4X7RA 3B20A 3WGLA 2WF8A 3K9WA 4RPHA 1C3LA 4LRQA 4XGIA 2P1DA 1IRIA 4TV8A 4ZCQA 3T9DA 3TGWA 1G6AA 1ZHHA 3LX5A 1OD6A 4W5TA 1Z2NX 1NNJA 3ITAA 1E1QA 1G21A 1W44A 4NSNA 5J4KA 5M2QA 4XN2A 1IMOA 7YASA 4CV2A 4FUWA 3OQMA 4TX1A 3LKZA 4KX5A 3PR6A 3KVVA 5IAKA 2VAVA 1RFGE 1A9XB 4LXYA 5ECGC 3GFGA 4XQGA 2FJ0A 3TI9A 2V2FF 5EVLA 1GZDA 5IJ0A 2EFYA 3AF1A 4N76A 3PTLA 1EWKA 3AUTA 4BYMA 4IEDA 5SZIA 4WVFA 1A3CA 3VJLA 2R5WA 4NBRA 5AJUA 3MRTA 4C7BA 5AI0A 3JRXA 5COAA 1VLHA 4HGQA 2I4IA 4DLWA 1XO1A 1MO2A 2AX4A 2XDWA 2QPTA 2CBGA 1SHKA 3NQZB 2XD9A 2XTAA 2ZSKA 3EGIA 4QEKA 3KD2A 1UAYA 5CCXA 2UYGA 1J2EA 3USZA 1EVIA 4X20A 5E38A 5BSRA 4EAAA 4W5JA 3FB4A 4CF3A 5HF5A 4X8OA 4Z6KA 2FZ0A 3ES9A 1RC0A 3CR8A 4Q15A 2AYXA 4Z0PA 4TLNA 1TS7A 5KQSA 1ES3A 3AILA 5KYUB 2QN1A 3IJRA 5CVTA 7AT1A 3E8MA 1RR6A 2Q2QA 1D0SA 1NRXA 3NIDB 1RAEA 3IWDB 1QO7A 3ANNA 1Z4QA 1D5CA 1K4KA 2WTUA 4RORA 2UYCA 2J5XA 2RGCA 4RACA 2JA2A 2AA3A 3S7OA 4UHHA 3U81A 4BCDA 4DV6B 4B6QA 1D2CA 3GRFA 3VNRA 1X7ZB 2NVWA 2XB4A 4E7PA 4LFUA 3VKFA 1SY7A 3RGSA 4B4ZA 4CLOA 2W6IA 2OCLA 5FAOA 1UJ2A 3RSFA 1FRQA 1FYDA 1JVNA 1KK0A 2C92A 2R86A 4LHZA 3R74A 4A6EA 2YJTD 4BMNA 4IIJB 1TS0A 1M74A 1XNRM 4KN8A 5K01A 1XC7A 2H63A 2H8GA 4MK4A 1QKIA 2DRIA 4HRYA 1LRKA 1TAGA 4MJXA 4WDQA 1GL7A 5AI5A 1OZFA 1ACLA 1QQ7A 5LXTB 4EA6A 5CHYA 2PUBA 1Z18A 1LL5A 4LNUA 3O8OA 2VF8A 1KIMA 3IX7A 1RZRA 2W6MA 5HQJA 1RYEA 3WXMA 4I08A 4TYPA 3ELBA 4GAEA 3FX2A 4KGZA 3PLAE 2ZG6A 4BPRA 4GLLA 3ZFZA 4ACBA 1KPGA 5GZ6A 3TQFA 1HKUA 2ARKA 4FWTA 5DLPA 2G08A 1ABBA 3H17A 5L3SB 2WGIA 4Q4LA 4CQHA 1FMJA 4LZZA 1W35A 4PLGA 4L5IA 1B6GA 2HUPA 5ILQA 2AZMA 3EZGA 2HIMA 1TT5A 2B7CA 2C4TA 5ECWA 5E1OA 1G3MA 5JJCA 1U7XA 1NUUA 3TE8A 5BNWA 2IZ7A 4UQIM 2IYYA 4MGIE 2FPPB 1UL1X 2PK3A 4M9QA 4H17A 5CHEA 5SYMA 1Y6GA 4HEA1 1ZR4A 5ITUA 5IDXA 2WUVA 5IKEA 1GZ3A 4RHYA 3RSHA 1GAQA 1P5HA 2R60A 4P92A 5CB4B 1JR4A 5ERGB 1WMBA 2VUSA 3A0RA 4IQGA 1HDIA 4QY6A 1TC1A 2Y1EA 3IP3A 1X86B 3AKYA 2AQ8A 3H8JA 1BMFD 5EY5B 2CLLB 2VJNA 4U1RA 4ARSA 4WBGA 1EWYA 4XYLA 3UUEA 4LJ5A 3B74A 4DJ3A 1EE9A 1Y9DA 2ZI7A 3QOYA 2VQXA 4KGDA 4COKA 3UYLA 3W5AA 3DBKA 5BSTA 3U7QA 4PSDA 4CLCE 4PPFA 2PLWA 3CIFA 1F2DA 3ANXA 3UCFA 3NHMA 4A91A 3AHIA 4F84A 1DKMA 5BV8A 4V3CA 2AG1A 4WKCA 1PWDA 3PGVA 2BEUA 4F46A 4TTTS 1Q11A 4S3MA 4YRNA 4KITB 1LS6A 2XF8A 2JLBA 3LHKA 1YM1A 1ODSA 4NOJA 3DZ4B 2J9FA 3S2ZA 3VO9A 3N2KA 3SH7A 4BBVA 3FETA 4WEKA 2BZGA 3QVUA 4K6HA 5DIFA 3ORSA 5KI6A 2IPAB 4QBIA 4F91B 1N5IA 4X62M 5HS6A 4D91A 5EXXA 3I4FA 1PN3A 1ES9A 1VM1A 3JYLA 5JBNA 3I6YA 3NBAA 4P22A 4BD0A 1NSYA 2OO5A 4FYYA 4XJSA 5C1IA 3RFVA 4ZI7A 1PF7E 1JEYB 4MVYA 1QG4A 5CVUA 2R1VA 4KT0F 2ZT7A 3ENWA 3ZJUA 1KHHA 1JVJA 1FQJA 1BH2A 4PW0A 1GTSA 4LWPA 5JHGB 4XEHA 1PX2A 5KNDA 1N2IA 2FZVA 2EW8A 2M9MA 4PRLA 2FFJA 1C7EA 2DSTA 2JIDA 4I55F 4ZEMA 2M1XA 1YBHA 4XPZA 1P18A 1PSDA 1L2BA 1RSZA 2MR5A 3F2IA 4HDNB 3EUWA 4KI0A 4MUEA 4OB7A 1XVLA 3V6LA 3NHYA 2O8EA 2R7MA 3EAGA 5ALGA 3A11A 2ZM0A 1TTEA 1L5OA 4RMNA 4MUNA 3RRYA 4C2TA 2CW5A 2IYPA 2COKA 3KVYA 4L3VA 3ZDJA 4TZTA 1OIWA 2L7HA 1D8AA 1V4NA 2PZEA 3SJUA 2M7UA 4HNTA 2IF2A 4OFBA 1USIA 3NRJA 1M1NA 4L75A 2P9ZA 3S2EA 5EHNA 4NKRA 2PJDA 2AMLA 2AI2A 1PZOA 1TJ3A 2CUNA 3MJ4A 3OEWA 5IYZB 2H1OA 3EY4A 2WUGA 3K2BA 2EXAA 4LK3A 3GJ4A 5C5IA 2WZXA 4POAA 1DRWA 2FWIA 3MT9A 5A4MS 5K1VA 5AK0A 1VYHA 2PT7A 2AG5A 2OSVA 2QIPA 3B7PA 5FUWA 5HFNA 3DNZA 1K9VF 2O1SA 4F60A 2F5SA 1YQ9A 2BZ1A 4IX1A 4AUKA 4JI2M 2FSFA 2JFUA 2IT1A 3OZSA 3T4LA 2HNKA 3KEDA 1YCDA 1P44A 4PFQA 4TWJA 1E0AA 4Y6LA 2UDPA 3HJCA 2XXAA 4Q01A 1QF6A 1ZKJA 2WHEA 3DE1X 1GV0A 5ED0A 1WB4A 3WRYC 3D8HA 2PR7A 4B3HA 2KXEA 1B73A 1UJ6A 2QAIA 1PWCA 4N9KA 3G0DA 3ODGA 2HC9A 4HGYA 3UMDA 1T6BY 3HR7A 2IGBA 2FS1A 3GB9A 3SKVA 2O8CB 2RIRA 1K8XB 3UB3A 1Z36A 3DFZA 3ML1A 4QUOA 1NWCA 1S4RA 2VHCA 4G0OA 4KQ6A 2QX4A 1W5TA 3OWOA 4LRYA 3DEKA 4RHFA 5E4JA 4MX8A 4WCVA 5EZYA 2A7QA 2D5IA 5I94A 4FKBA 1RXVA 3MELA 2LD4A 1FXUA 1MQSA 1RP7A 2YOFA 3I2GA 4J7UA 4R1LA 3W67A 4CQMB 1XHBA 5CVVA 2CWBA 4EJSB 2H2GA 5B7QA 4OP8A 3TIVA 5AESA 1WMSA 4N12A 3PSAA 3LX8A 4KKXB 4PRZA 2RKOA 5K0ZA 5KSZA 1BMDA 1I14A 1YLZA 2CDRA 1X0VA 3QNUA 4L0CA 4Z86A 4BB0A 2HDRA 1I13A 4N65A 3L4JA 4E70A 5ITTA 1P4SA 1CUSA 1HYHA 1R66A 3ZWKA 4AYWA 3MCAA 3R3SA 1GNLA 3ZG8B 3E70C 4FJ1A 4PHHA 4R1TA 4R9UC 4UQIS 4DKJA 2YBDA 1WB9A 3C4OA 2YVUA 2ZBPA 2CC1A 4UVIA 1CULC 3IMEA 2PCLA 1UPTA 1WA9A 3FU3A 2IX9A 3IWCB 2RI1A 4KOAA 1MIOB 1QHXA 3TIIA 4YRKA 2OHHA 4PVBA 1T9AA 3FU6A 2PH1A 2QUKA 3IDAA 3OLCX 4P3NA 4WH0A 1EKXA 4RH0A 2DUNA 5D3MB 4ZAMA 4KZ3A 1TX4B 3L3BA 2EG5A 4XSVA 4GICA 3WRXA 4LXUA 1DJQA 2VPIA 1ZS9A 4OH0A 2VRCA 3UB5P 1A5TA 2ZYVX 3F5QA 3FYTA 1SOAA 4TT3D 4XCQA 3K72B 5CX1A 1S89A 1RKVA 4UA7A 2A3NA 2X9QA 4R3DA 4GUAA 4HN9A 4J2HA 4XWTA 5AKKA 2HU7A 4QSHA 1PGOA 5F9MA 1UANA 4IRUB 3NN7A 4XN1A 2VZWA 2WEKA 3QHPA 1IQUA 3B6ZA 3T1QB 1CJTC 1W30A 1KRHA 1EBFA 1XEWX 5H5JA 1ZDPE 2IYUA 2OY0A 2H1HA 2X42A 1KK1A 2Y92A 3Q43A 4QX6A 2WF9A 3HFGA 3X2FA 4EBNA 1M72A 2FCAA 2NO0A 5KYWB 2BI7A 3BBPA 3EEFA 4FW9A 2XECA 5TX7A 5JS6A 3AYZB 4HWSA 1NYQA 1IYQA 5EP1A 1M2GA 1M7HA 1THMA 1U9IC 1XTQA 2IVZA 2W83A 3GH3A 3N53A 4XB2A 3NWOA 4NESA 4XUDA 1NN1A 4IILA 2FPGB 1E8MA 1XCGB 1BRMA 4WMCA 1DLJA 1EM8B 3WWXA 1QLJA 4AN1A 5DNVA 3UPUA 2NU6A 3RIXA 3H2HA 3WAGA 1V26A 1XCMA 5EQFA 3DO1A 4CM4A 2YWCA 5FKJA 2RGXA 3BRCA 1SRRA 4LEIA 3L49A 4CG1A 3ZJVA 5LA6F 3IECA 1F06A 1K55A 2C4NA 3KB6A 3HQ4O 1F3LA 3HBRA 3HSYA 3II6X 3KEMA 4IVRA 1RTTA 2JAOA 3QF7A 5HGJA 1RBMA 1R5NA 3DTNA 3MJ5A 2A1UA 2QA5A 2GD1O 3MJSA 5D6OA 3T7SA 4CTOA 1S8NA 1U0LA 2BC9A 1X8KA 4LFBM 1JZQA 2PBZA 4HGRA 5FV4A 2JEOA 4RYEA 5LNK1 5LYYA 4P38A 3T54A 3LC0A 2ACWA 5JSYA 2R8PA 3RSCA 2BKEA 4GPTA 2OB2A 2WJPA 3SC6A 2Z43A 4LHEA 4EATA 1L5QA 5HW3A 4DY4A 3IPRA 3Q7TA 2CN1A 3LGAA 3BJZA 5CX4A 1N8TA 4WZ5A 2GN2A 3GEHA 3MCTA 1W8QA 1NJSA 4OMUA 5U9CA 1SKYB 4ZYWA 1A2QA 3O7MA 1XN4A 3S3TA 5EIXA 3BB4A 1DRJA 1W8YA 3I30X 3OLYA 4DMLA 3AGFA 5K8UA 3LL4A 2YFYA 3B48A 4BHTA 2OHJA 4DMMA 1WYBA 2AC2A 2AG6A 5ALVA 2R4JA 2X8AA 1CF0A 1PTJA 1YOBA 2AFRA 4OW0A 4PIMA 3R8XA 1FNCA 1BNCA 4EUEA 4LTMA 1X13A 3GY0A 1YQTA 3N7TA 5DHRA 5C8VA 4OMFG 4ENWA 3TTVA 1VSBA 5CB6A 3H16A 2CXQA 1XVVA 2GXQA 3IAS6 4IBGA 3JYNA 3MJCA 4GW3A 4AZ3B 2BHNA 5JXHA 2WHRA 3CUEF 3F7MA 1YKDA 2JCYA 1GQYA 3HZJA 3H2GA 3S5JA 1DKOA 2ISCA 5EA2A 5JMWA 3ZU4A 1D6NA 4DDKA 3S1YA 4MTLA 4QUKA 5HCUA 3TRIA 3GLIB 5U47A 3TKAA 2WVAA 1TJPB 3ETHA 4N7MA 1YBAA 1XZLA 2Y0PA 4N0EA 1MTOA 5JOQA 2D74A 3GGOA 5CDSA 4KE6A 3L79A 5TNXA 5FSPA 3CQ9A 4ZYYA 1Y6RA 5F9FA 5J1SB 4UAJA 2G9QA 2R1TB 4WV3A 5IUKC 4Z4HA 2YMPA 3HP1A 5AJGA 3KQPA 5KQGA 2VHYA 2ODTX 3HJNA 4GGOA 3TPFA 4EL0A 5BW5A 2XI4A 1YAXA 2FFHA 4B84A 1NMZA 1KI8A 4S0XA 1I24A 3D4OA 4BMOB 4GM0A 3ZQ6A 4BP1A 4REQB 1EFVB 7TLIA 1X1RA 3E7XA 5A7FA 2O4UX 2JFQA 4ZU3A 1ZMOA 2FUG1 5EOEA 2FE1A 5DYGA 2YZMA 3FLFA 3W4PA 3EEBA 1NX6A 1XDZA 3NTOA 2V1XA 1UXKA 5C46F 3PXUA 5H0IA 2Q7XA 2V96A 2ZIWB 1PX0A 3HSSA 1Y7LA 1V95A 3PUYA 4EJSC 4R0MA 2JN7A 1H4VB 1JI0A 2V0CA 2RHDA 4IZIA 4JX9A 3O0DA 4RKFA 4ZT7A 3TQHA 4ALJA 4NZ9A 2ZYAA 1OYYA 3EQZA 3U5ZB 1KJIA 1WVMA 3GEEA 4IRXA 5E8RA 1OIZA 4W7HA 5IZCC 4HLNA 5A6VA 4GL4A 4HQ6A 4JA2A 4TVSA 4RJKA 4BKUA 1G0OA 2ZE8A 4TKZA 1C80A 3CX6A 4QPNA 4RO0A 3EIUA 5B7PA 3NDJA 2ZPUA 4JR1A 4R05A 1JA1A 3T41A 3I2HA 2FMFA 2QPNA 3DZDA 2GF9A 2IJGX 3HYCA 1JMKC 1PV4A 5F7ZA 4LV1A 1E59A 3C45A 3TRFA 4IDPA 2MWMA 2BKVA 3WQSB 1NJ5A 2EF1A 3EG9B 5ALNA 4EITA 4HH3C 5HAQA 2GI4A 5JD5A 3F1PB 3PQ5A 3TK1A 4OP5A 3E18A 3EH1A 3H0CA 3VRHA 1ZPDA 2B7BA 4D9CA 1WXFA 3O82A 4UXJA 1N33M 4MQFB 3C6KA 5JPIA 1SDNA 3QMWA 3T8VA 2AFIE 4ZTBA 1X8LA 3FPGA 4RA9A 4LSZA 3ZE9A 1G41A 4PVCA 2LR0A 4ANFA 1SXPA 2P2SA 3PKZA 4KNWA 2PUDA 4RF2A 2IEIA 3EXFA 1UBSB 3HKEB 4D4HA 4DJAA 1T5DX 1GN9A 1Z68A 1W75A 3QY9A 3KELA 1UEJA 3O4FA 4OHBA 1LBIA 5DYNA 2X0NA 4AR8A 3EZXA 4JXXA 4PSKA 1XLWA 4Q7KA 4A2QA 3ZXXA 2GPSA 3BORA 2PUAA 4EDHA 4H8RA 4HGNA 3JZIA 4WASA 1XQYA 4GM4A 1KKKA 1JSLA 2GXUA 5I9MA 4MUFA 2GCEA 2ORIA 3MBZA 1JXOA 2CWDA 2XZLA 2HHHB 3UHAA 5B58C 5HZHA 1P1HA 3V5MA 3BLMA 1KMMA 1BX1A 3NBIA 3VP0A 2EKZA 5EVIC 1KS9A 3WL8A 3U0VA 2MCFA 5KTKA 4OHXA 5K0EA 5CEBA 1EDBA 4UU8A 1X39A 1R37A 1YLPA 2O3UA 3G0OA 2BF7A 4EKYA 3R24A 4I3FA 4I1UA 3BFPA 1OHHA 4Z3KA 1L3BA 1TDJA 3KJQA 4EG3A 5GL9A 4BLCA 1OT3A 3T1TA 4TYWA 2IPLA 4S12A 3IILA 2H1IA 3IUNA 3OUZA 1NLYA 3VR5H 3V32A 3TWKA 1FLVA 1GQSA 1NPYA 2OL4A 2PL1A 4QTXA 1FJQA 3M9WA 3DMFA 8MHTA 1O97D 1EXNA 1KBOA 1JGTA 4BC1A 4RZXA 2HHCA 2PUGA 2ADFA 1IIRA 4PO8A 5FPTA 1QFMA 4YRSA 1BT5A 1BSVA 1P3DA 2Y8EA 2Y21A 1FUYB 1UZNA 3V8QA 1UMDB 2JJ1D 2Y77A 3UKOA 1OVGA 3E98A 2AIRA 3PXDA 4OIMA 5BSWA 4AR1A 1URPA 2HPHA 2YV2A 2V4ZA 5F1GA 3IMFA 3COPA 4MCHA 3RGGA 1PNOA 5A4DA 2V0GA 5A03A 1ML4A 1PR5A 2X19A 3MN1A 2IY9A 1YT4A 3C74A 5COQA 4UQLA 4Y2YA 2GM3A 1WUIS 1Q19A 4OHVA 3HU3A 3AFOA 3ICOA 4NJEB 3MAJA 4UTNA 1BEZA 4ZVRA 3T5DA 4PHTA 1GTJ1 2RH5A 3L9XA 4EBLA 1KI7A 4X1IB 4GDNA 3OX2A 4LYJA 3AEKA 4ZVOA 4JR2A 3QP4A 4U6QA 3K1YA 5G02A 2PRYA 1YVPA 2P7JA 2OAP1 2GYVA 3GP8A 3LXUX 5I7WA 5JPDA 4DSNA 1W4CA 3HB1A 1E7QA 3FSEA 4G4NA 3EPAB 3R6GA 5F2NA 1YWGO 5FNVF 3ET4A 3PNKA 5G4LA 1WIWA 1I7NA 2AWOA 2DBYA 5LP6C 4YT8A 2PBRA 2R45A 1RBQA 4EG1A 3O8CA 1HNZM 2CFIA 3WMEA 1YVDA 4YYZA 1EFDN 3T94A 1P60A 3CITA 2R9VA 3JPYA 3CUKA 4ARIA 5GP1A 1IWBB 4J0FA 5LBUA 4PMAA 2Q50A 4KXVA 4KVZA 3WGOA 5DFLA 4GOKA 3FCXA 4Q24A 1XPJA 1AQNA 3KS9A 1DXYA 1L1FA 5HQDA 5CNKA 3N2IA 1PYOA 2GEJA 4PZUA 1OPRA 2J6BA 1PFQA 2LWXA 3M2KA 1MU0A 4K9LA 4OFZA 4RL4A 3UOWA 3HUTA 1FILA 3TG9A 7ADHA 3MTDA 3I12A 4YUXA 3I51A 4ZQTA 4LJSA 2C78A 1IQPA 1VKHA 4YY3M 13PKA 2HPVA 2WJIA 4Q93A 2D7DA 4QEZA 3KZVA 5EZ6B 4BNNA 3QE9Y 4WM9A 2F3PA 4CMIB 1FX0A 1UIRA 3EDRA 4WFJA 1N8SA 2PWPA 2OB1A 2TECE 1VCOA 2QRHA 2VNHA 2DT5A 1HA3A 4MLCA 5J9FA 4KZ8A 3JQ7A 3UATA 3WK4A 1FTQA 2VYNA 2AUMA 2PWAA 1FRFS 1VKRA 1W5BA 3JYPA 2O7SA 3OQVA 1PS9A 5EP2A 2A9KA 1JXMA 2OVBA 4Q1CA 5GVSA 1N2ZA 1W96A 4BENA 2Q46A 4M0EA 5B3LA 1IK4A 2HV1A 2WU8A 3CS3A 3JQ6A 3PP8A 3ZH9B 4OQPA 4D3ZA 2C95A 4EQ1A 1WHTA 1ZA2A 2H2WA 3OZBA 2QHOB 2HFKA 4FBLA 4M2LA 1C9EA 1PM5A 1U1FA 4GS5A 4KE9A 2GGSA 3IP5A 4P32A 4QUEA 2Q5QA 5JSUA 4JVLA 1T8UA 1C1DA 1DB3A 4GIPA 2ZR8A 3WLPA 2X3YA 4BKPA 2PL9A 1ADGA 4KQRA 1P9RA 1AUPA 3ITDA 4AMBA 3UG7A 1E2UA 1E5XA 4ZW5A 2CHGA 2PYIA 2XWPA 3K2IA 3LMKA 4XAQA 1FIUA 1AV6A 2IH2A 3RFUA 1E1NA 3JQGB 3KFUG 4EM6A 1HFWA 2LNDA 4WFKA 1RPJA 4H1VA 4DCMA 3JWIA 1HGXA 1MNQA 1K7EB 2BHRA 1K5PA 2PRIA 5CMLA 2EUCA 4S35A 3RJMA 4E6EA 5AKZA 4TUWA 5FA5A 4LZNA 2EL7A 4E22A 5J23A 4MV1A 1YA8A 2YWFA 4YMSA 1E9DA 4CKBB 2PD3A 2H4ZA 2DMWA 2Z57A 1KFKB 1OTXA 4IYRA 3WNBA 3NGMA 4DM3A 1QV6A 3FNFA 3P2MA 4FYVA 3S44A 1OXSC 3FXPA 2QDKA 2ZE6A 4E5NA 4Y0UA 1QVAA 4RCZA 4C0LA 4IIYA 3B9PA 1DC5A 5MN4A 2JBFA