4II7A

Archaellum assembly atpase flai
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
512
structure length
504
Chain Sequence
SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGEIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords FlaI ATPase
publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 156
structure length 504
sequence length 512
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ii7A05
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ii7A02
3.30.360.100 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ii7A01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ii7A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ii7A04
2MSCB 1MABA 4BFTA 3HU3A 2HT6A 2BV3A 1OPXA 1US8B 1OB2A 1WA5A 2P6UA 2O8DA 1GKUB 4PR0A 2RGGA 4QGAA 4V03A 2RGNA 2WJHA 2V7QA 4X8OA 4UQOA 2D74A 1XNJA 3FFAA 3OE7A 521PA 1EX6A 4FMDB 4TL7A 5FBVB 3ZDQA 1E4YA 3CKLA 4C0JA 5FTKA 1FFHA 1E1RD 2UZ3A 4M53A 5KDOA 2IF0A 4CW7A 4H9GA 4PANA 4Q18A 1XB2A 1E2JA 3NH6A 5HTKA 2V55B 2PLRA 4LJ5A 4UNSA 1E0JA 2ZROA 3EWSA 2EFDB 3P20A 1EG7A 5TV2A 3R9WA 3QF4A 2VH5R 1XD2A 3OEHA 4KODA 2WWWA 5JEEA 3ZS9A 4MYHA 1U8AA 1Q3TA 1XEXB 2BMEA 1ZUNB 1GOTA 2WAXA 2IX3A 2HCBA 1ZVQA 2QGZA 3OAAD 3TAHA 3RC8A 1ZCAA 2NO0A 4M22A 2OBMA 4BRWA 3BBPA 2BCGY 3SNHA 5E3HA 1HQYE 3AP1A 2Y8EA 3VHXA 4WXRA 1A82A 3ZIAD 2Z83A 1JAHA 4QJ4A 3AVWA 2G0TA 1W4CA 1Z0KA 3KKNA 1US8A 4LJ8A 3DVLA 1TUIA 2OAP1 1W47A 4D4JA 1XWIA 3F3YA 2GZDA 1SVIA 2HF9A 5BN3A 1E2MA 3PITA 2G1KA 2F43B 3L82B 2VPPA 4TMVA 1AM4D 1X3SA 2D3WA 4QNRA 1M2OB 4D26A 2QTFA 1IJFA 3ZJYA 4HAZA 1VIYA 2R9VA 3KJIA 4NH0A 1WBDA 4LHVA 2GXAA 5FTMA 1Q3HA 1ZAKA 4OI2A 4RZUA 3WMGA 4OI0A 4G5QA 4PSAA 1Z0AA 2ZR7A 3KKPA 2IXFA 2BMDA 5EP3A 1JAIA 2Q3FA 2QP3A 3DL0A 4A0HA 2V6JA 3K9NA 4LRWA 2ZRLA 4C7OA 3ADDA 1GNPA 2BIFA 2IC5A 4IJMA 1G21E 3GMTA 5B64A 3PUYA 5LDDC 2OBNA 2D06A 1FMLA 1G18A 4P3YA 3MJRA 5KDLA 1RC8A 1II8A 3W9YA 4Z8YA 1CTQA 1CJKC 1VMAA 5IF9A 3GLHA 2JCSA 2A30A 2QRZA 1ONBA 5DSZA 2VP4A 1VG8A 4A6PA 2O8EA 3K0AB 4XH9B 1HE1C 4L5BA 4MRRA 2WAYA 1KO8A 3UANA 3MMPA 3F8TA 3B1VA 3BK7A 3FMIA 1A2BA 3MGCA 1N6OA 1QRAA 2P65A 5FTJA 5D3QA 3QJYA 4NMMA 2PBRA 1DG3A 4HI0E 1AKEA 1D6JA 1R7RA 4AG5A 4E09A 1YVDA 3IHLA 1W4RA 1CS4C 4FWTA 2GJ8A 2JIZA 1G20E 4KAXA 4HLUA 1PLKA 1ZD8A 1OB5A 1KAOA 3SI7A 3TR0A 2ZETA 3I8SA 3FB4A 3BB1A 4MGYR 3TR5A 3LDAA 4AKIA 3SFVA 2G77B 3QXCA 3KJGA 2YWEA 5CK5A 1OH8A 1X8JA 2FU5C 1XTIA 2QMHA 4UJ5A 4DLSA 3KQHA 1QZXA 3Q8XB 2GTPA 1OXVA 2XITA 2ZQ5A 4C0AC 1QHXA 4RCZA 3C41J 1NIJA 4EAQA 4BGDA 1QHNA 3NTUA 2VHQA 4ZDWA 3RYTC 4MUBA 3B13B 3GQBA 5CITA 4TZ0A 4KI0A 4F38A 3OEEA 1ZNYA 2N42A 3TW4A 1YZGA 1YZUA 4PQFA 2AFHE 4RD2A 1EWQA 4UXIA 3NIBA 1NVVQ 4TMTA 4ERNA 3GJ8A 4LPKA 4B32A 4D81A 1J7KA 2RGAA 1OXXK 3SHFA 3MWLA 5HPYB 2AKYA 2ZS9A 2RGDA 2CLSA 1IM2A 1QBKC 1NI3A 1RKBA 2OEPA 2VP5A 3EIEA 2AD1A 1KDRA 3HPQA 2GJAA 5BQ5A 1Q57A 1XXHB 2QT0A 2DWQA 4BLRA 3WP1B 3DOEA 3RLFA 4DLVA 1YZLA 3UG7A 1GDDA 4Q7MB 1W0KA 1YE8A 1GWNA 3L0SA 1KJYA 3R7WB 5KDDA 5EXSA 2VSFA 4DSTA 3GEIA 1KKMA 2ERYA 2IHBA 3RC3A 3QVVA 1N5LA 2ZRAA 4N0DA 1GRQA 5FPSA 1C4OA 2PL3A 1KI2A 3BB3A 1XD8A 3EIQA 3D31A 3Q5DA 1G3UA 1G4UR 4LOAA 1KI6B 2ZRPA 3T35A 3AF3A 4XVUA 2IYLD 2O8BB 4QBFA 1KK0A 1KNXA 1JR3E 1NKTA 1E94E 1CJUC 1XJQA 2GVZC 4XVQA 5G40A 3BFKA 5TMPA 3WNCA 3N2IA 2FX3A 4NYMQ 1NLZA 4BECA 3TVDA 3VR3A 1NN3A 2VP6A 1VG0B 1RZ3A 3J81k 3KQNA 4JZKA 4TQUS 2P67A 4KV9A 3EC2A 5CM8B 1JR3D 2AWNA 5JS8A 2WOOA 4IHQA 1JBKA 3TIFA 3U2QA 1EESA 4UKDA 3ZQJA 4HAWA 4B76A 1PZNA 2C78A 2F3RA 2ZRJA 1P2SA 2GXSA 2F1JA 4GBMA 5DIFA 1OXUA 3VR2A 4C0HA 2FFQA 1ESMA 1QHIA 2DR3A 4TSFA 1AS2A 2IS4A 3B8HA 2RB4A 4M9ZA 3W5JA 2XTNA 3SBEA 1T0JB 1VCIA 2KSQA 1RRGA 3TSZA 2GXQA 2HYDA 4YMWA 2C9OA 5J4VA 4A8JC 1VKJA 4EPXA 3ICEA 3GJ5A 3I5YA 5EP2A 3W6PA 1H65A 1IHUA 5FR1A 1QG4A 2GRJA 2LKDA 2FPMA 4IDOA 3ZS8A 2ZANA 4WZAE 3HYTA 1SULA 4GNKA 3ZD6A 2RHDA 1R2QA 4MYCA 1SVLA 1Z8FA 3RS2A 2ZU0C 2O8BA 3KB2A 4MKHA 2QBYA 4QM7A 3SOPA 3PQCA 1JNYA 1CJTC 2ZE8A 2CNWA 1HQCA 4W5WA 1GUAA 2JDID 2QAGB 1SVSA 3AF1A 1HA3A 2ZRIA 2ZJAA 1TU3A 4EJSC 5IHPA 5JWOA 5FL3A 3B82A 3T34A 5B30A 4BFXA 1A4RA 1E98A 1JJVA 4MYTA 1TAGA 4QHSA 4Z8XA 1PV4A 1UEJA 4O0MA 1TUEA 1TF2A 2FFHA 4WXPA 1GKYA 3GFTA 1VIAA 4OHYA 4B6FA 2HEIA 4TLCA 2IUSA 3H1TA 3AQ4A 3B5JA 4CGZA 1E2EA 1AZTA 4HDOB 3PCRB 4CZ2A 221PA 2IYZA 4UNPA 1ELOA 2IWRA 2VIIA 1N6IA 1QHHA 1ZIPA 1GM5A 1T91A 4HYYA 4M1KA 1IY0A 3ADKA 4DLUA 4B48A 2GBLA 2JJ2A 4URZR 3IHWA 4U00A 2WIAA 3GP8A 3UKDA 2R2AA 2OILA 1NF3A 1HT2E 2D62A 4TLAA 3FHCB 4GZLA 4LBWA 1BMFD 2O5VA 4QHTA 4F91B 1YJ5A 3CF2A 6Q21A 3QG1A 3H0KA 4ACBA 1NN5A 4M2LA 5JHHB 3L0PA 2QUZA 2XEXA 1G8YA 3QKTA 4QBGB 2BM1A 3TRFA 3ZVRA 1OFUX 1W5SA 4CEJB 5FI0B 1CBUA 1G5TA 4DUGD 2D2FA 2F1HA 1EWRA 1NN0A 4HATA 3NC0C 1UEIA 2J45A 2QP9X 1GNQA 3B9QA 3VFDA 4A82A 2QENA 4NE2A 3VQTA 4AIIA 4BEBA 1Z2AA 3WMFA 2O8CB 3B1ZA 2IYUA 2ZTSA 2DPXA 1SKQA 1T5LA 4CVNA 3RS4A 3FWYA 4HB4A 3H86A 1UJ2A 1W49A 4KFSA 2IUTA 3B1XA 4DEYA 3AEZA 3K53A 1QDEA 3AP2A 4JLPA 4N0EA 4X8LA 4ZI3A 4B73A 1OYWA 3SEAA 4MKIA 4E07A 3DKPA 4O2RA 1O3YA 5JCZA 1R0YA 5P21A 1Q20A 1KO4A 2B6HA 1NY6A 4JLAA 3TE6A 3LY5A 5J4HA 4C9BA 4HEJA 2GF9A 3UMRA 5JSZB 3SFZA 4US2R 3MAAC 1U0JA 4Q19A 5ELXA 4FXPA 1E3MA 2HV8A 1P4SA 2AX4A 1E9EA 2XOKA 1E2FA 1E2KA 1U90A 2HCJB 2HF8A 3QXXA 4UNQA 2IS1A 3ASZA 2QSZA 1KI3A 2HXYA 4NCKA 2ECKA 2QA5A 2CCGA 4HZIA 2AN9A 2AXPA 4TYWA 3C16C 4KHZA 3MCAA 1E9SA 3O8RA 4OI1A 4A0GA 4DDWA 2RGXA 3UATA 1BS1A 3KJEA 4BFYA 2YWHA 4GMXA 4DDVA 3THYA 3T06B 5GJBA 4ASUA 3EG5A 4CEJA 4QKQA 3GLIA 5FUYA 1FP7A 4XD7D 5D3MB 1XCPA 3ASYA 4AKEA 3X2SA 1M7BA 3QXJA 1CF4A 2ZIAA 2J7PA 1NBMD 4XSGA 2O8CA 1MH1A 1Z2CA 3QQ5A 2NG1A 4V02A 4LJ4A 1MO4A 1XMJA 1Y3AA 4NYJR 5JJLA 3VTKA 2YYZA 4M1TA 5BWMA 2B92A 3RRYA 4N1AA 4TTQA 4BE7B 1H8HA 1DG1G 2G9NA 1KMQA 3DZDA 5A0FA 4MITA 1P6XA 2EW1A 1ZM7A 1R8SA 3U7EB 4A8JA 2J46A 1HT1E 2F1RA 3CF6R 3OFND 3VX4A 5JSZA 2YOGA 3P26A 1MO5A 4JVNA 2BJVA 1QHYA 4K8OA 4Q5IA 3R9XA 1AKYA 2XTZA 4B3CA 2CK3D 3CRW1 3SBDA 3QUSA 2ERXA 1FNMA 3LQRA 1NMXA 2A5DA 1W44A 4OK3A 2GZAA 4QFMA 4RZXA 5DI3B 1XFAA 5CB6A 1J2JA 2ZI4A 4FMDF 1QF9A 1N6RA 4DVGA 1PLJA 2JLWA 1WXQA 2EYUA 2ZJZA 4LBVA 1UBFA 1CRQA 1PVOA 2BJWA 3PUWA 1ZJ6A 2H92A 1KO1A 1CULC 3IKJA 3NH9A 4PHHA 2Q3HA 1HYQA 2FH5B 4R2IA 4GPTA 4KYIB 5EE1A 4Z54A 3ZYCA 2AFIE 3GLIE 4JYBA 5D3MA 4MGKR 3PEUA 4KO8A 4OHVA 1OFIA 2O52A 1YR9A 4PHTA 1XJ0A 2RGNC 2OFWA 3T12A 3H2YA 4P4TA 4BFZA 1M7HA 5KSPA 4Q02A 3EC1A 2DY1A 2RGBA 3LRPA 4QHYA 3SHWA 2V1XA 5IK2D 5JRJA 1LS1A 4HUTA 4DLTA 1KDPA 2GCOB 1GL7A 2LCFA 4RZ2A 4QC2A 2QMEA 4HDCA 4YMSA 4BZPA 3BH6A 5JWRA 3NEYA 2KBEA 1OSNA 3IBGA 4YLGA 1L2TA 4OHXA 4TQAA 2FZLA 3RAPR 4LJ7A 2ZR9A 4KFRA 1GZSA 4M1MA 4TL6A 4Q9IA 4GP6A 2CL0X 2IYSA 1EFRA 2QSYA 3M4YA 4Q47A 1TMKA 3I5XA 2ZU6A 1E2GA 4ZIRB 1Z6TA 1E99A 1IN4A 4YMTA 3I62A 5IDVA 2YOFA 1DVRA 1FTSA 2FZ4A 3QXSA 3GJ6A 4OKSA 1YZQA 4PC7A 3WBJA 4IOJA 3S1AB 2GJSA 1S4QA 3EZ7A 1D9XA 3T15A 3TNFA 3SDZA 2ZE5A 1E9DA 1G8HA 1NVWQ 1OFTA 4LHYA 2ZRHA 1BH2A 1JB1A 4BASA 4LHWA 4B2PA 4LBYA 4KXFB 2XSZA 4JMPA 4B35A 5KOYA 2JLXA 4QJ5A 3CRVA 5ANRB 1NL3A 1OHHD 1RW4A 3CLVA 2CVHA 4PZYA 4BFWA 3NEJA 4O3MA 3TSWA 4F93B 2JAQA 5M04A 2GCOA 4Q1EA 1GITA 1JPJA 2QE7D 2IEZA 2PZEA 4DIDA 4HUQB 2D7DA 2WOJA 4Q1FA 2AXNA 2OUKA 4PPFA 5F98A 3HYRA 2V4ZA 1XDBA 3LVQE 4ZKEA 4DEXA 1M34E 4EFMA 3PUZA 1R4AA 1Z06A 2V6IA 4TT3D 4KVGA 1EFCA 1ZINA 3DMDA 1GKIA 2FSFA 2XZLA 1FPMA 3QE0A 4JBYA 1WQ1R 1N6NA 4LPSA 1E1QA 2ZS7A 3ZGXA 3PEVA 2DFTA 1UKYA 1QHSA 1IN7A 4HAUA 3R8CA 3P1JA 3UIEA 2PX3A 3ADBA 2OSBA 3LX8A 3QBVA 3KTAB 1GIAA 3I92A 3TMKA 821PA 3FE2A 2C04A 1KK2A 1XCMA 4KYUA 1OH5A 4OYHA 5HKKA 1B23P 3A1UA 1X8KA 3M1IA 1DPFA 1I2MA 2BMJA 4GMDA 3C8UA 4MRNA 4L8GA 5KNDA 3NDBB 3DZ8A 3GLGB 2IYYA 2IEYA 1XX6A 1HV8A 1SXJB 2CE7A 5GJVC 1NKSA 1P9NA 3LWNA 4DSOA 3DEFA 1AS0A 4CT5A 3K70D 4DSNA 1O87A 2C2HA 2WMNB 3KQUA 2W2XA 5JWHA 2ZRCA 1IJEA 4D0NA 4YXWD 1N6PA 2WPDA 4HLUC 3TAUA 1T8TA 1U81A 1WDTA 3CH4B 3CM0A 2JLSA 2ZRMA 4KSCA 4DWJA 5EZ5A 1Z3IX 1NVUQ 2E9SA 2IXEA 2FSHA 3GEEA 5K8TA 1SHZA 3SYLA 3QPVA 1HE8B 1Y63A 3I4LA 1I2DA 3L0IB 3HDTA 5EE5B 3UWKA 1YQTA 4TL9A 3A4MA 3RSOA 2WSMA 2D7CA 4JLDA 4MYUA 5DYGA 1G1MA 3KTAA 4CDGA 2V3CC 1NN1A 3ZVMA 1N0WA 1R5OA 2QMOA 3K9GA 4AD8A 4BZQA 2A5GA 1LNZA 3O8CA 1AK2A 2R6FA 1V5WA 4HZUB 2YZ2A 2TMKA 1U8YA 2W6JD 5CDFA 2REOA 2BDTA 4IXNA 1SXJA 2OT3B 1S3GA 4U7DA 2ZSDA 2AR7A 4C0SA 1KI9A 1EX7A 5C4MA 1NJFA 3NDPA 3DO6A 4HB0A 5J4LA 3BS4A 2JJ1D 1E69A 2VSOA 4D80A 4Q7KA 1DO0A 1GILA 5FOUA 4ZCMA 5JCPA 2VHCA 3FFBA 3PUXA 3RRMA 4OQMA 1MV5A 4KLZA 1NY5A 1OE0A 4A2WA 4GT1A 4OL0A 121PA 4DCUA 4HLDA 2QTVB 1Q1ZA 2WBLC 4ZCIA 1KYIA 5DLQC 4G0NA 3GFPA 1NSFA 2GZHA 4JKYA 3W8NA 3LLUA 4C3ZA 1M1YE 1IQPA 2XJ9A 4Q4HB 5J4YA 1SKYB 1L7VC 4QG7A 1XD9A 1T3HA 3AUXA 2GAAA 4WVFA 2QL6A 1M7GA 4IW3B 4OBEA 3IPXA 1COWD 4TYNA 4RY2A 2C96A 1OKKA 3LBIA 1QG2A 4WA7A 1KJZA 3JZAA 1ETUA 1U0HC 2JA1A 4UNRA 5CDFE 3TUIC 2EFCB 4CIDA 2ZI3A 1G6OA 4I4LA 4LUCA 5BYKA 2PX0A 4K81B 1CU1A 5FFMA 3U60B 5DHAA 4U02A 3L8YA 1HY3A 1Z29A 2MMGA 3B1WA 4L4UA 2OV2A 2FE4A 3BOSA 2ZITA 4YMVA 2V1UA 4JYCA 1NLYA 1KZGB 1XZQA 3WMEA 4HAYA 2Z4SA 4MQBA 4B3BA 4EFNA 1IXZA 2ZSBA 3OZXA 3AVVA 3K0SA 3JZMA 5KSOA 1PJRA 2V7QD 5KPDA 4KFTA 3N70A 3OE7D 1R0ZA 1CLUA 2CBZA 3REFA 4IEIA 1E2QA 3KXLA 2WWHA 1XEXA 2NQ2C 4DKXA 1W46A 5LD2B 4GZMA 2VP2A 3MD0A 4Q4HA 2Z4RA 3ZVLA 2FMXA 4XIGS 1KDOA 1KI1A 4JT2A 3OIVA 3OEHD 1RYHA 1SVKA 2EFHB 1Z6YA 2ZYTX 2QZ4A 3NBZC 2QMUA 4HLCA 3AUYA 5GVSA 1NMYA 4RFSB 5GJWC 1G291 4Q9HA 3FKSA 1D2MA 2EFEB 5JJKA 1OJLA 1ZC3A 2F43A 4OHZA 4BZXA 3A37A 1XF9A 1W48A 4MRSA 4AKGA 2OLJA 1MR3F 3IDQA 1CJMA 1DAEA 1UM8A 4B47A 3BORA 4FD2A 2JATA 2J0SA 4AK9A 1E2HA 1E0KA 5EXXA 3P32A 2OZEA 2ZVQX 4LX0A 4DHEA 1IN5A 3C7KA 3CO5A 5FL7A 2VSXA 1GTVA 1XTRA 1XJCA 4QBHA 2Z43A 3UXMA 3AF0A 4CYMA 3CWZA 3PXGA 4EPTA 2GBLC 4Q7LA 3IQXA 4TYPA 4DIEA 1JJ7A 1L4YA 4DZZA 4L9SA 1ZNZA 1KSFX 4UXJA 2QP4A 4PO9A 2FEMA 2AK2A 2GESA 1ZIOA 3BH0A 3DKVA 1C9KA 5K8LA 2A2ZA 1R8QA 2XZPA 4IKEA 3OF5A 5HCNA 1MO3A 1Q0UA 3B9PA 3GEHA 2JLUA 5KSZA 1ZU5A 1P7CA 1XRJA 2HJGA 4TTPA 5JHGB 3GLHE 3Q85A 5KO2A 4TMKA 2WJIA 5G3YA 2QAGC 3K0AA 1N6HA 3UMFA 3HU1A 3KKOA 2ZEJA 1N6KA 4FMBB 3LX5A 1E79A 1NVVR 4RFSA 1VG1A 4JKIA 4CRWB 2GAOA 2Q6TA 2A5FA 2W6IA 3RRZA 4IVRA 2HLDA 1VCMA 2NO7A 4GSYA 2F9MA 5AJXA 5LPNA 4LK2A 4JLOA 3VR5A 3Q72A 1TU4A 1JECA 3QENA 1GRRA 1OH6A 3PEYA 2LWIA 2JJ8A 3R9IA 4JT4A 5EJEA 3ONWA 2DWPA 4MRPA 2OFOA 1ZM9A 4MH0R 4NCHA 4OJQA 3GJ3A 2YKGA 3VNVA 4B75A 1W0JA 3LBNA 1M74A 4B34A 4IVQA 3KJHA 4JLVA 2DFLA 3CRRA 2JIZD 4XWOA 4C4PA 2BEJA 2CVFA 2O0JA 3KUCA 2GVDC 3MSXA 5DI9A 2C9YA 3DPUA 2ZJ5A 1OT3A 1Z08A 4URUR 5KUTA 4G5RA 2WJYA 5DE3A 3CUEF 4OQFA 3QBTA 2ZRDA 2OESA 3KZ1E 4NYIR 2EYQA 4RFVA 2PCLA 4G5GA 2VO1A 2FV8A 1FTNA 3BH7A 2NO6A 3AGPA 4NYMR 3SU8A 4URVR 4I1VA 2GETA 1S0UA 2A3RA 3HP1A 2N46A 2ZUDA 3FKQA 3K9LA 5CK4A 2J87A 2NGRA 4FI3C 3T1TA 1DAKA 1E32A 3NHAA 4B71A 1FQJA 2OBLA 4XTRA 3BIFA 3CF0A 2REXB 4B43A 3V9PA 3WYAA 1ZRHA 3OEED 3AKCA 1P62B 3CPHA 4M21A 1W7AA 4LJAA 3BD9A 1XXHA 4PHGA 1TADA 1CEEA 4JSTA 1AIPA 1T3SA 1KI7A 3R7WA 4EDHA 1KK3A 2ZSFA 3WYFA 1LTQA 1ZM3A 2YNMA 4JJKA 4CEIB 4IEEA 2QI9C 3IPYA 1WE2A 2OCPA 5FBWB 1T5IA 5K8IA 1TF5A 3B6EA 3GJXC 2ONJA 3TW8B 4WZBE 4EKDA 4PHFA 2VF8A 2WZQA 2ZI6A 1P2UA 2XAUA 1S8FA 2ZYVX 5AJYA 4EPRA 1KIMA 4EUNA 1KI6A 4GL2A 1W0KD 2H17A 4D82A 4I81A 2FFBA 4M1OA 1OF1A 2V8OA 3EAQA 3MJHA 2D2EA 5F3WB 1IY1A 2XNSA 4V0OA 2J9RA 2WTUA 1ZYUA 1H8EA 2VP0A 4US1R 2C99A 3PFIA 3T5GA 1DTSA 5EQTA 2PJZA 4A9AA 5AR1A 3EARA 1ZD1A 4PXAA 3TK1A 5HR5A 4Q7JB 4M1WA 5FPYA 2QGNA 4QRHA 2OCBA 3EW9A 4Z1MA 2UKDA 1M6NA 1XBTA 2FGJA 2OO7A 5L3SB 3U3OA 1P73A 1XXHE 1OH7A 3K0CA 4KFUA 5EE0A 4A1FA 3IO3A 4ZKDA 1G7CA 3B78A 1HURA 1OIVA 4Q1AA 3UK6A 2CHGA 3WNBA 2CJWB 3K9HA 1CKEA 4DCSA 4GDFA 1LB1B 2ZE7A 5FOXA 5TARA 1I4LD 4GFDA 4PAMA 3CWQA 2CDNA 4TSFD 2FG5A 3QEJA 2A7QA 3FVQA 2WHXA 5FR2A 4RZ3A 1A1VA 1W36B 2ODNA 3K0EA 3LXXA 3V4FA 2CMKA 4ZDIA 5KNCA 2P3SA 4B3XA 2UZIR 1S1MA 4EQ6B 5E4FA 1P75A 1VPLA 4RCYA 2QAGA 2XB2A 1KK1A 1KKLA 2IK8A 4AURA 3L8ZA 2RHMA 4IRUB 3HJNA 1F60A 3F5FA 2B21A 4YONB 1I4TD 1DAGA 1G3QA 1NNEA 1NG1A 3W34A 3WRYC 2XZOA 5C46F 4RSGA 1NSTA 1RRPA 3UPUA 1XEWX 2W0SA 3HU2A 2ODEA 2X2FA 2ZR0A 1I4DD 3E2IA 3WYGA 1FW6A 2CNWD 1UPTA 1P61B 3KKQA 2X77A 1TTTA 3QOFA 3KQKA 2ZRFA 2P6RA 3GD7A 4KJZA 1MOZA 1IOZA 2QPAA 4TYQA 3PUVA 3CNLA 5CLLA 2W00A 4LYJA 4PC1A 2ZVPX 2R6AA 2WKRA 4GOJA 3LFUA 3DM9B 1E9AA 4R98A 1T4GA 1XMVA 3CNOA 3TUZC 4WZ6A 4UXHA 4W7SA 1MRSA 2NZ8A 2K5UA 2HXSA 3IUYA 4M8NE 2ZUBA 3UWOA 3IQWA 3LNCA 1KMHB 4BFUA 2J0QA 2JEOA 4AY2A 5DN6A 4V0KA 5CJ2A 1E2IA 1S1CA 3ZLJA 4Q4JB 3Q9LA 3QVUA 2P6NA 1W2GA 2JJ2D 2AHOA 1YRBA 2GXUA 2H8KA 2MSEB 4TQ9A 4EIWA 1TPZA 4A6XA 4L9WA 3KX2A 2JLYA 4K46A 5L3QB 1JR6A 3RNLA 5C4GB 5GVRA 2OCAA 2VQSA 2WSSA 3P4XA 3PENA 3FDIA 2CEAA 2ZRGA 5HCIA 3WRXC 3R8FA 2FDCA 3ZZUA 3LW7A 2ATVA 3AF4A 1KI4A 3M6AA 4M9QA 3AF2A 4DDTA 1DAHA 3HWSA 3FOZA 2W83A 1SVWA 1S9HA 2ZAOA 4CT4B 3ZD7A 1G19A 3KKMA 4JVLA 4DLRA 2HYIC 1RVDA 4DJTA 3SN6A 4M1SA 3I32A 1J90A 2VEDA 1OIXA 2O0HA 2DB3A 2KWIA 3TBKA 1OV4A 4LSGA 3THXB 3A36A 5DH9A 3TVTA 4BLPA 5AUQA 4Y0AA 3V00A 2OHFA 1W4BA 4LBZA 4P33A 1U9IA 1Q1QA 4C0BA 3FYHA 3GLFB 4XVRA 5AJVB 4IDPA 4G5OA 4Q4JA 3C5CA 1ODFA 2IT1A 4J0QA 1FOEB 2XOKD 2J41A 1G8PA 1FX0B 2G3YA 4RVCA 5HZHA 3LW8A 1CR1A 4FN5A 4Z51A 2P5TB 2VRWA 3FMFA 4TLDA 3FPAA 2Q9CA 2BVNA 3PJRA 3PVSA 2QG6A 3CONA 1CP2A 5AK0A 5F9FA 4M0LA 2WJGA 1G3MA 1JEEA 3CH5A 1EGAA 3BC1A 3KFVA 3W5IA 2WWXA 3NKVA 2BBWA 3KXKA 1YZTA 1ZC4A 1ZW6A 4ZV4A 4A0FA 1SXJC 1PLLA 2YJTD 3SJZA 1XMIA 4QNMA 4DB4A 4RD0A 5GJCA 4RD3A 3EPJA 1RRCA 3BB4A 3X1WA 5KU1A 3K70B 3EPKA 1S9DA 1KO5A 4ASUD 3CR7A 3TUJC 3RRNA 3AKDA 1KGDA 2J7PD 5CIQA 4OI4A 1OYYA 3GFOA 3AVTA 2FNAA 3K09C 2PMDA 3NHBA 4IDHA 2X2EA 2EQBA 2GHIA 2H5EA 3CR8A 4Q9LA 3KFXA 5BN5A 2NMVA 5EUMA 3D6TB 4P4SB 2IYWA 5DI3A 1H8HD 2WWIA 3U4QB 2ZRKA 621PA 4TLEA 4R7ZA 1TL7C 4C2UA 1GL6A 1NG9A 3A4NA 1KOFA 1P9RA 3KUDA 5FOWA 4O2LA 4I1UA 1JQLB 3GLFA 2BBTA 1FQKA 3VU9B 4MDEA 4DB2A 3MWKA 4XTCS 4ARZB 3CB4A 5C2JB 2ZRNA 1F2TB 4NU0A 1R5BA 1OW3B 1JXOA 2W58A 3HPRA 4LC0A 3LXRA 3WBKA 5EP4A 4BRUA 1G5PA 1TEVA 4JL8A 4PAOA 1P2VA 1VG9B 3QI2A 4B44A 3U3MA 1KAGA 3LAWA 5J4KA 4B6EA 4US0R 2QRNA 1OIWA 4WBSA 1G5RA 3ECCA 4LJ6A 2GNOA 4G1UC 4GOXA 4OK6A 2EVWX 4DCNA 5C1BA 2F1IA 3BERA 4NONA 1KJWA 3U61B 4IOLA 3RWMB 3LBHA 2GKSA 4LDJA 5TDHA 1BYIA 1CR4A 4Q4AB 4ESHA 4PPQA 2KB0A 4JBWA 4RKFA 3PEWA 3N2EA 2W2VA 1YRAA 5AUPB 4NBSA 1DADA 3I1FA 3U44B 4R9UC 5JZVA 2IYTA 4NPHA 1JPNA 3A1VA 4Q9KA 5TY0A 2ORVA 3VKWA 3ZZTA 3RS0A 4QXAA 1BOFA 1F5NA 1KI8A 2WJJA 3AVQA 3HR7A 3U4QA 2GA8A 1UFQA 1OFHA 2BMFA 2EU8A 3T1VA 4KLNA 4BQSA 1U94A 4DLWA 2FWRA 2YOHA 1X1SA 4L15A 5B2ZA 1ZP6A 4XJXA 2OAQ1 2EWWA 3RDPA 1II0A 1E9FA 1YR6A 3LO5A 4ZIRA 2AKAB 1RIFA 1VCNA 5FUVA 1F2TA 3S1AA 4LI0A 1KSHA 5CYOA 1E2LA 2XNDA 1ZD9A 4LZZA 3Q5EA 2IHYA 1EFRD 3ND9A 4PO8A 3GPLA 3U6BA 1DAMA 3DOFA 3EPHA 4EPYA 3ZH9B 3THWB 5L8VA 2BKUA 4QJ3A 5BXQC 1E9CA 2KBFA 1L8QA 3IEUA 5BW8A 4OQLA 4BWYA 1MT0A 3C5HA 2NOAA 1X1RA 5FUWA 3LVRE 1E9RA 1XPRA 2CCJA 1E1RA 1DAIA 1P72A 2OE2A 4NDZA 2WIBA 3CRMA 4QGGA 1GFIA 5JMTA 3D8BA 5TXGA 2KI5A 4HUQA 3X1ZA 1U2RA 5CLQA 2O8DB 3IILA 3U44A 4B3GA 5C18A 1CIPA 2C95A 4LJ9A 3A1SA 4JIMA 4AG6A 4AWXA 2XSZD 4P31A 4W9MC 4BLQA 2C77A 4MKGA 4O25A 1WP9A 2JLRA 1Z47A 2GJ9A 1Z6GA 3QF7A 4PC3A 3X1DA 2FGKA 2ZUCA 4M1YA 1E4VA 3G82C 1D9ZA 3JVVA 4E22A 2OM2A 2ZI9A 5LD2C 3QKSB 4TTRA 4EFLA 1NP6A 3OAAA 4PX9A 3M0EA 1TQ6A 4DXAA 2HT1A 3U7FB 3IIKA 1T8UA 1NMZA 1TQDA 4A2PA 2PEZA 3SJCA 2A5JA 3EZFA 5F2EA 2C9CA 3ZIAA 3CPJB 1XD2B 2F3TA 2CLDX 4LV6A 2UVQA 5SZIA 4D6PA 2P2LA 1E1QD 1B0UA 1ZUHA 2YVUA 4X8HA 1HEIA 5FOTA 2OLKA 1X86B 4XWAA 3GLGA 1RE0A 1HTWA 3P4YA 3THWA 2ORIA 3BXZA 1ESNA 1D2NA 3MRSA 2PEYA 2I1VB 2QN6A 4N3NA 2ZJBA 1G41A 4QL3A 4URWR 3U3JA 1ZU4A 3B1YA 3T1QA 2GK6A 1SGWA 4OK5A 5HKKD 2REBA 3BGWA 4LJYA 3WXMA 3DDCA 4PQRA 4JL6A 4JLMA 3K09A 3LA6A 2BBSA 2IWHA 2FPKA 3IIMA 3EA0A 4OHWA 3NBYC 1F48A 1YKSA 5L3RA 3IBYA 1IAQA 1S96A 4Q1CA 2HUPA 3I72A 3O8DA 1RFLA 5FBLB 2QPOA 3E5HA 4YMUA 5FBRB 5AUNB 3TKLA 1G3IA 3NG1A 3CX8A 1JQJC 3Q7PA 1FUUA 2WPDD 3E70C 3W3AA 3TGPA 421PA 3QKSA 1KDTA 4ABYA 4F4IA 3MG9A 5LB2A 3QKRB 2QM8A 4DLZA 3LLMA 1XTKA 2XNDD 3GCGA 4BFSA 5KPJA 5DO9A 2JLQA 2ZJ2A 4X8MA 1N2CE 2XTMA 2QU8A 5E95A 4JLJA 4ITRC 3VR4A 4HZUA 3I3SR 4Y0VA 1XZPA 4B74A 4C7OB 3AP3A 4Q00A 1W4AA 1XTJA 2R6GA 3GLGE 2CE2X 1SXJE 1AN0A 1E2PA 3FHOA 4DC9A 2B8TA 3EX7C 3HR8A 721PA 1II8B 1JEDA 2BC9A 2GEDA 1LV7A 2R6CA 1KSGA 1BYUA 3CNNA 4LWZA 1AQYA 2P5SA 3RS3A 2NPFA 3GLHB 4RKEA 1Z5ZA 2A9KA 2JASA 3ETLA 3H84A 3H4MA 3SS8A 2QTHA 4MGIR 2O8EB 1DELA 1OLOA 1AQUA 5FOSA 3U3KA 5EXPA 2JGNA 1U8ZA 3P27A 1DO2A 1FP6A 1OXTA 1VYTA 1SXJD 2XX3A 4WW0A 1E2NA 3CZQA 3EASA 3RWOA 3WP0A 5K8UA 4CEHB 5KTYA 1DOAA 3L2OB 4XWKA 2AK3A 1DARA 1D5CA 4QGHA 4ZPXA 4BPBA 2AL7A 3DMNA 3BAFA 3VKGA 2IUUA 2DFKB 4MKFA 4D4MA 3EIHA 4GOKA 1Z6AA 5AWFC 3MUFA 2PLFA 4RD1A 1IBRA 3QKRA 3R20A 4TMXA 1ZM4A 3A4LA 1R0WA 2QQEA 2YWFA 5CIWA 2ODWA 2QORA 3MWYW 4FW9A 1A7JA 4HSEA 2G83A 5JI2E 1G16A 2PT7A 1LVGA 2ZM5A 1XP8A 2X1VA 3ND8A 2Q0HA 1T0HB 1W5TA 5JS7A 4V0MA 2ANBA 3X1YA 3EZ9A 2JLVA 2C5LA 2X19A 1K8RA 3MLEA 3B7GA 3EXAA 5GADl 1RPZA 2VP9A 1K5GA 3AVOA 3SYKA 2FF7A 4HAXA 3I73A 1TQ4A 4UNNA 4NHOA 1WMSA 1EFHA 2PCJA 3NXSA 1OKKD 4JVSB 3IIJA 5DGXA 2NO9A 1RJ9B 2DYKA 3SZRA 3U7GA 3K0CC 2WMOB 5SZKB 1R0XA 1S2MA 4JJZA 2FJUA 3RVBA 4FIDA 4CEHA 4QM6A 3D3QA 3TQCA 4R2HA 1M8PA 3N5CA 5LBIA 2L0XA 3KL4A 4WOPA 1XEWY 2QT1A 2B7CA 3NC1C 4YDHB 5KHOC 2ZE6A 1GAJA 4A2QA 1KSJA 1K6MA 4HB3A 1JALA 4IOKA 2H1LA 1TX4B 1T6NA 1SKYE 3UG6A 3X1XA 4IVPA 4F7WA 3QY0A 4R71A 1HH4A 3PIRA 2PZFA 2ZJOA 2NTYC 1AGRA 1T3LA 1PUIA 4FCWA 4D25A 3SQXA 1ZUIA 2D4HA 1ANKA 2ONKA 3CX6A 2PT5A 1E0AA 2WWGA 4AKHA 4A4DA 4BFVA 3EWAA 3LV8A 3MWJA 4I1SA 1Q21A 1JR3A 1SVOA 4V0ME 4A92A 5FTLA 4KU4A 4KITB 2ZAMA 5AJZA 3BWDD 3D7MA 5FBQB 4D0LB 5G3ZA 1G9XA 2E1RA 4NCIA 4DBLC 2SHKA 4XOIA 1WF3A 2BKEA 2FA9A 1RJ9A 1Q12A 2QAJA 3QXHA 3FKSD 5EXTA 5FI1B 3T61A 1UF9A 3C4JA 5JECA 1XEFA 2YINC 4U5XA 3BJIC 4S2EA 2J0VA 4YDSA 4EPWA 4B2LA 2CL6X 2WWYA 4LV8B 4PPNA 1KNQA 2Q21A 5EP1A 4ACAA 1N5JA 3RHFA 3K8YA 4W5HA 2V9PA 1Z22A 3A6PC 1YHNA 2CHQA 2VHUA 1RRFA 3TH5A 2ZPTX 1YZKA 1VECA 5FL7D 3CRQA 5A4JA 1KY2A 3SYNA 3LQQA 1W36C 1IONA 1LS6A 2IYRA 1AGPA 3BE4A 2NPIA 1VCOA 3NVAA 1IXSB 2JDIA 3PV0A 1FZQA 1Z0DA 1KHTA 4JLBA 4JSYA 4Q1BA 4Q9JA 3RS7A 2G0NA 1D2EA 3WNDA 4PFSA 2J7KA 2YC2C 3TQFA 1AJEA 4C30A 5KSYA 5JRZA 2F9LA 3QSYA 4MDFA 1G17A 2BM0A 3VMFA 3W6NA 4D4LA 1G7RA 1CRPA 3IEVA 4II7A 3SR0A 3G0HA 5DISB 4JS0A 2QBYB 4P32A 4NYIQ 4E03A 2E87A 1QVRA 1IXRC 1N6LA 2NO1A 5DYIA 3VNUA 2VHJA 2MSDB 3FTQA 5JBQA 1Z83A 1NIPA 1Z0JA 2DBYA 2RAPA 1E79D 3OHMA 3RANA 1KTVA 4TL8A 4FINA 1UBGA 3W3ZB 2W6ID 4KBFA 2CCKA 3TSOA 5CJPA 1G6HA 5KYKA 5IRCD 2IYXA 3NBXX 4Q01A 2HLDD 4WAUA 1N0VC 3AV0B 2RCNA 2BCJQ 4IOMA 4D4KA 2ZJYA 5J5CA 2IL1A 2ORWA 2IS2A 4CF7A 1GL9B 1U9IC 2IS6A 1BMFA 1QHHB 2VL7A 4UJ3A 2FSGA 3E1SA 2OCYC 4D0GA 4TZ6A 1W0JD 2RH5A 3SJAA 1XTQA 2P0EA 5E7MA 5FH9A 3GJ4A 5J47A 3IGFA 2ZYUX 3QIAA 3ZQ6A 5KNBA 1VDZA 4P4UA 4DUGA 5H8WA 5AUOB 1EFUA 1CR0A 2VHTA 2XXAB 4KBGA 4LHXA 1XU4A 4JBXA 2ZS8A 3CBQA 4FCVA 4WIAA 5E7IA 2Z0MA 5JI3E 1FNNA 1TNDA 4A36A 1Z63A 2H7VA 3PG5A 1E96A 1MKYA 4G5SA 1X6VA 3L43A 1BIFA 3REGA 1UKEA 4M4SA 2BEKA 5UKDA 2WM9B 1TEXA 3QEOA 2FEOA 2V54A 4TN1A 2FPLA 1Z07A 2RMKA 2AWOA 3FMPB 1LY1A 2PJRA 4E5UA 5G41A 4CEIA 1VYUA 5L3VA 2IA5A 2OFXA 2ZREA 3K0FB 1G7SA 2QEQA 4C0LA 1GSIA 3KB1A 3OESA 5EUQB 1DAFA 1W1WA 1XTSA 1QVAA 3WHKA 1V43A 1CR2A 2VBCA 2VYFA 5DNYB 1ZBDA 3B85A 2CXXA 3K1JA 4URYR 3U3RA 2ODBA 2B7BA 3NWJA 4FWIB 1II9A 4M9SA 5SZJA 1WRBA 5FPHA 4BLOA 4XSHA 5EE3A 4B3FX 1VHLA 1NJGA 3ZVNA 4LV5B 1W2HA 2VF7A 4AYXA 4BEJA 4XD7A 5BYJA 1EXMA 4ON9A 2IW3A 3AVPA 2XXAA 1NBMA 2RKOA 4I1OA 4I99A 1ZMXA 1P5ZB 2X8AA 4LY6A 4LGMA 5CM9C 1OXSC 1H8ED 4TMWA 2KJQA 1J70A 2O0KA 3DM5A 4NKRA 5L3SA 2A5YB 2ZSAA 3AGQA 4LYFA 3K70C 3THYB 3LD9A 2H16A 1BO6A 2QNRA 3GLIB 1DS6A 4M9XA 4LC1A 2BHRA 1J99A 1Q22A 1U99A 2ZI7A 4HLQB 4BLSA 1DBSA 4DLYA 4RD6A 2XB4A 3RSLA 3OFNA 4Q4LA 4KCGA 3KQLA 1DEKA 3KDSE 4Q66C 3OIUA 2CJWA 5AJWA 2YC4C 3L0OA 4Z1MD 4B2IA 3EA5A 2CK3A 2IXGA 1KY3A 5BN4A 3K0FA 5TB5A 1UBEA 5FUXA 5A5GA 4PQYA 1WB9A 1N5IA 2QQ0A 4NZYA 4TLBA 2IBMA 2ZI5A 4JLNA 1MO6A 1ZM2A 3ICQB 4PSKA 4P0TA 4A8JB 3T1OA 1E0SA 4URXR 1GVNB 3VHLB 4PZLA 1UKZA 2NIPA 4EQ6A 3W8RA 3QNUA 5JJIA 2CHVA 2J0UB 3BFXA 4HAVA 4YC7A 2VTKA 1YZNA 2WV9A 4FMCF 2ZYWX 3QG5A 1AZSC 3THOA 1ZNWA 1NBME 2C03A 4DRZA 1VYVA 3I61A 1G7TA 8OHMA 2R6DA 1R5NA 4QOSA 5FOVA 4A0RA 4ZDJA 1LFDB 2W2TA 4QBIA 4EJSB 4FCTA 5IK2A 1WCV1 4PC2A 4MGZR 3B60A 3WY9A 3Q3JB 2ATXA 3IO5A 1F3OA 4HDQB 1NVXQ 2CLCX 2QPTA 3QPUA 1P3JA 3VX3A 2CL7X 2DHRA 4IFBA 4ZCLA 4ESVA 4NYJQ 1LF5A 1P60A 1QHGA 1N25A 3FMOB 1Q1BA 2VA8A 4NCNA 4PC6A 2YHSA 4D2IA 1U0LA 2GCPA 4IDNA 1X8LA 1YR8A 1KMHA 4G3XA 3U5ZB 2ZJ8A 1CJVC 2J1LA 4LHZA 2GEUA 3A1TA 4YQFA 1L4UA 4RD4A 1VHTA 1GNRA 2RGEA 3SQWA 4AYWA 2DFNA 5CB8A 2AD5A 5IT5A 1P9WA 2GJKA 1XMSA 3I8XA 2HDNB 2PMKA 5L3QA 3A8TA 2J0UA 3FGNA 1G8GA 3EZ2A 5H70A 2BBOA 4B33A 1IY2A 4OQXA 3DHWC 4IDQA 5DN6D 2Z5FA 3AVXA 4NTZA 2G88A 3RS5A 3U7HB 5F9HA 1W36D 1JI0A 4IFEA 3CX7A 1UADA 1KZ7B 1G3RA 5JFGA 2R8RA 2Q9AA 4NCJA 3EPLA 1OHHA 4GI7A 4EJSA 3AB3A 1DE0A 2WVJA 4V0NA 4LYAA 2GF0A 1EK0A 4BUJA 5JEDA 2WSSD 1G64A 2ZXUA 2G1JA 2FOLA 2QY9A 2IYQA 1FMJA 2GCNA 2F7SA 2QE7A 3GJ7A 2R65A 3VAAA 1WBBA 4Q21A 4V0LA 1YR7A 3BRWD 1UAAA 1F2UB 2MMCA 4OQNA 3THXA 2A78A 1BKDR 2G6BA 3WHLA 2J5XA 4Q03A 4TT3A 1G4AE 3KXIA 4ILEA 1Z0FA 5HE8A 1AA9A 5E7JA 2J59A 1FUKA 1SVMA 1XCGB 1P2TA 2WKQA 5H1YA 1TQ2A 4Q48A 4C0KA 1LW7A 2QROA 4MA4A 3OIWA 1F6BA 1FX0A 1SQ5A 4LCBA 1D8TA 3A1WA 3AH8A 4H1VA 4TMZA 1IN8A 1T9HA 4KVAA 1GG2A 3Q7QA 4L16A 4OJKA 5HE9A 1YU9A 4BLTA 2FFAA 2LKCA 1R10A 1GRNA 4DDUA 4HB2A 2I4IA 4PPGA 3AKEA 2ANCA 2F6RA 3TLXA 4DSUA 4F4CA 2DCUA 2BWJA 2H57A 3B2EA 4PO1A 3U6KA 2O8FB 4AYTA 2BOVA 1C1YA 3CW2A 3EZ6A 4NL4H 4A15A 5EE9A 3O8BA 1PUJA 1Z28A 4YXWA 4DLXA 3QPWA 1UDWA 1Z0IA 4F92B 4Q1DA 1G8FA 2I1QA 4JL5A 5B58C 1R6BX 3CPEA 2DWOA 2RGCA 2W0MA 1J8MF 4NP6A 4P4SA 1F2UA 2WICA 3SE0A 1SZPA 2J3EA 3C14C 2GILA 1E6CA 3NBFA 3OIYA 5CYPA 5FPTA 5LB4A 1IN6A 4DT1B 4ZO4A 4PSVA 5EZ6B 3UMSA 1UDXA 4TWZA 3GLFE 4JLKA 1FL9A 1XPOA 3VU9A 2WJVA 4PTLA 2I3BA 3G5UA 4ARZA 1E9BA 4DCVA 2NZJA 1NLFA 3GJ0A 5B57C 2N1BA 3MFYA 1ZNXA 2R44A 1LF0A 3VKHA 5FPKA 1N3BA 2JLZA 4AI6A 3F0TA 2Q9BA 2IYVA 2W6JA 3SJBA 2ASEA 4B3DA 1J8YF 1MRNA 4POAA 2XGJA 2GEVA 1K5DA 1Z6XA 1N5KA 2VLIA 4DCTA 3CIOA 1A5TA 2PZGA 5H68A 4GRAA 2R62A 1AS3A 1A2KC 2O8FA 1E2DA 1HUQA 4Q4AA 2H18A 4H1UA 4C2TA 1MABB 2JJ1A 1SHKA 5J40A 4F4JA 3JVUA 4W5JA 2YWGA 4AC9A 3AVYA 1JXMA 4MRVA 2KE5A 3O47A 3PR1A 1CXZA 1Q1EA 4LYHA 4S35A 4QGFA 3T5DA 3VR1A 4GP7A 3AVUA 2ZSEA 4RJLA 2GK7A 4FMCB 1U98A 2Q3MA 4G01B 3ZZ0A 2C98A 2OXRA 4C0QC 2WKPA 1N0UA 2FN4A 5FTNA 2GWHA 3AKYA 2GDJA 1KO7A 4DT1A 2B8WA 5TVKA 2WWFA 4MUAA 3W6OA 5DHFA 1RYFA 3CZPA 4IXMA 3RABA 1GP2A 1ZCBA 3ADCA 3FHTA 3W90A 4JVMA 5SZHB 2HJVA 4PZZA 2OXCA 2IF2A 3TJZA 3C15C 3QF4B 3BFVA 5HZKA 1EFTA 2XJ4A 4TYYA 3VR6A 3V4RA 1COWA 2EWVA 2YV5A 5JLJA 4EPVA 2C8VA 4ZDKA 2PH1A 1UKVY 3A58B 3SC3A 2OG2A 2EFGA 4PAQA 3QKUA 2ZRBA 1Q44A 2FSIA 2QM7A 3LH5A 1S3SA 3AM1A 2Z6VA 2F55A 1NRJB 1VTKA 1XPUA 1UBCA 5G53C 4KSBA 4ZI2A 1TF7A
chains in the Genus database with same CATH superfamily
3HXQA 1DC7A 4ZQFA 3A1FA 5ERYA 2K6GA 4Y1FA 3S1YA 2I1WA 1JB0F 3G68A 1VLMA 4OHCA 5JJCA 2YBDA 5IMSA 2BFCA 4F04A 3R9WA 2W90A 3NWEA 4KODA 3HLEA 3V80A 1Q3TA 3WBBA 2VCEA 4MI9A 3OAAD 3NTXA 1FVXA 2C1ZA 1PR1A 1UZMA 2Y0TA 2XQZA 3AIKA 3MBIA 1VC2A 1US8A 3JPUA 1TUIA 1XWIA 1VZ2A 3ZVWA 2PV7A 2GZDA 3IODA 3RUPA 1E2MA 1T1RA 4RUKA 5ICFA 1OU4A 5KQ8A 1BU8A 4PJ6A 4IKOA 3B2XA 1Y4SA 4YRKA 2QTAA 4ROSA 1FR6A 1NBIA 2OPHA 2PK3A 1USWA 1UWVA 4C7OA 3ADDA 3UFXB 2F2TA 4IJMA 1T1BA 3DLCA 5JQGA 1JHAA 1A71A 1GCGA 2RGHA 3IAM1 3ENQA 2QRZA 5G4YA 4CE6A 1ONBA 1MX9A 1R00A 2CKDA 1HE1C 4JI5B 3ICCA 4NMMA 5JDIA 1QF2A 2HPZA 2A4KA 4KENB 3SI7A 4FI3F 4YQYA 3Q81A 4IJFA 1GZ4A 1NIJA 5JW6A 1EVJA 5H4HA 4ZRNA 1GGKA 4KDFA 3CX4A 4WNAA 1HO3A 3M83A 3O3NB 3QBJA 1ADJA 3QUAA 1E62A 5TGTA 4P4GA 3LLSA 4LTMA 4BNKA 4EHBA 4S1WA 4B7HA 5B7QA 3GMIA 2XHZA 4AZFA 3SVZA 3FX2A 1FLVA 3H4TA 3C6ZA 1DXYA 3R7WB 5EWLB 1TF0B 3ZV5A 3F9CA 3L7NA 2PYDA 3ISJA 3LRXA 3HSKA 2Q41A 1Q11A 4QBFA 5FTWA 2FVYA 4YJ2B 3PC6A 1N9NA 3WV4A 1QUSA 1I7QB 2O14A 4BO8A 1AK9A 1CJBA 1FLAA 2HREA 2I4TA 2VP6A 4CR7A 1JR3D 2EC5A 1PZNA 2C78A 1KGFA 1KHHA 2F1JA 2HK7A 1Z6QA 3HTXA 3L0YA 3AF5A 2DM6A 4R0QA 4NV0A 4E5YA 1X7GA 3NRCA 5FLXS 4C2AA 1IQUA 4TQGA 1KKUA 3B8EA 3Q9UA 1H6BA 4UUBA 4XDHA 2RHCA 5JNTA 2QAGB 3FVVA 1OTEA 3ANYB 5FL3A 1MB4A 2GM4A 3BQ9A 1YFJA 2DR0A 3FH5A 3IRVA 4KZ9A 4R41A 4FGJA 4HDOB 3FNFA 2J9FB 1NX9A 2B3DA 1RM5A 1TTQB 3KL2A 4U00A 2VPZA 2D62A 2VA9A 1DL5A 3ZC7B 3RJ5A 2G1AA 3N8SA 1Z2PX 1VPTA 3VQTA 3B1ZA 1H19A 5CDSA 4CVNA 5FIUA 3AEZA 1QDEA 3KZVA 3P2IA 2VQDA 5EM0A 1F8YA 3I6ZA 4PHCA 2HWXA 3C6QA 1Q20A 4PQGA 1YGYA 5J4HA 4PYKA 2NZWA 3AUAA 3PTEA 3LPDA 1E2FA 3Q7VA 5DJTA 3RUHA 3I09A 1JEOA 1MORA 4F9TA 2CCGA 1DKUA 2IYOA 4L5JA 2PNFA 3E9SA 1D2GA 5I7OA 1CK3A 1LI5A 5EJ5A 4GMXA 3BICA 3GQ4A 1NBOA 4ASUA 1FMFA 3EAFA 3SM9A 5AW2A 2ALJA 1CF4A 3P2EA 1M7BA 1OLXB 3QXJA 5JO0A 3TL3A 4XSGA 4ZO6A 2I2AA 2PD6A 1LSXA 3RRYA 1KMQA 1AKUA 1WUKS 4IGEA 3CF6R 2XTZA 3KALA 1PS9A 4QU5A 2A1UA 1GSWA 4N0MA 1J2JA 2ZI4A 3B3QA 4LFUA 3NHJA 4QYTA 3UF0A 3IEKA 5FNVB 5F83A 1I30A 1RABA 3IKJA 3KELA 3NH9A 4GEKA 2CLHB 1R6UA 1IHOA 3MSHA 3ABQB 3RTYA 3B89A 4R1NA 1RMTA 2QUAA 3LRPA 3SHWA 2KHHA 2VDNB 4UVIA 3EXEA 4YO8A 2QMEA 5GWXA 4EEPA 5HMLA 4O2AB 2RHLA 4HDCA 4YMSA 3Q1FA 5HHTA 3V3KA 3V3TA 1UL1X 4KFRA 3CLSD 4Z9FA 2IYSA 4X3OA 2NSLA 4EZBA 4IBKA 3S7TA 1O95A 2ZU6A 4A91A 1E2GA 2XQVA 3ZU5A 1FP2A 4G4SP 4GX2A 1ECGA 2FE8A 1I10A 3W9BA 1GTJ1 1BH2A 4K5NA 5THKA 2IWBA 1JPJA 1L0FA 3FDFA 1SBTA 3LMKA 1OKSA 1H94A 4J76A 4HWKA 1P80A 3W5DA 1B6GA 2BONA 3F2VA 4JBYA 5CXUA 4O3FA 3O7MA 3PEVA 1TK2A 4MRMA 2W43A 3FWZA 5TF4A 1RBQA 4G1MB 1RJFA 2P9EA 4WOKA 4UQPA 2BE7A 4GMDA 2HF2A 6ADHA 2JRLA 2CE7A 2GO7A 2VDMB 1ECBA 1UBKS 4EY5A 2QHOB 3A6ZA 3KQUA 2XCTB 3H19A 5THQA 1D5WA 4IGKA 3CH4B 3I2FA 3WLTA 2OK7A 2VJMA 2XVXA 2JGAA 4XX0A 1QH8B 2WUGA 1RXCA 1OYVA 4PN7A 2TSYB 2Q6VA 1P6UA 2YFHA 1U0TA 1O8CA 4JLDA 4MYUA 1PZFA 2I3GA 1AK2A 3PDWA 1DV2A 2YZ2A 3PL5A 5FDSA 1ATIA 3HA3A 3KDAA 4Q0JA 3VR0A 3IPRA 1Z88A 2AR7A 5F23A 3NOVA 1I2WA 2B1GA 3B51X 3NHSA 3FFXA 4QRDA 3THSA 1DO0A 2FEWB 3SARA 2VQFB 2YXPX 4JITA 3IHKA 2QTBA 4E31A 3DE4X 1IQPA 4INJA 4MVJP 4WKPA 1T3HA 2IOQA 3LQFA 4RY2A 2Q7DA 1YRWA 2EFCB 5C8VA 4LUCA 4MJLA 1TK3A 4MUIA 5IAJA 2FWJA 5AW8A 1QQ5A 3BFPA 4HNBA 2ZSBA 3F2IA 3HWWA 3S2IA 1AIPC 2V7QD 3GFVA 3ORHA 5A4KA 3BSFA 4B82A 4N7BA 3KT3A 3EGCA 1W46A 1ULTA 3COSA 4E5PA 2VPYA 2PGAA 3RRXA 2IA2A 3VOAA 2WP0A 2JXNA 1EFKA 2VYQA 2P9TA 4AJ2A 4B83A 2G06A 4YT4A 3AUYA 2OAEA 4Q9NA 4RFSB 1ND5A 1N2ZA 1OJLA 1MNQA 4AKGA 1XF9A 3B2QA 4BCDA 4DBVO 2IX9A 3P32A 3ZE9A 4K6KA 1BVRA 4Q16A 3AF0A 4F3YA 3P9QA 1EDDA 2J7VA 2AGVA 1MB9A 1BXRB 1KQNA 4KXXA 1R8QA 4MVCA 1BFKA 1WQ4A 3IP8A 5JHGB 3KK0A 4UATA 3ZNYA 3K0AA 1N6HA 5KHLB 4E11A 1T2VA 2ADFA 2NO7A 4GSYA 3ZDXB 2HUNA 3PEYA 1JJAA 1EFPB 1NASA 2LWIA 2I7XA 3KXEC 4YV0A 4FYSA 3EG9A 4HESA 4JT4A 4TS9A 2DWPA 4DJAA 4G86A 2A3UA 4D9JA 4ROTA 4YRRA 4B9EA 4Z9QA 3DPUA 4NEQA 1OT3A 2O6LA 3T1HB 3IS3A 1IZYA 5DF9A 3TTWA 3AGPA 1TA0A 3ZJUA 3T1TA 3V42A 1P4AA 4YP9A 1GGNA 5IANA 4B43A 4JI7B 3OEED 3ZKWA 5IKEA 1ISSA 1UAYA 4M55A 2R7KA 5L3UE 1ZI9A 3DW1X 4TKVA 3WYFA 1LTQA 2ZBDA 1P7PA 5L2FA 2C3UA 5CVEA 3C38A 4O5AA 3TW8B 2VF8A 1NSYA 2DTEA 4KQIA 1YB1A 4UAJA 3AEUB 3PFGA 4UCFA 1CEFA 1IY1A 3N2ZB 3LT1A 1H8EA 1U11A 3EMVA 2XMGA 3RXWA 2R751 2DY0A 4NMHA 1C0KA 4W1SA 1XXHE 2QL5A 1OH7A 2CBGA 2A7GE 3BGDA 2Y20A 4FD8A 1GQ2A 1OIVA 5T8KC 1BQ3A 3O4JA 4K0KB 4GDFA 3UAZA 2RHTA 4EETB 2EQ5A 4C3OB 1TS0A 3PX2A 4YJ3A 3ITKA 3FVQA 1RKUA 1LV8A 1LK5A 2GD2A 3ABIA 3VSEA 1QC5B 2RHMA 1LHYA 3Q41A 1DQNA 3VYSB 1ENYA 3LECA 2NXCA 5CXWA 2LCQA 2L2DA 5IREB 4JYAB 3HLTA 2AYYA 4OBWA 1GAXA 2O1EA 4Y13A 1C3BA 2AFIB 3OJFA 1MAAA 1E9AA 3MMSA 1RQ7A 3D43A 4A16A 1EP1B 1CLEA 2PGOA 1QXSA 4FFRA 1TPZA 2VK1A 4QU8A 2JH3A 1RWKA 4HFRA 3KQSA 3DHEA 3RNLA 1SVNA 4BV2A 4MQEA 3ILYA 1X94A 1L5VA 1OIPA 4UASA 5LZ2A 2QIPA 4U2FA 4PSDA 1VZ3A 4DJTA 1V34A 1BX3A 4BVBA 2JGDA 3V3SA 2QYSA 3L1KA 1PK8A 3RB8A 1K3TA 4B08A 3HDVA 1A8UA 4I2VA 5JJ5A 1R9GA 3A05A 4MGHA 4EUKA 4DV4M 3DZFA 2QG6A 4Y2XA 1FFXA 5JYEA 2RJ3A 4I0WB 1PZHA 5K0BA 4NXMM 1GTRA 1AKNA 1BW9B 1C7RA 2ODTX 1CDDA 4JDUA 4LZLA 1EW0A 1NNSA 2O3QA 4X7PA 4HNVA 1Y81A 4ZHQB 3ZDZB 1V2HE 4HGRA 1JXAA 1X1EA 3VPSA 3W7VA 5BOSB 3TLMA 5CA1A 3WI7A 2PSSA 1S7GA 1YIOA 1VBMA 5DT2A 1LH0A 4LC0A 2YZKA 4ZXFA 4JL8A 1YF3A 3NGMA 4WBSA 3STXA 4GOXA 1PVVA 2VZWA 2GD0A 4NV1A 2I6UA 4PM9A 3ZGNA 5J2TF 3OTOB 3I1FA 2X2PA 2POQX 2IYTA 3EXHA 4YRLA 3I4FA 4JJ4A 2JGRA 2WJJA 3IP3A 3TEMA 1UFQA 1XRSB 2Q07A 3HJCA 3ENKA 3HH8A 1M0TA 3RDPA 1A9YA 3HREA 4P34A 5FUVA 3OCCA 2XOEA 4LZZA 4IBBA 3FPWA 4X7BA 5GQSA 4O33A 5AO9A 4EL5A 3CG4A 2BKUA 5BXQC 3ELDA 3WGTA 3DF7A 3FXAA 2NOAA 3TFWA 4X00A 3FULA 1W9HA 4ALKA 4CKCB 2PXHA 2XMRA 2DECA 3IILA 4I5SA 4KQRA 1E18A 5D3KA 4RS4A 3N2YA 2ZSJA 4DE2A 3IIKA 2X8WA 1FFYA 3FU6A 2H7YA 2PR6A 5F2EA 5D1NA 5C7LO 1RE0A 4Q0HA 1N78A 4Q0MA 1NJ8A 3DMRA 3VDRA 3LUHA 3G0BA 4L4XA 4ZJZA 1VI6A 5TBMB 2VC2B 5A1TA 4OK5A 2IPOA 3DDCA 2YD0A 1Q14A 1MZPA 3OZGA 3CZ5A 1YKSA 5EQJB 1VE9A 2GCEA 1YZHA 1JTEA 3NG1A 5I7SA 1SOUA 1FUUA 2MSNA 3VI3B 3TWOA 4KNYA 3S2EA 3U26A 2P9QA 1TYAE 2QU8A 5E95A 4HTFA 4B87A 1RHJA 3TDMA 5HAPA 3GDIA 3G8CA 1I3MA 3UOAB 3WVNA 1Y0BA 2R1TB 2D8AA 3ANTA 3EX7C 2VZLA 3DCJA 1LV7A 4DTCA 4L1KA 2P5SA 2JASA 1OLOA 3PGKA 3CCFA 4IG4A 3CZQA 4NPCA 1Q7EA 4D8XA 2KQUA 1G20A 1JJBA 4AFIA 1Z6AA 2IUYA 2HIGA 3KSFA 3X1KA 3O8NA 4LDPA 4CUKA 2PGDA 1Z37A 1G16A 3D2CA 3HN7A 3L5KA 3WMWA 4WCDA 2ZBPA 1K8RA 4EYGA 1RPZA 2YXLA 3G0IA 4DQDA 5DGXA 4Z6YA 3F90A 3FCSB 3JZDA 3MAGA 1E92A 1VLZA 4X1KB 2Z9CA 1IZ7A 1XEWY 4B5LA 4NPAA 3T2HE 2H1LA 2EZ9A 3G8DA 4Z99A 3L27A 3V34A 1UJCA 1HZZC 1XX2A 4GF5A 3QVMA 4Y1EA 2EBUA 3CCCA 3KYBA 4WN5A 3JCZA 4D42A 1WF3A 2HJWA 1OFVA 5JECA 5AKGA 3MTGA 3NAMA 3HUUA 3CE9A 2BUAA 3QWIA 3TH5A 5DHUA 3ZGZA 3CRQA 5LSAA 1DQRA 3TNLA 5GLAA 1IXSB 2G1UA 4WZAA 1IEMA 1REQA 2HDSA 3DZ3B 5IZCA 3G0HA 2DNAA 4DWOA 3RV4A 3NHPA 3GEDA 4KXCA 4C89A 2XE8A 3OY2A 2VHJA 1L7QA 1Z83A 1Z0JA 1P74A 1IYZA 3T7JA 2XLNA 1UBGA 4ENSA 1HDRA 4XLTA 2EJSA 2XECA 3ADOA 2K9DA 3D6MA 2WZXA 4MAMA 3CJRA 5B4TA 2Q46A 5J5CA 4BIMA 3NMUF 5DM4A 1LL8A 4RA9B 5FH9A 4PYRA 1SQ6A 3M49A 4JBXA 4EZIA 4WIAA 2QLJA 3ZHCA 5PGMA 4OOYA 3HZJA 1NUSA 5HX7A 5FI2A 2AWOA 4J2OA 3UN1A 2QV0A 3ZKAA 5DGTA 3H42B 4G0VA 3HB5X 3I4YA 2G7MC 5JC1A 2W2KB 4H15A 4WRRA 1MKIA 2RB5A 2W3GA 1EZ1A 3NWJA 5TLNA 4NKPA 2VP3A 1U7TA 4XSHA 2ZTCA 3GZ4A 5EE3A 2L0WA 3ANSA 1EDZA 3V8VA 1RLMA 3RWBA 3PI6A 5ESWA 1VBKA 3KVOA 1BCRA 1RI5A 3Q2OA 3LD9A 3NGXA 1IFYA 1W5BA 1U99A 1AGYA 1YZVA 1K0FA 2PFKA 4CI9A 4FLEA 4QD4A 4AUKA 4IVKA 3QPDA 2I65A 1OU0A 3MS2A 3ICQB 4GD8A 3FWHA 2Z8ZA 3Q40A 1MQ8B 4G2TA 1OILA 5TT1A 1VB6A 3WJ2A 1AZSC 1GA4A 4GJ4A 1JEYB 2L4RA 3GRJA 4FH2A 1AUAA 1WPGA 4IDGA 1CDZA 2VHZA 4R9SA 3UB4A 4N4EE 2ATXA 3W77A 1GJRA 4ZCLA 1KVMA 4UDYX 5DYWA 5ED0A 4PNEA 1TA4A 4C01A 4PM7A 1U02A 2DQSA 3U5ZB 2JI9A 3OPPA 2OR3A 4RHCA 1DEXA 4AYWA 3ZG5A 3I8XA 1LVUA 3QMVA 1IZ9A 3MSFA 1G8GA 1U3FA 1ISIA 4IDQA 2ACVA 2OCXA 1P8JA 2G88A 1LRJA 5AQBA 1SC4A 3QJXA 5IN4A 1YSYA 2Z1MA 4ZI7A 4GI7A 1E4DA 4EJSA 3AEXA 3IUNA 2F7SA 1JS1X 4MMZB 1WMBA 1M0SA 4EFDA 2E4WA 1GGMA 1YDEA 2Y2VA 4LZWA 5E3JA 2RGYA 2ONCA 4BZWA 4XRGA 1TT5A 3WNQA 1O94D 1XCGB 1YBHA 4MP8A 4G0OA 3GO4A 4LCBA 3SZUA 2YMPA 5HE9A 2EUCA 4UTZA 3H1FA 1ST2A 3QK7A 3SHOA 4G3WA 5DNDA 1RAFA 1ZONA 1OLSA 1TM3E 2O07A 4MN6A 2WUVA 1LPBB 2HHHM 1SIWA 2QJRA 5A7GA 1Z28A 4DLXA 1QGOA 3GAZA 2CXHA 2MJLA 2ZOSA 3NZEA 3HFRA 2RGCA 4NP6A 1PTJA 2UDPA 1H3EA 2GZ3A 2KS6A 1PEYA 5LB4A 1IN6A 3S6JA 4XPIA 5C1IA 3PE4A 1A27A 5CVCA 4NZPA 2I3BA 2QKPA 3P9RA 1P7WA 3AGDA 1ZNXA 3W1EA 1J39A 1P0MA 4K0WA 1Y8QB 4GSLA 4I14A 4GMFA 2Y2OA 5H83A 2ENUA 3C45A 2N75A 5J40A 4HVCA 3X44A 3O8QA 3JVUA 1KEWA 1JXMA 4JUAA 1Q1EA 1Y33E 1U98A 2WKPA 3PHLA 4QECA 3O3MB 3D2LA 1T8YA 2XDQB 4Q6BA 5AI8A 2IF2A 5CDHA 3PA6A 5J6SA 1BVSA 2YV5A 4ZDKA 1M83A 1NRJB 4EV4A 3STWA 4BAUA 1R3DA 1ODCA 4YCBA 2AJDA 3MERA 5I3ZA 5DNAA 4HL4A 5AXDA 4UE6A 2UZ3A 3G59A 2WZJA 3I5UA 2V55B 1M0WA 3QF4A 3FCAA 4EQIA 4M22A 3T7KA 2GRAA 4YRQA 1U2GC 2L18A 2EZTA 4H4EA 3RH0A 4N39A 2J8ZA 3GFQA 4WBNA 1D2CA 2G63A 2IGTA 3ZXXA 5HP4A 5BN3A 3PITA 2WZDA 3DVRX 4QNRA 4JNCA 4XAQA 5KYXA 2G7UA 1Q3HA 1M8GA 4OI2A 1QKIA 3A32A 3KKPA 1U2ZA 5SY4A 2BMDA 4BNNA 1WW8A 3V4LA 3DKKA 2D06A 4J6FA 4M0WA 4P3YA 3TRIA 1B41A 5BUZA 2AEFA 1M2VB 2KZUA 3GLHA 1VG8A 4A6PA 3MMPA 4FDMA 3T2JE 2B5RA 2IPXA 4PZDA 3T7CA 1YVDA 2GYYA 1W4LA 2DHEA 4YMIA 1PLKA 5KX5F 3TR0A 2NZXA 2G77B 2JKZA 4MV6A 1IFQA 1XTIA 2BMVA 2PXXA 2XCSB 1UOOA 2CNKA 2BM9A 1CI9A 4DIBA 3UGKA 2WKIA 2XCIA 3EVTA 1TDHA 1YZGA 4PZPA 1T6ZA 5HAIA 3LTNC 2ZD8A 4AJ1A 3Q0TA 1IM2A 3JQGB 2GJAA 3FAZA 1V3TA 1LVHA 1T1SA 1VE5A 5EXSA 1MXOA 2WNIA 2NUTC 3X2EA 4M99A 1Y3IA 5I5GA 2YIDA 3FMVA 3UHJA 1MAHA 2FN7A 3OLXA 2VKTA 4QRIA 2D5BA 4RDHA 4YRDA 3ENVA 2H65A 4OVZB 3F8WA 4JZKA 3Q7EA 1XZFA 2AWNA 4IHQA 4LF7M 3WIUA 4U7WA 3RVDA 1WZNA 1EVEA 4WUVA 3GEMA 1Q0SA 1M1ZA 3ZLVA 3QHPA 1TEHA 3O3VA 3AU9A 4KOEC 3PQVA 2FZVA 2IU3A 1C9DB 2OV1A 1E3QA 2C9MA 3R6DA 1X9GA 2W3HA 4AF6A 4XZ3A 2IE8A 4KWIA 4FILA 4W5WA 4F2GA 2JGIA 1SVSA 2NXJA 2Q1YA 4GOLD 3ON5A 4C4SA 3V1NA 4AROA 4IP0A 4CGZA 3EVFA 5KOJA 1E64A 3SQMA 4B0PA 2HRZA 3MT0A 2GBLA 4B4VA 2GKOA 3L7LA 1Q7TA 4K6GA 1TVFA 1DBWA 4F91B 2XVMA 2B78A 4KIFA 5C5DA 5KX5B 3Q07A 4QGBA 3R7LA 1PSDA 1LT0A 2F1HA 2DUNA 1UEIA 3EY4A 4TV9B 3F7OA 5ALNA 3D4PA 3PYPA 4R1SA 1OTAA 5EQDA 3W5SA 1VKZA 1OYWA 5AK3A 3SEAA 1KORA 2B35A 1YZYA 1L5KA 1I6WA 3PJGA 3SFZA 1J23A 4FXPA 4PZAA 1X8XA 3DWIA 1E2KA 2QSZA 5EFOA 1SCBA 1NW3A 4ALLA 2AVXA 5ITQA 1IELA 4QNNA 4XN5A 1C8VB 3TI7A 1XIVA 3JQ7B 2AR9A 4MR9A 1Z9BA 2P35A 2CV2A 2JZCA 3JWGA 2G9NA 4XWGA 4ES6A 1ZUWA 1DWOA 1N33M 1TCCA 1PNRA 1QHYA 2ZKIA 3WS2A 2XYGA 4EF6A 1W44A 1XZCA 5DI3B 4QLAA 3FXSA 2Q1SA 3TGLA 3D2BA 3N8GA 5A91A 1XRPA 2JGFA 5CX1B 2QLBA 4N5NA 1UBFA 2FS1A 1QHFA 5MFPA 3T8CA 3P7NA 2PMFA 4KVFA 2JKTI 3GLIE 3DSRA 3ZNOA 3ZHUA 4ZVRA 3B7ZA 3PJEA 2HWWA 2OFWA 3T12A 1Z5BA 2J3JA 4KZ6A 1ORDA 3E4PA 3TSCA 1WIWA 3RTGA 2Z6AA 4IUKA 3EFBA 4UQIS 1M34A 4WKBA 4FDLA 3C87A 3VP4A 3QW2A 4K6HA 5FAPA 4ZVPA 3LPMA 3K6SB 3C1TA 3L07A 4ISBA 2P30A 5BRJA 1U3WA 1J8FA 1JB1A 1KE1A 5JNVA 4Y2FA 4JNKA 2X02A 1DJNA 2I9KA 5I9LA 1LRLA 5FLXA 2QM0A 2MJ5B 5GMOA 2O2SA 3IHPA 3KT8A 3FHEA 2ESRA 2OSBA 2J0EA 3BMCA 3TE8A 1BVYF 4N76A 4I50F 1CUWA 4UU0A 2IU0A 5KNDA 3F96A 3QP6A 1JZSA 5BUSA 4JWKA 1ZLXA 2BGIA 1R88A 2LNHC 3D8RA 1IJEA 3A46A 2B5OA 2EDCA 1IEWA 3CM0A 4ZRDA 4CM8B 3GT0A 4CCYB 1FRFS 2WRZA 4OQPA 1U6JA 3TMAA 3ILVA 3KR1A 2IXEA 2JK0A 4EB6B 1EEXB 1GABA 3BGSA 3RRBA 1E5DA 2W4MA 2VDUE 1A1SA 1DHRA 3L4KA 2FCAA 3N53A 3FRHA 1G1MA 4CDGA 1VE6A 1DP8A 1GQQA 3VU0A 2YMMA 3GTCA 2CMGA 2XRZA 1KJNA 3VI4B 4MIKA 4MWBA 3WA6A 1WETA 1S3GA 3D4NA 4WLVA 4FKHA 3HRKA 4WBGA 2ZQ9A 4N9QA 4E30A 4HLDA 3AHJA 3TBHA 3G2ZA 4CQJA 3TN7A 1UKBA 1HTBA 2GEBA 4CF4A 1M10A 4ZANA 1J8VA 1HEYA 2WNHA 5LQCA 1RJEA 3I8OA 3CC8A 1CVIA 5DW0A 5JZOA 5LNK1 1YUNA 2D1FA 5G0TA 3VR6D 2HMWA 1WYBA 3ND6A 3WDMA 3TUIC 5U47A 2V1AA 3B3GA 4Z2AA 4U02A 1HY3A 3GJQA 2RI0A 1KZGB 3MWDA 2CBZA 4H6JA 1ORIA 3FZCA 3DNMA 4OLFA 1B15A 2V0UA 4DR6B 4PNPA 5I4BA 4FS8A 1LLDA 2XXJA 3K1TA 4P38A 1V6AA 4Q9HA 1BQ4A 2HV1A 1TW3A 1R2ZA 1UM8A 3ZG7B 3MS6A 3PF9A 5DBHX 4BVGA 1SWVA 1O5IA 2C54A 2Y8HA 4DV0B 3T99A 4GQBA 1TM5E 4MPPA 4QBHA 1C0PA 3PQEA 2XUOA 3FPLA 4RM3A 2HNKA 3HLCA 2FEMA 2AK2A 4KAFA 3DCIA 2JLUA 2OC4A 5BVHA 3VKFA 4DDHA 4FJ2A 2C61A 5F2OA 3SS9X 1P1RA 5LPNA 4JLOA 4D9GA 1IATA 3Q7RA 5TGZA 4IR7A 1NHGA 4B75A 1FC0A 5JPIA 3KJHA 3CRRA 3PTLA 4RHUA 1BD3A 3MSXA 4OBBA 3N8LA 4GBJA 1ONGA 1TF1A 1O5OA 2PCLA 3U48A 2A92A 3A3PA 1B2LA 4HWPA 1DAKA 1MG0A 1PD0A 4OLJA 3L9XA 1B26A 4ND3A 4M21A 1W7AA 2OM6A 4KDEA 1UXGA 5IUNC 2X9VA 4RTQA 4JSTA 1J2RA 3EVEA 5M19A 1KK3A 3GRPA 3WRVA 4ZICA 3F7TA 2EKLA 2WG0A 3RJZA 3WKBA 1HMYA 3H4IA 1NDUA 2H17A 3GNSA 2EA0A 5HEKA 1P1BA 4JR2A 5F3WB 4V0OA 3AW8A 3BBLA 4PYMA 2H1OA 3KSMA 4H3SA 2VTBA 4FEYA 4DY4A 2XPCA 4HXEB 4RIEA 4OJNA 3LQYA 3GLVA 1KMNA 2FRDC 4QQ8A 4ZKDA 3II6X 1LB1B 1VFPA 4YCJA 3KAJA 4LKOA 3ABRB 3CWQA 3P98A 3EH2A 3TL2A 3I9JA 1WMAA 3JYOA 5IYZF 1KAQA 4DPKA 5KNCA 2OP0A 5FWAA 3E4RA 4W1PA 4ZO9A 3AUFA 3B5EA 5U9CA 2IYNA 3AIMA 3G02A 5CVDA 1GUBA 1P4GA 3Q6IA 3KS8A 3N21A 3LGXA 2X8JB 3R7FA 1FIUA 1PHPA 4IQ0A 1IOZA 2DI0A 2QPAA 3PUVA 1G8SA 3R5JA 1PGNA 3OLCX 2RG7A 4HIAA 4WDRA 3TUZC 2AG6A 2R47A 2VLBA 4CM9A 3TTSA 3KZXA 3UWOA 3DCNA 1S1CA 4KRGA 1QZZA 3CZAA 2H8KA 2MSEB 4NZ9A 1GN8A 3E9MA 2DQ4A 4DGQA 3AINA 2XE7A 4HNTA 3BTOA 2N47A 5EA2A 2CEAA 4OQ4A 1LNQA 4C4YA 3AF4A 3B3XA 1KI4A 3WGZA 4OP1A 3GRKA 3KDPA 4DLRA 2Q4DA 2J4CA 4O4JF 2FUCA 1U1GA 2R7MA 5DH9A 3HJSA 4R1GA 1RZVA 3NWBA 4KWHA 4F21A 3Q7TA 1IAVA 4HGOA 3QVWA 1SMKA 1M66A 1H5XA 4C3VA 4TLDA 4RF5A 1ENPA 1D1PA 4X7RA 1FA9A 2O2YA 4M0LA 1G3MA 1U5CA 3F74A 3OZ7A 3WSWA 1SXJC 1VETB 3ZNQA 4PAGA 5F5XA 2C8LA 1SQGA 1NYTA 1KDSA 3GFOA 3WB0A 2VDBB 3MJQA 2IIVA 5C7OO 2J80A 1KAMA 2XQIA 2EJBA 2FZKA 4ZYLA 4HJRA 2P77A 4I1UA 3KT6A 2P08A 3STYA 4EYSA 3U3XA 1JHUA 2XTAA 3MOSA 2NO4A 4MV9A 3DT9A 1UJNA 1L0GA 4B44A 1KAGA 4B6EA 2HF6A 1HX7A 3I51A 4DCNA 1YT4A 1E1NA 1A77A 4ITQA 5IYZB 1MY8A 1XLTC 2Z09A 3PEWA 5CAEA 2BDUA 2EQAA 3WJ1A 1E6LA 5EHZA 3A1VA 3ZWQA 3ZZTA 1UAGA 1GPUA 5JAPA 1SBQA 4HJ4A 4DLWA 4NIMA 1VHQA 1CF0A 2YJ5A 5LQDA 4Z1OA 3PHIA 4XUZA 4NR0A 1MEJA 1NVBA 3G0OA 4XQEA 1WJGA 4EPYA 1KS2A 4TMNE 3G31A 3C5HA 2W2OA 3HXPA 1E1RA 2P1RA 4MKGA 3AR6A 4PC3A 4ECEA 2Q0SA 4D97A 4M1YA 3OLQA 3VR4H 4HDMA 5DLHA 1KZ1A 1UFOA 2A86A 2YJ4A 3MT8A 2EXBA 2ECQA 4I66A 4UU7A 3BMQA 2ID7A 2ZT5A 4OJMX 3P7UE 3TRJA 2OLKA 1J42A 1TYZA 1PF7E 1XA7A 3EUWA 3C7CB 5EWJA 1C7YA 5ULLA 4NEED 3NUZA 4HPJB 1GHIA 4OHWA 3IBYA 4LMRA 4CHTB 3U6SA 2PE5A 1KRWA 1E0DA 4MVWA 3CUTA 1IWBB 3P9IA 4ENWA 3GBPA 5C53B 4R68A 3JTEA 5E2EA 2QM8A 5LIRA 2B5VA 3BD7A 3TIVA 4B7AA 5EKSA 3I2KA 1GZHB 4LFCB 3TQTA 1XTJA 3FHOA 1L5FA 3MJCA 1Y42X 3GN1A 3CLHA 2ZCUA 1AQYA 3L26A 1XZLA 1Z5ZA 4PN3A 3I5MA 3LXUX 1VYTA 3TQQA 3KV1A 1WIVA 1MLDA 5DSTA 2W1TA 1PQYA 4BNLA 1ZMUA 3ZDCA 4ETWA 4MCJA 3NGLA 4J1SA 2M5ZA 5A4FS 3QVLA 1JPUA 1LKZA 1ZM4A 1IKIA 4LHEA 4PNZA 3SCZA 3TL4X 4QOJA 3NDJA 2X19A 5FSPA 1EDEA 1O6BA 3B53X 4IH4A 3IIJA 1UJ4A 3MYRA 3LDGA 1F9IA 1RJ9B 1FF9A 1TLXA 3RIGA 2IGBA 5J63A 2PKRA 2F1OA 4CEHA 4BMDA 3UT5A 3G5TA 2NQ8A 1G0NA 3TQCA 4FGSA 2B7CA 2IZ1A 3GX1A 4A8PA 1GKLA 4TM8A 1I32A 1JALA 4IOKA 4D4IA 1TX4B 5CNJA 3AJDA 2XDWA 4KE8A 5BSUA 4BVFA 4OQIA 4KX9A 4KK3A 3S44A 4FYMA 1RYNA 2BGTA 4MLDA 2YWXA 1TMGE 1OROA 1Y9DA 5CLJA 1GU7A 4JLUA 5DCWA 2E1RA 2BTQA 1SJ9A 1ORHA 2QAJA 5FA5A 1UINA 2ARKA 1RCTE 1UF9A 4I36A 1NF8A 1I7MB 3BUSA 1Q7GA 1NT4A 3IX4A 1YHNA 2CHQA 4MKRA 1JKIA 1SCJA 1YZKA 3Q8KA 3SDBA 3QVGA 4ZU6X 4LF9M 3UHFA 2H1HA 4EGQA 1QYDA 4CMEC 4OSOA 3I6YA 5D00A 5F77A 3ZEIA 5AVKA 4OV6B 3E7DA 4II7A 2QHXA 1Z2OX 3LT5A 1QCDA 2Y05A 4P32A 1FQGA 5DYIA 2XLCA 2MSDB 1ZHHA 4JSRA 1WXWA 3O4FA 3EZYA 2DFPA 4FOLA 5HQTA 3L0ZA 5DOZA 1XRQA 2RH5A 2ZYUX 3QIAA 2CV1A 2OCDA 3SQDA 1XU4A 3QITA 3GD5A 1S2GA 1YZFA 5E7IA 3LQ1A 2OL4A 4EG7A 3UJ9A 1FXUA 2ZYGA 3PDUA 4G26A 1Z07A 1IQ0A 3D7SA 2Y1GA 3GH1A 5F21A 4PZCA 4Y6LA 3RTCA 1QVAA 2B99A 2B82A 2Y2GA 2D1SA 3LI8A 2NUTB 3HHEA 3O3OB 3V97A 4BEJA 3FZGA 4RX1A 5BMVF 4NS1A 1KWGA 4I99A 4HH3A 3QOXA 3H5WA 1OXSC 3P5BA 4TMWA 3ESDA 1J70A 2A5YB 4B4OA 3IESA 1THLA 4L2LA 3NPMA 3RSSA 1JLRA 4HLQB 4N0PA 3VH2A 1M72A 1OZHA 2Q1UA 3DO1A 2LXEA 2IXGA 4YUWA 5TB5A 1YOVB 5J9FA 2E0IA 1JHPA 1QJ4A 2WVGA 4K0RA 4OFWA 2ENWA 5DKKA 5F68A 2QRGA 4WZ5C 1QFXA 4KYVA 5CW1A 1ECJA 3RYHB 2FKNA 1YTUA 1K8QA 4B1FA 3Q8MA 2QPTA 4J16C 4KPEC 4B5KA 1DUSA 2J5BA 3IAM6 5IKXA 2X1LA 2G80A 1KMHA 2J1LA 2C3MA 1ML3A 1EGMB 1JIJA 4C05A 4WK4B 4XGRA 2FMTA 1ZOOA 3GGDA 4XB2A 4OQXA 2Z5FA 4HQRA 4NTZA 4L6CA 2HK8A 3KRTA 1RM3A 5TQVA 1RGZA 1ZJYA 5ITZA 2BF7A 5B3AA 4JHLA 2G1JA 4L4RA 2GCNA 3W0LB 1RYBA 1OZFA 3BRWD 1TM4E 1E7MA 1QIGA 4Z9YA 2GBGA 3KSXA 5D5PA 1N0IA 4QUBA 5JRDS 4KHPM 2V2FF 1GG2A 4AW4A 1TGUA 3RAGA 1GRNA 3PHBE 1LQUA 3IVMA 4AJOA 4Y2VA 2QAIA 4EEUA 4HP9A 3G6WA 1JUDA 3AI1A 1GYRA 3LHKA 5EE9A 3PL1A 3IAAA 3BG5A 3OCUA 5EKTA 4KGXA 2I1QA 5C8ZA 1IOUA 3G1TA 1GW6A 3S2UA 3SC2B 3NBFA 5CYPA 5FLEX 4AIRA 5LIPA 4DT1B 3UMSA 1QGAA 3GLFE 5HD3A 5DBIA 3L06A 2PA3A 2E4ZA 3G7UA 2GX5A 2XCQA 3H9GA 3JVEA 1J8YF 3TO5A 2GEVA 2PWBA 2JKVA 1GPBA 4GRAA 4K9KA 1DKNA 4FHDA 4LXHA 4MLCA 3INRA 2I87A 4HEA1 1JIXA 5EL0A 5EMMA 2Q5HA 1QV7A 1V16A 1YMSA 1UP6A 1JVSA 4ALJA 4GPD1 2ODAA 1MB0A 1CXZA 4RJLA 3WIOA 2WT4A 2OXRA 2NTNA 4FS3A 4J0DA 1NQWA 3W6OA 2ZM6B 2WF8A 5DHFA 2D2XA 2X0IA 4UEJA 3FHTA 1CB0A 3W90A 5FFNA 3I12A 4RF3A 1E1YA 3BFVA 2Z5VA 4RC9A 4BWVA 1RHQA 2E48A 1VLVA 3IS2A 4DR3B 3A9UA 4KSBA 4ZI2A 2MSCB 2BV3A 5ITRA 2L7HA 2IUFA 4LNAA 3DL7A 3EXFA 4QQNA 3WWCA 1UBTS 2D74A 3OE7A 5A02A 3UHOA 4Q9AA 2O3JA 5AM5A 1N2BA 5KDOA 1WLYA 1E3LA 4PANA 4P9NA 5EIEA 2EFDB 1PT5A 3EFHA 1SHUX 2E21A 4JEIA 2HDQA 5LQJA 2W37A 1W6UA 1XD2A 2A9RA 3O1JC 3RT1A 3H5AA 2UXCM 4PWYA 3EAGA 4GMGA 4ZAXA 2A49A 3VHXA 2XT6A 1CNEA 1HNZB 5GHXA 3UUGA 1Z0KA 1CEYA 3DVLA 1GTSA 5DYTA 3OWXA 2D3WA 4LRSB 3BCHA 1XQVA 4UVEA 2GM9A