2XPYA

Structure of native leukotriene a4 hydrolase from saccharomyces cerevisiae
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
632
structure length
628
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEGKNKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords LEUKOTRIENE A-4 HYDROLASE
total genus 216
structure length 628
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpyA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpyA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpyA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpyA01
4XO3A 3B7RL 4XNDA 3QJXA 1EZMA 3FUDA 4FYSA 1FJOA 4D9WA 4KXBA 3FH5A 5L3UE 3MSNA 3NQXA 3CHSA 4R5TA 3FTYA 5JXNE 1Z1WA 4K90A 3FTSA 4ZQTA 3QH1A 4MS6A 4MXJE 5LIFE 4GERA 5LWDE 3MSFA 4M65A 5K7TA 1FJVA 3EBHA 4RSYA 3DO0A 3FTVA 4XN7A 3T73A 5HQDA 4KX9A 3EBGA 1Z5HA 4GAAA 3CIAA 4N5PE 5TMNE 3FHEA 1FJ3A 5A3YA 1QF0A 1QF1A 4XO5A 4XMWA 4TLNA 4R5VA 3NN7A 1KEIA 3FUIA 4TLIA 4XN8A 3Q7JA 1BQBA 4N66E 3T2IE 4FYRA 3P7PE 4ZX6A 5LHDA 4Z7IA 2XPZA 3B7TA 4PW4A 3FU0A 5TLIA 4B52A 2A7GE 4P8QA 1NPCA 5C97A 3FB0A 5FWQA 5LDSA 3KEDA 3CHOA 1TRLA 3QH5A 3U9WA 4PJ6A 4QUOA 4XNBA 4RVBA 4R5XA 3EIMA 3FUEA 3FU3A 4OI5E 5JT9E 1TLPE 4KX7A 5FSSA 4K5LA 2VJ8A 4MTWE 4TNLA 3SE6A 4K5MA 4KXCA 4J3BA 3DO2A 3FU5A 4QMEA 2TMNE 2YD0A 1FJUA 3FTZA 3CHRA 3P7SE 4L2LA 3MS3A 3DO1A 5K1VA 3FULA 5FSPA 3TLIA 2G4ZA 1PE7A 5J6SA 5FXNA 3F2PA 4ZW8A 4XN1A 3SSBA 3T74A 2R59A 4R7LA 5DLHA 1SQMA 4ZW5A 2HPOA 2DQMA 1LNBE 3QGOA 4MZNE 3B2XA 3FXPA 1LNDE 4ZW7A 3FBOA 3P7QE 4F5CA 4FKKA 4XNAA 3P7WE 3DBKA 3FV4A 3P7VE 3T8GA 3B37A 3Q44A 4XN5A 3T8HA 2WI0A 1TLXA 1KJPA 3B2PA 3NQYB 3FUJA 4D91A 5JS3E 1HS6A 3Q43A 3FUHA 3B3BA 4QHPA 4Q4IA 1Z9GE 3P7UE 5DLLA 7TLIA 5L8PE 5DPEE 4FYQA 1L3FE 3FGDA 1HYTA 1KTOA 5BPPA 1ESPA 5AENA 5L41E 5AB2A 3B7UX 3T8CA 2DQ6A 3MDJA 1TLIA 2HPTA 4ZX3A 4JBSA 4XMUA 1ZDPE 4TMNE 4ZX5A 4XN4A 1PE5A 4KXAA 4Q4EA 4E36A 3T8DA 4KXDA 4QPEA 1KR6A 3FUKA 2XQ0A 3QNFA 4XMXA 2TLIA 1FJQA 1FJTA 4NZ8A 1FJWA 3MSAA 5LG6A 3T8FA 4X2UA 5JVIE 2VQXA 3B7SA 3FUNA 1QF2A 3B34A 1PE8A 4ZX4A 3NQZB 5DYFA 1OS0A 5AB0A 4MWPE 4PVBA 4OU3A 4H57A 3T8VA 4K5NA 3P7RE 4WZ9A 3CHPA 1GXWA 3FUMA 4K5PA 3FXSA 4NAQA 5TLNA 5CU5A 1GW6A 1U4GA 4XMZA 3TMNE 1KL6A 1KROA 3FORA 3EBIA 1LNAE 1KS7A 4N4EE 4XN2A 3FTUA 5DPFE 1TMNE 3FH7A 4DPRA 3FVPA 3N21A 4XMVA 4PU2A 4ZW6A 3T87A 4XMTA 3PUUA 4ZW3A 3DNZA 1THLA 3ZI6A 4FKEA 3FU6A 1KJOA 1H19A 3T2JE 8TLIA 2WHZA 3F28A 2TLXA 3LS7A 7TLNA 5JSSE 4FKHA 4FYTA 5FSJA 3FTXA 3CHQA 4OW3A 4HOMA 3FCQA 4K5OA 3FH8A 1Y3GE 1LNFE 1LNCE 4MKTA 4QIRA 4XN9A 4XO4A 6TMNE 8TLNE 4K89A 3T2HE 6TLIA 3FUFA 2GTQA 3FLFA 1LNEE 2ZXGA 4KX8A 1KKKA 2XPYA 3FTWA 3P7TE
chains in the Genus database with same CATH superfamily
1U8MB 4PJFE 3FT2A 3ATEA 3T5WA 2J8UE 3MA9H 1EJ8A 5LWDE 1RZJH 1E3FA 4HETA 5E2VH 4UBDD 4M3OA 3MRKB 4HH8A 5E1IA 3MTXA 1Q8MA 2EE0A 3DPBA 3MUUA 5K9QG 3KLDA 4ZTEA 4LLDA 4YH6A 3C6LD 3WKPA 1RJCA 3O41B 4Y19E 3U9PL 1I3UA 1CLOL 2WQ6A 1HF8A 1BCIA 2FJSA 1T22A 2OX5B 5JMND 4PS3A 1IGIH 1MFUA 3UABA 5KBKA 4KTDH 3I75B 1U3YA 5M95B 1MH5A 5CZRA 1RURL 3D2TA 5JJ7A 1E8XA 4HWZA 4M9OA 5D7JA 4D0DA 3SPVB 4CRPA 1TZHB 5CNHA 2I27N 2A6JA 4G6AD 3D0VB 4N0FA 1LEGB 1PGRB 4Y4KB 1T20A 2Y5TB 3WIHA 3STZB 4JQIH 4LVNC 5JA8B 2P7TB 1KTRL 5HDOA 2EEBA 5LBVA 2B0SL 2G4ZA 1XGQA 4JG0L 4MBOA 4TF4A 3ZR6A 4ZW8A 3SSBA 4F7MA 4UOQA 7FABH 3HKFA 5BXFB 1K8IB 3P0VH 1LYQA 1XH1A 4K7PY 1BX2A 2IH1A 5JMRA 1YY8A 2HKAA 2X4NB 2SODB 4Q2ZB 3OPZL 1EBAA 2X0UA 2R7EB 3PWVB 4YHKL 1MVFA 5KW9L 1IGTB 5GGRB 4CJ0A 1E5UI 1IAMA 3WN5B 3VXMA 1JTTA 4ZOCA 1CE6A 4MA8H 3L4ZA 3FGDA 3EYUH 5DD5H 3RZWA 5KWYC 4J5VA 1F1AA 1DL7H 2XHNA 3PGCA 2DQ6A 4DN4H 4KPHL 3S3DB 4WW1A 3SDDC 5DHYA 3VRIB 3SDXA 4NHUB 2PWGA 2A1WL 1ICTA 4MMXC 3PWLB 5I5MA 1QBQA 4OV5A 1U4EA 2W07A 5CP3H 5BW7C 2ZX9A 5IMOB 1U42A 2OL3L 1MRDH 5ISZA 4HVBA 4TULH 3BO8B 3MO1A 5GRWA 4YLBA 4G83A 3UXFA 5AW0B 3TXMA 2BIHA 3CZKA 3IEAA 2QVKA 3P0YH 2LFGA 4LVOC 2MFNA 1GVIA 1D5BA 1RK7A 3MLRL 3N55A 3OAUL 5C08B 4ZMWA 3NCWA 4HIXL 3NQKA 3DSFH 2BC4A 3GSNH 5DC0A 5CINH 1UVQA 3OV6A 1KIPB 2NYZA 4YXHL 3ULVH 5JPMA 3DTDA 3OAZK 2WNGA 1G7QB 1U2YA 5JQHC 1CLOH 4H26A 4JPVL 5KSBB 3K2UL 4A7SA 4U1SB 1FZKB 2EE2A 2IIJA 4PBWD 3CSTA 2FH8A 3V79K 1IC5L 5DR5H 1IFRA 4CCAA 2Z8RA 4OKDA 1WWWX 4F9LC 3K3QA 1HH8A 4I6EA 1J0JA 3IFOA 5BJTB 3NB2A 4U8YD 4JRXE 2VDMH 5L2JB 2O6PA 4QF1A 5IKCA 2WPGA 1BAFL 2CHDA 4U1IA 5I16A 2EDMA 1FG2A 1BZ9B 1WGVA 5FINA 1DO6A 4PGZA 1USZA 5BZWB 2PW1B 4AUYA 1BBJB 3VVMA 3WDJA 4UZSA 2YO3A 1EJ6A 2X4PA 5A16A 4M03A 1MRCL 4H7YA 5G4OA 4XP9H 3VVVA 4OFYA 4NHCL 4WFHD 5K9JL 5JXEC 4GAAA 4ZT1A 4PGBB 4OCYH 4XX1E 5DQDL 5EX3A 1RK1A 1NUDA 1DCLA 1OB1A 3NIDF 2AJZB 5JR1L 3MBEA 1HHGA 4IQHA 3C60D 3NK3A 3WUWA 3BEEA 3EYFB 2FE0A 4HDIA 4BK5A 5K9OA 2ZCKL 1PAMA 4NP4H 5KYYB 2QQQA 2J73A 4W6WB 4TSBL 2QV4A 3EYUL 2BSRA 3IAPA 4GW5B 5FF6B 3QIUC 4WI8A 1IE4A 1WZ1H 1XCWA 1JPTL 3BP7A 3DOHA 5C07B 5C0BA 1RHHB 2ETBA 3D3VE 4ILGA 3GSQB 1M6OA 3ZGQA 1AFVL 4TVPD 4G8GA 1ONOA 1N68A 5JOEA 3T74A 2GBUA 2WLHA 4GUPB 2OX5A 4ACPA 4WF7A 1CD1B 2Y0SA 1BJ8A 3O41A 4E9WA 1T1XB 5C0AE 2N3JA 3ARRA 3PREA 3EJYC 1AHWB 4L7TA 1H3GA 2FO1E 2W94A 3SODB 3C60B 4ZSOB 3O6KL 4JDVA 2FEZA 3B3BA 2R4RH 4OGXH 5CJ8A 2V2XB 4AQZA 1HYTA 3V6ZA 2P7TA 3B5HA 1I8KB 2PL2A 1E6JL 3WXWL 5A2CA 5HKPA 2I9TB 1YUHB 5JPNA 4R0LA 3LHPH 3Q8CA 4BCXA 4GTMA 3UL4A 1HCZA 5D7LA 5FB8A 1O1RA 3NAWA 1QBBA 4J27A 1SA4A 3QRBA 3D3MA 4S1SH 4R90H 3P4NB 4FHBD 4OV6F 1NIDA 4JFFA 4UTBH 4Y8DC 1Y6NR 2YFOA 4PJEA 1Z9NA 4Y1AE 3E38A 1JHTB 1SZNA 1ZHLB 2E7CA 3GJEA 2BP8A 1K72A 1BAFH 5I1HH 3QFJD 3APMA 4PJHF 1DEEB 1JHTA 4XPHH 2Y1CA 2HLAA 2OCJA 3DX9B 2O30A 4NKIL 4HB5A 5F44A 4Y2DD 1LE9B 4ZS6C 3T71A 3FORA 5JHDB 4ZO7A 3HR5A 3DGGA 3G2VA 3V7AG 3LY6A 1UKQA 3FU6A 4BY6A 4JFWA 4JO2H 4KXZH 1T4KB 1JPSH 5CN3A 2DYPB 3QJTB 4EBAG 4MVBC 3VH8G 3ULVE 4HFWA 4PTUA 3BKYL 2DH2A 4LSQL 4AJ0A 2HR2A 4POYA 4PVNA 4L23A 3MO1B 4PREA 1FC1A 3WAJA 3FUFA 2GHWB 4HS3B 2BZDA 1DVZA 2BHYA 4IRSB 2LO6A 3TBTB 1I1YB 4W9LC 3QDGB 3KLQA 4Z1PA 3NOGD 2FL5A 5D1QB 5EC2B 3FQWA 4RWHA 5GGUA 4D7BA 3C6LC 5HTSA 4BE5A 2GUOB 3V4PH 4HRMB 3TA3B 1BM3L 3BAEL 2E5EA 4JGUA 2XX0A 3PJNA 4LEUA 1MLCB 4YIQB 5KVGL 2CGYA 4JRYA 5CMYA 2I07A 2R2HB 3WDIA 1WGOA 5E6IB 5EULV 1BLNA 4N0YH 5KBLA 5J4MA 3UTTB 4V1DD 2YAOA 3MV9B 3G9AB 4HCIA 3WSQH 1I8MA 3Q6FB 3EFFA 2HVJA 3QZNA 4Y16A 4CC4A 4PBVC 3WAKA 1H6UA 4NM8H 2A73A 5MERB 1NL0H 1IGMH 2WLIB 1DQKA 4LEBA 1AZZC 1E6JH 2PO6C 1A4JB 5J1AA 1NWPA 1TZ8A 3GDBA 3K8MA 1XAKA 3L08A 4P9HH 5KYWA 2OEWA 1A6WL 1JNHB 1WHOA 4IMKC 1NICA 4S1SL 3X1GA 2B1HH 3IVKB 2BW4A 2Q7YA 1ACYL 1JZIA 3J8F7 3KL3A 3OHXB 1KXHA 2YEVB 4ZTOH 4RZKA 2GPZA 3ESKA 3MKGA 3ARDA 4HZ1A 1PAQA 4TS6A 1CI5A 1VAHA 1SA5A 1C5CL 4ES8A 3G2SA 2CDFA 4NC1C 5JW4R 3UPRB 4YEEA 2BK8A 3PRZA 2NYKA 4K15A 2WP3T 5I19H 5BJTA 3DLQR 3HMWL 5EN3A 3CHMA 1V27A 3LH8A 2ZICA 1NDMB 4X98B 4L29B 5HDQH 1NFIE 5KANG 4HBCH 1CLZH 4Z3EA 1BD2A 4MSWB 1SOKA 2JH2A 3L17A 4KXDA 5AVTB 1CFSB 2H41A 3QDMA 4OBSA 4R84A 1J05B 3MNWA 3R7QA 1A7RH 1UOVA 4WWKC 4OUUA 4S1DD 1UJ3C 1CDYA 3N06B 2VN7A 4EQ2A 2QHRH 1N94A 4UDTA 1NTDA 4UZUA 4JDTL 1LO2H 3CFIC 4YHPB 2HVKA 4ELKB 2JI3A 3V0GA 1U91A 2Y36L 3U83A 3SPJA 4BFBD 4A1RA 3VJ6B 1BM3H 4D8PA 3ARSA 2C9PA 3ZBMA 4JG5A 2XY1A 2UZXB 4DEWA 1FQ9C 2OP4L 4HBQA 3DPBB 3PP3H 1HHKA 3EHMA 4NKMB 5HVHC 3SBSA 1IBHA 4WV1A 1BQHB 2A7BA 2WQ7A 1RL1A 2FJHA 4HGWA 4OFKA 4XPFL 3LKOA 5G4MA 4PJ8B 4EI6A 1FHGA 1UD4A 1ERNA 4JHZA 4MNHA 4N1CA 4ONGH 3P4NA 4Y5YB 1KN2L 4R7NA 2NSQA 2X2YA 4ZOEA 1K8KG 3D9LA 3LQZA 4GG6E 4RMVA 4AVXA 1NL0L 5T3XH 4CU8A 1BPLB 5C0CB 2KCVA 1ONQA 3CDYA 4ABWA 2UUDH 4X7DC 3IJSB 2GHZA 4LG6A 2L0TB 4PRIA 3EJCA 5JHDA 1AJ7L 2K6YA 3LN4B 1A6WH 3IGAB 4PW3A 4WUUA 2Y6TE 5FHBL 1AR1B 3TBCA 2WB7A 5SWSA 3IDXH 4O5LH 3WN6A 5IB4B 4KZ0A 3G6AA 4IMLB 5AOMA 1RUAL 4EZKA 1C5CH 2DMHA 3P4OA 3QDGD 4CBZA 4TNVK 5I71C 2V17L 5HYJD 1DLHB 2L3BA 4RAUB 4WI9A 4Y2NA 4ZAKC 1J8HB 2JD2A 3CUPB 4OZHB 5F0JB 3HMWH 3ZUVB 4HKBA 2ATPA 3U9WA 3JWDC 1EERB 3QQ3B 3WG7E 1J8HA 4HD5A 2XZQH 2ITDB 2X4SB 3IN0A 1A6UH 3SE6A 3CC5B 3WO4B 2ZKHL 4YHLL 1CLZL 4X7EC 3MV8A 1S9XA 3V7MA 3SD5A 4K3EH 3TF4A 3L16A 2AANA 1KFAL 1WUNT 2NSZA 4G1EA 2F18A 2DQMA 3DO4A 4WJG3 2MSPA 1AGBA 1KJ2H 3FBOA 3UAJC 4BELD 2E4TA 4U63A 3CZNA 4IS6A 4HRNA 1J5OH 9PCYA 2ENSA 4JZJC 1JNLH 2NY5H 3GUFA 3PGFL 5C0JA 3UACA 1QLEB 2GTWA 1SGKA 1YEFH 2PW1A 2AERT 2VDPL 2WLYA 2B16A 2UXFA 4WJKB 1OAUH 3U48A 1NP7A 1N6QH 4HFUL 1P4IH 3ZKMC 3BSZA 2BVQA 4Y4HA 3RU8L 3IU3B 5MEQB 2JXMB 4RFEB 4XPFH 5SWSD 4KNUA 4XI5C 4LHUB 5L9DH 5K1NA 1T03H 2BO0A 4B0ZA 3MPCA 4OJCA 3TPUA 4EO5A 3PUJA 1CDGA 3FCTA 3QHTC 3OKDA 1MHHB 5BS0E 1HE8A 1G7QA 3TWVA 1A4BA 2TRHA 2O26U 2YR3A 5A7DB 4MB4A 2A5UA 3S7GA 3CBRA 2PCYA 1INEH 2HJLB 2Y2YA 1CO1A 5D7IB 2E6JA 5KYXB 5DZPA 4IKJA 4Z7NF 3VNZA 3MV7B 2XVBA 1OWMA 1N0XL 3MC0A 2QVIA 1CD1A 2A6KB 4ABNA 3QEHA 1RXLA 1FO0A 3QDMB 2LU7A 3NP4A 4M8QB 4NIKB 1KN4H 4MSWA 4L5FE 5HHMD 4UTAA 3H9SA 1AHMA 2ZP9A 3MGBA 3ANNA 3QBTB 1PDKA 1QFHA 2YJLA 1FFTB 1O7DC 2P8LA 3IDUA 4GG8A 1EGJL 2R2LA 1D5XA 2BMKA 1MEXL 1MREL 3P4MA 1LDPL 3U4BH 3LV3B 2XZQL 3KLLA 4K3GA 4NRZB 3E2HB 1B0RB 5K5YA 3MYVA 2HTLD 4Z7QB 4WHTA 1QI3A 2K9FB 3B7YA 4ZMYA 3FO9A 2ILRA 3L5WB 3TOPA 5ANHA 2YAMA 3V4UL 3MREA 4GO6B 3VWJC 1KLXA 4N0RA 3T9KA 2QQNL 5CZXD 4AYEC 5C0ND 2AJXH 1P7QB 4MLIA 1MPAL 4G1MB 1J9CT 2MNJB 3SDYL 5CIPH 1BQBA 2NY5L 1G6RA 4N3TA 2HT4D 2YLKA 1KJVB 2WUCH 1D7FA 1TCMA 3OPUA 4FS0A 5C97A 5LLIC 4AYDC 1JFQH 1RPKA 3QIUB 4BUGA 5F6HJ 4RVBA 5ENSD 1P6FA 1RZ4A 1X44A 5FYLE 4JD2G 3EYSL 5J13C 1QPKA 1S7VA 2CBPA 3ASWA 3L7FB 5BZDB 3TBWA 2BSTB 3K6SA 4LNBA 4E9VA 1A21A 1JVLA 5EEYA 4KI5F 3OGCB 3DETC 4KRMB 2VAAA 3ZYZA 2IY0C 4KBQA 4IBLT 5DHVH 3U7WH 1UH4A 4N2EA 1Q9LA 2IFFH 3ECWA 4YO0A 3UX9B 1TEFA 1ULVA 2EYTB 3JV6B 3KPLB 2I1KA 1FL3B 3MACL 4TUOA 5IK3B 4DGWC 3US0A 4B9PA 1SDAB 1Q9LB 3BSGA 4X8JA 2GSIA 1JWFA 4A63B 2ARJA 4KK5D 3DWTA 1U2HA 2JKSA 5DPEE 2I60H 5I75B 4Z7WE 5AW5B 5HHXL 1ESPA 3N50A 3ZDXF 1KY6A 1GAFL 2VAJA 1L0XA 3SFYA 4N0CC 2WQRA 5DZJA 4NQDE 5IR1A 3MMEB 2LT9A 1YEEL 1QUNB 3FCSA 3LKNA 4OCWL 5T1MB 3S3JA 3HE7D 2CALA 4NQDB 4LHJB 3T0BA 3WMPA 1VADB 4OQTL 5C08E 4LAJH 3VXRB 4EN2A 2ADYA 1Z3YA 4PJCE 1T1ZA 4AIXA 2GC7C 3V2XA 1NC4B 3H85A 3VGDA 2FD6L 3BH4A 5KYUB 4FFVD 7TAAA 4OD1H 1RPQA 1MFBL 1CWVA 2XFXA 4AL8C 3JTSA 4BERA 1AVAA 5HYEA 1YHPA 3LKQB 1XIWB 4NO0D 2F7PA 4Y4KC 4LLMA 4WIQA 1YEGH 3VFVA 5E8OA 5LBGA 1KROA 3ZE2B 8FABB 4QTIL 4HIJB 3Q2NA 4ANWA 3DBSA 4UOW0 1Y6IA 3GI9L 2C9QA 1JUFA 2Z92B 4QXUL 5AW2B 2P5EE 1XEUA 2HAZA 4PY7A 2LOEA 1MWAL 3GMPA 1HCYA 3DRAA 2P5WA 4N8CH 2HFTA 2NY1D 5HHPA 3UZEA 1ND0A 4ZJ9A 4Z77B 3NCXA 3O8XA 2A9ML 2GIXA 3E1F1 3RY4A 3GSWB 4PB0L 4KX8A 1CFTA 25C8H 2MPVA 5HBBA 5BV1A 4P3CH 3ZL4H 4GPMA 3C6LB 4MAYA 4G80A 3KPSA 4KK8C 2VIRB 3NABL 2MKLC 4IJ3B 2XRYA 1UWXK 3FTSA 3N41F 3ZTDC 3ZT7A 5BMFH 3DV4B 4NUPA 1AKJB 1OGAB 4R4ND 4Z95L 1DUZB 3IFNH 4DGVH 5A2IH 1Q0EA 3P9WB 4AYID 1XGRA 2NNXA 5A3YA 5I1DB 3DDGA 1LVEA 2EKSB 1KLGB 2NY7H 3SGKC 4N66E 1CF8H 2VLRB 1SC5A 3VFGH 2TSBA 3MJ7B 3FU0A 3OAZH 1UWEL 2AC0A 2QSVA 1NL4A 2W1NA 4QRTA 2YAQA 4F7EA 4ELDA 1NCIA 5EORL 3UO8B 2OR9H 2A4ZA 4M6AA 2GI0A 5KUKA 4EJ1C 2QQLL 2ZCHH 2BP0B 3H3PH 5CEAA 4W9DC 5DI8A 4CRWA 1LK3H 2GJJA 4NZRH 4XWGL 4J8SA 3SGEH 2AEOA 4UNUA 3VMPA 4XCCL 1VFMA 4L4VD 5AZEL 3ARBA 4Q74A 4JO3H 3HUJB 3OJVC 4MXVF 2B2XH 1P4LB 4RG9A 4H7VA 4TTDD 3BH8A 1AQKH 2EC8A 3DBKA 3KXFD 3DA0A 4Z7AA 4DOHB 2JD1A 5BQ7A 2HRGA 4FXKB 2JKWA 3DUUA 5EO0A 4ACTA 3DX1A 4G1TA 1JHKL 1JCQA 3RU0A 3L6AA 3HE6B 4LHUD 2EIEA 3LV3A 1EUTA 5HHOA 3NCYS 2B7DT 3B9KB 4Q8BA 2O61A 4RWYH 1TLIA 2BS8A 5EO1A 3RC3A 1TTAA 3EO0B 4LRIC 5I1IL 3UBGA 5IJKA 2C5ZA 4HLZH 3Q7AA 1A7NL 4QRAA 4WI2A 4DPAX 1Z5LB 4KI5E 2OKMA 2Y7MA 2Z8VC 1JPLA 4JE0A 4PTTA 1SMAA 3GWJA 4YZFF 1J88A 3CUPA 4NQVA 3H7LA 4U7MA 4NNPH 2OCFD 2ZUSA 4XT1C 5ICZA 1E67A 1JWSA 2NQCA 4J2QA 3S8FB 2FO4B 5JW5B 4D0CA 3ZL4L 1JDDA 3SE9L 5MP6H 2F53B 3QDJA 4M48L 4UM8A 2XQBH 2QKIA 5ITBH 1XAUA 4K5PA 5GS0D 4H7XA 4M02A 4LFHD 1AGEA 4LDEB 4TUJA 5MERA 2ESVD 3T4YB 1IXVA 1QZ2A 2X7LB 5E1GA 1P9MC 2R1XB 1SN5A 5EX0A 4FCHA 4H4NA 4G2VA 2IDTA 1A4CA 4MD5B 4UNVA 2FDBP 3ETBF 3G08A 2OZ4A 5I1JH 2CJUL 1NDTA 3DWLG 1PIFA 4ZPVB 5JHBA 1UWEH 3QS3A 4XPBH 1BFVH 4MAUL 4NBZB 5AIJA 1ANUA 1M71B 1D6VH 4BWRA 1UCBH 4QXGL 3VD5A 1UJTA 4HJ0D 1ACZA 4UILH 5DHMC 2ICWJ 2ICEB 4ODBD 1S2EA 1UHVA 5TQ2H 3NIFF 1EF1C 3ASOE 4ODSL 5ISZD 4YR6A 2XGSA 1WAEA 3QUXB 3GMOA 4N2LA 3ILQD 3AQDA 5TDOA 2IG2L 5JJ6A 3ZE1B 4QT5A 3GXPA 5K7TA 3NRQA 4E0RA 4I9EA 4JFDD 4X6FA 1ZLWK 4JCLA 4MJIE 4PJAE 1DN0A 1MI5D 1MIEL 1ZSDB 3NZSA 2EUXA 4F8LA 6TAAA 3MRMB 4KXBA 2WM0A 3AGVA 4XN8A 3S48A 4LBEA 3WY2A 3O3UN 4DX2A 3FDWA 2V2TB 4OI9A 3L4CA 1MG3C 4KKQA 2YPVH 3KD4A 3L9YA 2X6VA 5BV7B 3RG1C 4WEBL 3JWDL 3ZU8A 5C3IA 1D5MA 3EYVA 1HQ4B 1A7QL 2F9BT 1G7HA 1IBFA 2BY1A 4ZFZA 4FG0A 2R69H 4Z3TA 4JEHA 1QAWA 4YHNB 4K5AB 3OF6A 1YYHA 1RUQL 2RALA 3T5XA 4P2RE 3TX4A 5I1LB 1X5YA 2W65B 3ARFC 3ZDZB 2UXTA 1LO4H 3WUWB 5LVEA 4KQ4H 2A7OA 5GZOD 5IM7A 3G5XB 2BWDA 4N2SA 2I9LA 2LQRA 3MV8E 2E4FA 3CNKA 4P5KA 3OTTA 1QBMH 1ACXA 4JB9H 3FO0L 3O2WH 2Z7WA 3FRPG 4I4WA 2XWBB 5T1LD 2QV2A 3ZE1E 1J9RA 3VCLA 1S8DB 5AUMA 2YMXL 3DX4A 3O11A 3R9MA 3ASFA 3ZQ9A 5JAZA 2YD6A 2QADC 3CFCH 5HI3C 4AYBA 5KYNA 4OD2B 4NLAA 2H6PA 3MHZA 1E40A 3CWGA 3WLBB 5TFSL 3L5XL 2BKKB 3U6RA 5D7KD 3U0PB 1HFAA 4DFHA 4G2AA 2PQRA 4P49A 1Q1PA 3WY3A 3FT4B 4QRUA 5ERWB 2VLJB 1OHQA 3PJSA 1MFMA 4MAUH 4OJFH 4KFMA 2DBLL 1M7IA 1OOWA 4G7QB 4NJ9H 3INUL 3WD5H 2EKSA 1IKFH 1HKFA 3ET9F 2VR5A 3BWSA 2O6EA 1FO0L 2WLKA 3NSDA 4CDNA 3N1QC 1GW6A 4W6YB 1FRGH 1O5MA 1BZOA 1GIGH 1QRNB 1F3JB 5E6RB 1NC2D 4CAGA 4FA8A 1X9RA 3EH1A 4HIPA 3ZKXB 1UM5L 4R97C 3UTSB 4F57H 3QPXL 5MI0C 1T5WB 4DH2A 1E5ZA 1Q4NX 4I1MA 4RGMC 4WI4A 2F5BH 3VG0H 4YOKA 3TBTA 3HVEA 2YD8A 2WWMD 1PAZA 1SHXA 2VXTH 3BWAB 3C2AH 2VZ3A 2X70B 1RERA 3REVA 3S0PA 3SGKA 1ID2A 2QSTA 1RFDL 2I32A 3UZVA 2VDNB 2EO7A 5CO1A 2VR6A 4FNPA 3CGTA 3HS0B 4NQCD 3S2CA 3UT7A 1DBJL 1I1AD 2WINB 4E9QA 3QJXA 5ARGA 1E9OA 3GZ2A 4HALA 3FT1A 4LSUH 4NIYE 2NNAA 3N1GC 1GSMA 1WFUA 2C3HA 3O2DH 5CSBA 3QXDB 3DGGB 2X87A 4ZSOE 3UJIH 2HX9A 4GU5A 3C5XA 4UT9A 2HH0L 4XXDB 2QPEB 4RQQA 4A7VA 4J0UA 4JFEA 4Z7WB 5B38G 4BT8A 3OJDA 1TU2B 4RMBA 3VYOA 5CBEB 1K5NB 2VLME 1IBZA 4G71B 5IB5A 3JVGC 3NACH 4MB3A 3KLAB 1WAAF 5H37H 2NY4C 5BXFA 1TR7A 1SJEA 4MAYC 4B52A 1TNUA 3WNMA 1AHWC 1FNFA 2JD0A 3D9NA 3V6FA 4F1PA 5DS8A 4R5XA 4FI8A 1SG7A 3UZQA 1I9RL 3EO9H 4GMSH 1MRFH 3WKNA 5JHDD 1UUNA 3NGBB 1MCWW 4PRHA 1QUNA 4QRFA 1VFBB 4B96A 1JZGA 4YDJB 4D0DB 1HKLL 1KBGL 4NP9A 2IJ0C 4P2OA 2AQ2A 4UQ3B 2V37A 4HUNB 3FB5B 1FNSL 3JYCA 3PG2A 1LD8A 5AVSB 1RZIB 1NSNH 1OCWH 1EAPB 5CEYB 2WO2B 2Q2EB 4MDIA 2F8YA 3GIZH 3Q3GA 1FL6B 3GKWL 1FT1A 4DHLA 3MRLB 4FFTA 4FI6A 5DJ6B 1DR9A 2UZIL 2AZUA 2XVKA 5E5MB 3S9DB 3FCBA 3N9GH 3VAEA 1U8QB 1L3FE 3AWFA 4OSUH 2J1ZA 5BUPA 4F7CB 3EYVB 5G4NA 3TIEB 1NIBA 2GFBA 4X6CB 4X80H 4BFIB 4U3XA 1R0LA 1SY6L 3KGTA 5I1AB 2J5LC 3VU2A 1LTXA 3KPRB 1LQSR 2ALWA 3OWEA 5JXAH 2OJEB 4PP2B 1RZKH 2VSNA 1Q0LA 4FFYA 1RZQA 5I2IB 4E9RA 2ADGA 1BBDL 4O02L 4R7VA 1RUML 3ZTNL 3OHXC 2MHAA 3NZHL 1NZNA 4LPVA 4E2OA 2XN9E 5CJQL 1YYLL 2A6IB 5D5MA 5HHMB 3PPSA 5GS2H 2CKBA 2G75A 3NOIA 2EXYD 1DCEA 1KPRB 2QZAA 1C16B 5DGRA 5KG9A 2L6JA 1U8NB 1P1VA 1H2UA 3ML9A 1FV1B 3FO1B 2XYBA 3C08H 3GNML 5T1KD 3ZSSA 1BF2A 3GSRB 4AV5A 5BZWA 4JREC 4MBGA 2OTUA 1DLFL 1R0KA 3DGCR 4N90D 3RKVA 1RV6X 3GBNH 2OMVB 4GLRI 2HMID 1N4SA 3MLVL 4LGPB 3D69B 2QTVA 3B1TA 4OJEH 3HUJF 8TLNE 4ZI8A 2Z31B 5KSUB 1O7DE 5IROA 3KCPA 4M5ZL 2UV3A 3L54A 5E2UH 5IF0B 5T1DH 3UYPB 5F7YC 2CO7A 5FYJD 4HEME 2B4CH 2PPAA 3KPRE 2VW7A 2ITCB 4XMKH 5K93A 2JCCB 4Z0XA 1X7SA 4KJPC 4HUKB 3E32A 4M62L 1S7XB 4NERA 4PR5A 4UM9A 5DRXB 4N9OB 4E42B 4II7A 4M93B 3RWJA 2OW7A 1UFGA 3MA7A 2E27L 4BTBA 1JWSB 4D8OA 1T5XA 4KQ3L 4FA7B 5IB2A 4KX9A 3EBGA 5D66A 1S3KL 3DXAD 3PU7A 4HI9A 3K2MC 1QF0A 4HJUA 5HVWA 2EDYA 3LIZH 1K8DB 1R3LA 2X2HA 1HOCA 4H2AA 2Y23A 4P23C 2VLJA 2QT6A 1CYGA 2WTRA 5DRNB 4KXKB 3IXTB 4ZS7L 2VRKA 1HTYA 4ZODA 5CHEE 1AO7E 2PR4H 4JHAL 4JQIA 5F7WC 2ONDA 4M1DL 3RTQC 2P9KG 1RP8A 3D08A 3S6CA 2HT3D 1YPZE 1Z9SB 2D7NA 2Y7QB 5JXAL 5EZOH 3GB7B 5E5UB 4QDGA 5LAXB 2X4RB 4XN1A 4F3FA 3X11A 3L3DB 3V0EA 4G8GE 2VC2H 1Q1JH 2O4EA 1QSFD 3PWVA 1X4YA 2JCWA 2VO5A 4KDWA 2XRAH 2I9CA 1NJ9B 1A14H 3D3VA 1EA9C 3S5LB 4I2XA 2PTVA 1SUJA 4RZCA 4TXPA 3DO7B 1FGNH 5DRWA 2RR3A 3PWNB 4X4XB 1ADQH 4KKAD 3SKOB 4Y2DA 4JO1L 2WYHA 3QFGA 1DQDH 4GW1B 1YEDB 4U1SA 2XV6B 2ZSWA 1BI8B 2VDKB 3ESOA 3RZCC 3ZE1F 3WO4C 4N1HB 1H9DA 5DC4B 1UWFA 2IH3A 3HBQA 4B9KC 4GQRA 2NY0D 3MR9B 4UBDC 1D5ZB 4OFQA 2NY6C 4QFVA 2YGPA 4W9RA 1TZGH 2KLSA 3W39B 3U36B 4GQ9L 2WLMA 1YEHH 2WMNA 3ILEA 3QEQA 3CX5J 3WXVH 2FYVA 4JFVA 1B2WL 2AI0H 4Y4FD 4QO1B 5EG6C 3RPIB 4LCTA 2XFXB 3OZ9L 1MCOL 3WEXA 4UAOC 4P4KA 4GA0A 3U2SA 3AJIA 4XMVA 2WMPA 4RGNB 2I1JA 5I2IA 3CLEL 3ARFA 5KS9B 2XEHA 2R56H 2OJEA 3P40A 1JGUL 5MHSE 2WZ5A 2CGZA 1KG0A 1I9IH 2VCOA 3CQFA 4GKNB 4QIRA 2C3GA 1A6ZA 2WQAA 3LRKA 1MCBA 4K9JA 5IB1A 4GG6B 2JVUA 1G9NH 1J10A 2XA8L 2LTQB 2WSKA 4LCCB 3GI8H 2BNRB 3MV3B 1KXVC 4KT6B 2PR4L 4GSRA 1V10A 1LJMA 4F58L 5IW3A 1MJ7H 3D0AA 4S1RL 2NXZC 3U66A 4EOWL 3DXAB 3TESA 2IWGA 3ZKJA 1FLRL 1VLXA 1MFEH 2XEEA 5KBDA 4GYYA 4WFGD 4KK9D 3TF7C 1X9UA 1TMCB 3IJYB 2XETA 4GBXB 1L7IH 4MA3A 3MOAL 4P3DA 1Q1JL 4NS0A 5C0RL 5E08H 1HHIA 2UWEB 4NJAH 3TV3H 3QUZB 4Y2OA 4QXVA 5GSRB 4IRJD 2CLRA 5E95B 1AIZA 4AE0A 2EUWA 1A8JH 3CSYA 4AKQA 2WOYA 2DWDA 2UXVA 3B7TA 1N67A 2VDQL 3KJ6L 3VXTB 3NQPA 1DVUA 4AEFA 3L5JA 5GHWH 3ZSTA 4B27A 3U4AA 4Q0XH 5AQ7A 1DQJA 1K9TA 2D0HA 3E0GA 1G7LB 4FMFA 2R03A 1Q9WA 1ZOXA 2ZWZA 2XT1B 4QMEA 3BKMH 3N2JA 3H7BA 3AS4A 1H0DB 3QNYB 3BP4A 3F5WB 4ZUSB 1FL3A 5IK3A 5AEAA 4GUOA 2UX6A 5D7IE 3BD4A 1PSKL 1R6VA 5F8QC 3AU4A 1MCDA 4MQ7A 4UTAH 3UAFA 3EOAA 5IQNA 4CVXB 2LLLA 4PJFB 3QZLA 4XP4H 4KZDH 4H0IA 1P1ZB 1MHQA 3LRHA 1U30A 3RAUA 1OWRM 4EPZA 4QRUB 2Q20A 1MZZA 4HS6B 4XCYA 4YHMH 3UJJH 1Z3RA 2VDRH 4YDIH 3SE4C 4BSVB 4BEIA 4X50A 3MQIA 4GY4A 1VENA 4HU8A 2A77H 1VJSA 4GO8A 1R0AH 1S7TB 2XC8A 2VNCA 4DN3H 4KJYB 2PUQT 4R26H 4XWOC 5E00A 5JHLH 3MRPB 2BP0A 3DURA 4LNVA 4WTZG 4YSDA 35C8H 5KSAD 3EBAA 4BUHA 5D6CA 4MQTB 4L9LB 2IANB 1ZBPA 5AARA 2ZP0T 2YSTA 4W4NA 4P9MH 4ENEC 3EO1B 4X2UA 4XBPB 4X5PA 4OFPA 3BSZH 3IJHA 4U1LA 5KTEL 1VF5C 3FFCD 3VI3F 3AU5A 5C6TH 5ELIA 3GW4A 4FLQA 5JUEH 3GC3A 4NZJA 1H5BC 3MRCA 2B39A 5GSVB 1TF4A 1JK8A 1MLCA 2AJVH 5B8CC 3M1OA 1NBCA 3EJTA 3APDA 1OT4A 1Z9LA 4PRPD 4X7TB 1UGKA 5GGSY 4GCOA 3VXMD 3RWCA 4Z9KB 5KANI 4ZFOA 2UY6A 5GGSA 4ZW3A 1B88A 2YJQA 5F9JA 5D71H 5FUOH 2RFXB 1VEMA 2QYJA 4I0PD 5ICUA 1SJXA 2BVUA 3IRCA 3GSOA 4Z78B 1FCCA 4Q9RL 3APFA 1N8ZA 3FZUC 3S96A 4AXWB 3MKRA 4IHQA 3CXDL 3QEQB 4H40A 3I85A 2EH7H 4Z18A 3RAJH 4OOFA 2YBRA 1D7DA 4ZAKB 4ZK8A 2O5XL 2UY1B 1F3DJ 3JUZA 2DLTA 2EIDA 2OBGA 4J1UB 1UB5B 1SVCP 3DOSA 4KO6A 2Q8BH 1EYHA 3S4SG 1UATA 5F1NB 4ZNEE 1FNHA 4Q69A 4RGOL 4FTVE 1I1CA 4GZ6A 2D0FA 3LVRE 3H4FA 4ZFQA 4P48A 4L0PB 1VCAA 3D07A 2V7HB 3BYYA 1RZKC 4LCCA 1EK3A 2XXGA 1LMIA 5DMYA 3GGWB 3UYRH 2VGEA 3N85L 4V2BA 5AVXB 3AW5A 4YHML 3HFFA 5IFHH 4AIZA 3SDAB 5M94B 2WZPA 2EVIA 2WN3A 3V4VB 1J18A 3AC0A 1N2RB 2YOAA 3AG2B 2G2PA 1RUPL 4XVUC 1R0AL 4HG4K 1ZWIB 3KHQA 4F33B 5F6HI 2GTWB 2TMNE 4OVUA 4MYWB 2V3EA 1K4CA 3UEZA 2YZ1A 3CN0A 4AY5A 4FI7A 5J3HD 3DYOA 3OR7A 1PIGA 4F7CA 4ZUTA 4PBXA 1BFTA 3ZLQC 2DEYX 3LZNA 2LE9A 1BP3B 2ZG3A 4L5FL 2K6WA 3JTBA 4P3DB 4XVSH 3P2TA 5TDPB 5IHBA 5F7UA 3HXFA 2AJYH 4P3WA 5HHOD 2G9HB 4JFYB 4E0RB 4XAKE 4J3OH 4KK5C 4JZYA 4XVTL 1S9YB 3A4DA 1CG9B 2MOQA 3BHBA 3B1UA 3H9SE 5BV0A 3L3HB 4QJ5B 1GMIA 4XRCB 1KB5A 4H25A 1TR4A 1S7UA 2A74C 3O4LD 4OLEA 3S35L 4BZ1H 3MNVA 5DT1H 3KWUA 1PEWA 4FQLH 3M07A 2HE0A 3HPLA 4RCVA 5AVWB 3L9BA 3SIKA 4JK0D 2HRPH 1G6RL 5A6LA 3FQ4A 4MD0A 5CLXA 2A38A 2YBGA 2FQDA 4E36A 3QG6A 4HLJA 1NCHA 2VITB 2XEVA 3N0PB 4JKPH 2FX7H 4L3CB 2CFZA 5C0FA 5GGTL 4GSXA 4M7LT 5SWZE 3VXOA 2RTTA 3LZRA 1MELA 4UT6L 3SZ7A 4OLWL 1T5KA 2ED7A 1RHFA 5EF0A 1KPVB 5TE7L 4HEPG 2WBJB 4X5QA 4X9IA 5FDWB 2XJLA 4LPWA 3CE1A 4OCXL 4Y4FA 4Z7OB 5ALBH 3BP6A 2OTWA 4KQ0A 5CERB 4JQIL 1S7QA 4WHTB 1C9SA 1LO0L 4PTTB 2Z34A 2KXPC 4RQIA 1IE5A 2FLBT 5IFAL 3JUEA 5CLZA 2DQEH 3CCHA 5AVQB 3M17B 5F0PB 2QKSA 3HMXA 1XF5B 1U8JA 3BZ4B 1GTNA 1SYVA 1T83C 4BZYA 1IMHC 3R06B 3PWNA 5FR3A 5I6NA 3OPZH 4HMDA 3V10A 4U95D 5DZ9A 4QHNB 1BWMA 4I5BB 1U8OA 5E03A 2YPKB 4F8QA 1KCUH 1F86A 1OLZA 5SWZA 3HAEH 3QYCA 3T6WA 4L8SA 4YQXL 1I9EA 5DHXB 4N0UA 2PCXA 4UQIM 3T0DA 5SWZB 3U36A 4L5FH 1UYWH 3AABA 4UIMA 5JXEA 5IHZB 3GMLA 3PE3A 3F12B 3PQYA 3VWJA 3BZDA 4ZQKA 4OZIE 1JF5A 1TO4A 3ZU7B 3ABME 3VW3L 4R7DA 2E7DA 1WBXA 2Z35A 1WBZB 1CT8B 4DGYL 3CK8A 1MRDL 1YEJL 2J1XA 5E24E 2DMKA 2JMRA 5J12B 2PYED 1UA7A 5ENPD 5IVXE 3NEXA 1SDDB 3ZL1A 3PDGA 4A04A 3TN0D 3MN8A 4XCEB 3EH5B 4HIXH 4UT9H 4X7CC 4MA7H 3F2PA 1BIHA 1OM3L 4M6OL 1A9VA 1DE4A 3QGOA 3OC8A 4P2QD 5EV7A 1AZRA 1NDGB 1HXYA 4YSRA 1OEZW 5C92A 2YC1B 5A2LH 2MCAA 1JVKA 3PL6C 1G5GA 5T3RA 5DR5L 4AIZB 2C0LA 2AQRA 1ZLSL 4ZO6A 3RBGA 4QHMA 4Z7NB 2PP7A 5ENNA 1CUOA 2A3TA 2R0KH 3C09B 3L1OH 3ZDYB 4AEZC 4GA1A 5HNHA 4V11A 4LCWA 3P02A 1NUNB 2GRLA 4G6FD 3KPPA 4IKNA 4AJWA 2CO3A 5AYUL 5A43C 4NZUH 4Y2OB 5FCUH 3IKCB 3ECUA 3DOSB 3DRTB 5F9WC 5GRZA 4LGSB 4BSXA 2FCBA 4H8WL 1ELWA 2HKFL 1NCUA 3BFQG 1CG9A 2ITFA 2K7PA 4HKZB 2CBQA 2OMNA 1MF2H 5EA0L 1Q9KB 5HLTA 3BPLC 1EAPA 2AEPH 2DLFH 2ICCA 5LB1A 3UAAA 2WWNA 1UG3A 1T89C 2YUZA 1OWNA 4HHGA 3ZE0F 4YDKL 2CG2A 3BDYL 2IAMD 4EF3A 2D2CC 4ILHB 4G6KL 1UJ3B 4ZFFA 2XS1A 1A3LL 3CKBA 2VM4A 4LDCA 1EV2E 4LIQL 2FX9H 3HZKB 5GSRA 4WFFD 2K9UA 2VITA 3UIYA 1N95A 4O2EA 3WV0A 2WHVA 4DQOH 1VB9A 2JV6A 4APFA 2AQTA 1CLYL 1E43A 3FAXA 3SJVE 1A6PA 3K4AA 2CMRH 4LCCC 2Z92A 4OTXL 1V5JA 2KC0A 3Q5TA 5INDA 2X4UA 3ZTCC 2B59B 1B9KA 1ZAGA 3EG9B 4NCC2 4LU5H 4PLNC 3TT3L 2WBJA 1G1YA 5CBEA 2AEQH 2KZTB 3ZT5A 5C71A 1KJ3L 4UT9L 3QDJD 3L22A 3KWWA 1FJ1B 3BP4B 3F5WA 3ALWA 4Z76B 3EGDB 4M65A 4XKBA 3T0EE 1BQRA 2FEJA 2VSDA 4HIHA 2R69A 4Z7UF 2J88H 1Q9WB 2RFAA 4UB0H 3U0WH 4N5ED 1N0LB 3DROA 3QDJB 5IMLA 4L3EA 1OWWA 4Z7IA 3D52A 1GOHA 1A1MA 2CGRL 4IDJH 4ODWB 4PJIF 5JIQA 4F8NA 3EZ8A 4NZFA 1FGVH 4AMWA 4KI5C 4B0MM 1J05A 3GZPA 2D7TL 2BJMH 3UTPE 3W0WD 4Y6RA 5CD3A 2O1AA 2I24N 5EZLA 4G26A 1ECYA 2KKQA 1L6PA 2ICWI 1U8OB 3R7RA 2QADB 4ZFOB 3WDHA 4ELMB 2EAEA 5C2BH 2Q7FA 3DARA 4LLAA 3V8CA 2K8MA 1FVDA 3KYMB 2RJMA 3QQ9D 4OZGB 3HS8A 4YO0B 2AJAA 4WVRA 5EF1A 3S35X 5DZVA 1JXGA 2HP4A 1I53A 1FPTL 4YAQB 4AEEA 4HUCA 4K7FA 1QWHA 5ESQA 5GJSL 3VA6A 3TT1H 2X6HA 4N87A 4FCAA 5ABAA 5IJVA 3PHOA 1Q0QA 2QKIC 3F7VA 1QI4A 1UACH 3QO1A 5DMIH 1I4FA 1ZHBA 3UXGA 3T3PB 3T09A 3VXRD 4IU2B 1KTOA 1YPZB 4POUB 4XAWH 1RULH 4BV1A 2EDBA 4GO9A 1I1AA 4P4RA 5FK9B 4QTHA 1E9PA 3F7YA 3T4YA 3ZNGA 1SBSL 2FB4L 3GTNA 2VTFA 3B2MA 1AYRA 1PZBA 1QBAA 4MA1B 5BVPH 1QEWA 4MD4A 4HLLA 1KTBA 1G9MC 2BWQA 5FYJL 5GJTL 2HVJB 1GYWA 1HL4A 3ZHXA 2CIKA 3GMRA 2VOTA 3LX9A 2GGFA 5IV2B 4LU5L 1VEPA 1TJGL 1UN8A 1F5WA 3WIFA 3C3RA 4MJ5A 1NC2A 1H5BB 2H1PH 4YFLI 3MLSH 1NMCC 4ZPVA 1O9ZA 3FQ1A 3TXNA 2QPDB 4MAYD 4ZFOL 3KS2A 3ECBB 1PFCA 3IF1B 3SY0A 2BY2A 4BQ6A 2WSDA 5E23A 3PPEA 2GC4C 2VRAA 3C3QA 2J88L 2ICEC 3PUUA 4LB8A 4Y2DB 3QUXC 5FYKE 1CC3A 7TLNA 1XV8A 3F05A 4NEHB 3DRQB 1ACYH 4IMKA 2DY2A 4FP8H 4JFOB 4FGMA 1UG9A 2Y06H 2ZKWA 1RURH 2GYSA 4PJ9B 4K7PL 1C16A 4JFTA 4X6BB 3C60C 3LKPB 4JN1L 1KGXA 2KATA 4LNRB 2WPVA 3K5SA 1OPOA 1YZZA 2Y3NA 3QEQE 2RMNA 2FTAA 2HJLA 2FBOJ 5C2BL 1A9EA 3RNKB 1AOHA 3I9PA 4MS6A 2B4CC 5EU7E 3AMKA 2FO7A 1E90A 4UQ9A 4OM1L 4X9YA 2HG0A 4WO0A 4WNQA 1L9OA 3BLPX 1YECH 4I6JA 3IT8D 4ELME 2B1AL 1ZT1A 5J7CC 2C5DC 4MMZB 5LQBH 3ULVF 4RISL 1MHCB 4B3VA 2FYYA 2V8LA 5LXGL 2NX5D 5DQ9B 1Z66A 2HKHL 4KKCD 1RH8A 4J2XA 4L1BA 4PIRF 5FW7A 4NQCB 2EINE 4HUMB 4FD0A 3QJRB 1IZKA 3TWRA 4GRMA 2B15A 5IHLB 1CXFA 3E34A 1P9MA 2AQ3A 4NKMA 3T8KA 5EU6A 3QDMD 4XNUH 3VCLB 4ABQA 1F2XK 1BD2D 2MKWA 2Z4QA 1AS6A 3U4EB 1PVHA 5L2KA 2R2BB 4M9PA 4WW2B 4AQ8C 3MLWH 4K0OA 5KVDH 2FWLB 5DTFB 4PYHA 3GTVA 1OD7A 3E33A 5DS1A 2F2HA 1TJGH 3Q44A 1IC7L 1ZS8B 4JM2C 3LQAL 3S97C 4ODWA 5ITZF 2ZGDA 3MLSL 2EGHA 4RFNC 2R23B 2YIHA 3O2VH 3BT2L 3MLXH 4OM0L 1BQLL 3DVNB 3LDZA 5I5RA 2QVMA 4A7UA 3K6SB 2AQSA 3F12A 2F8OA 4NO3B 4KAQL 3KYMA 5D1ZC 1XCQA 5C1MB 3MNZA 4IGBC 2H1LM 1NBZA 1OARH 1WZMA 2EDQA 4P57A 1ZDSA 3PCYA 2AXWA 4PJXE 2NT0A 2QVFB 3O3BA 2O7GA 3MSAA 1OKEA 3AG2E 3E6FA 5DXWA 1UA3A 2PXYD 5D6CB 1E6OH 4NQEB 5HVGB 1L5JA 2HLFD 3GKZA 4PJBA 4N9GA 5CGYC 2V17H 3TZVB 4I0KA 5DZOA 3RVVC 4Y16D 1RZ7H 2D7OA 4YDJA 3Q13A 4GXUN 2F19L 3SQBA 2QZ5A 5ESVB 4AKOA 4W81A 4GB9A 2DLHA 5I28A 1U92A 1PLCA 5FGBC 3SGDI 4AENA 1VADA 4GRWF 5TGBB 1TN7A 1CL7H 3IDMA 3ZKQD 4X4YB 2NZ9C 4BSJA 2W9LA 5JMWA 2R2EB 2W8CA 3RWEA 1CXHA 3BUAA 3OKMA 3B9DA 1BGXL 4DP1X 5I24A 2ZUYA 4NACA 3RWEB 3CX5K 1KFAH 2ZQKA 4HJGA 5I0ZA 4Q7DA 2XQYK 4BZ1A 4GP8B 1XBRA 5D1XE 3LY9A 3DXMG 5LXGH 3BRDA 2UY7A 2AXUA 1V8HA 3V0VA 1GZQB 3WNJA 3GHPA 1TTUA 5JORA 3RRUA 2VERN 4F1ZA 3WEXB 5B39A 4O58L 1UWYA 5I30L 3WIFB 5BZXA 2WGNB 3DRTA 3N44F 2APWA 3ULAB 1WFIA 4J3OF 3NCBB 5IVZB 5L8KB 3H56A 4IU2A 3WTTA 2CG3A 4LSZE 4HFUH 1QASA 3DEOA 2V8SE 2YEZB 1OAZH 3KL0A 3P11L 1Q94A 4LOEA 3TEYA 3KXFA 4P46C 3QQXA 3D18A 1HZKA 3APCA 3KW7A 2HN7B 4XO5A 4HT1H 4K07A 3TEUA 3TEXA 1AGDB 1AS7A 5FAAA 1ZTXH 1ND0B 4U1MB 4Z77A 1KCRL 3D9OA 5J12C 1A4JA 5J1AB 3SBRA 1MWOA 5H7PA 1HXYB 1TN8A 5CMAB 1VPOL 1WYJA 3T0EA 3CGHA 1PX3A 2D03H 4HC1H 5IP4A 2WB2A 4KX7A 1TN6A 4PQXA 3V6OA 5MEPB 1JXDA 3X1BA 1NC2B 5AW8B 2YEQA 3VXNA 1C5BL 2JV7A 1PZ3A 4PJFA 5I6LA 3STBA 5KVFH 1P5VB 2PO6D 1L5GA 1MCHA 4WU5A 2UY1A 1XIWA 3LDBC 5ECGA 1RPUA 4UTBL 1DUZA 4H88L 4MCZB 1BXAA 5AFAA 2NCMA 3OHXA 4QOKB 4X9GA 1AGCB 3DK0A 4X6DB 1CIDA 1WICA 5I1EL 1J5DA 4OLVH 3UC0H 5DRXA 3CFQA 3QJHA 4K3DH 4B53A 4FFZA 4LT7A 2JLLA 2G2NA 4O4YL 1JK9B 5DQ9A 4NKIH 4P2RB 3E30A 2J55A 3CDGB 3RJVA 3EGDA 2QZQA 3LZLA 3WJMA 4Y1AB 4TNGA 5CSZB 2YXVA 4EN3B 3BRGC 2A6KA 1K8DA 1QI5A 4FFYL 1JPSL 2WQHA 5B38B 4PP1C 3GZ1A 4RGNC 5EYLA 5LN4A 1DSFL 2I7OA 3EOAB 4UOZA 1WDYA 4CGVA 2P5WD 2Q8AL 3ILDA 3CVLA 3P77A 2IOMA 1OGAA 4JB8P 5GIRA 4LPXA 1CS6A 5J8OA 2HXAA 5DFWH 1T7XA 3KYKH 5B1AB 3S2AA 4TSAL 3KSQA 4GAYB 1FIEA 1JFQL 1MXDA 4GZ5A 2GITA 2ITEA 3AT0A 3D50A 2DQDH 3NCMA 4Z0XB 1S63A 5AAMC 1QMUA 4U6HA 1ZVSB 4KO9A 4YPGB 3TWYA 5KVGH 4HI8A 1NAKH 3W56A 1O6SB 3L2LA 3NZ8A 4Y4FB 3V9CA 4I2XB 2R8SL 3ELAT 4NRYB 1RZ8A 1HI6A 3ZGHA 1QOKA 4PS4H 4OAVB 1XF4A 4I1AA 2IO3C 3QUZC 1AS8A 5JDSA 2H8PB 4AE1A 1AZNA 2PWHA 3KEHA 3VXUE 2OTUB 3RX9A 4J8FA 5CXPA 3D9IA 2D03L 3K74B 4ODXB 2P9RA 4KWUA 1EO5A 1XL4A 2G3XA 3AS0A 5D4JA 2X0WA 3IIEA 3K0YA 5ANMB 3GJFB 4QEGA 5HHXH 3BUTA 4G5ZH 5EEXA 2FECL 4PGCA 1GAFH 4OCSH 3TYFA 4PRAA 2CNYA 5IVXA 5AOLA 4CKVX 2DQGH 3AJ7A 5I1EH 5D7SL 4MWFB 1UZ8B 3S96B 1GRWA 3L3OB 1AKPA 4KRPD 4QRQA 3IM1A 4OZIA 2R15A 3FRPA 3F7VB 5I18L 3QVAA 2TRYA 5B1BB 1TQWA 4X6CA 3BESR 3ZRCC 2DIAA 4N9GB 2ED6A 5IW6B 2BY3A 3HRZC 2G5BA 2P26A 1IQDA 2BIIA 3OVUB 4HJIA 4P5MB 4HBDA 4KHTH 4M8VA 1OCOE 5AOKA 1T6BX 3TNNB 3VD3A 1SXBA 3BMVA 1WLHA 2Y4TA 2WNKA 5EU4A 3U7YH 4QOKD 4S1QL 2JKLA 3U9UB 2YLHA 5TDOB 3WUWG 4OW6A 3QARA 1H6TA 2F0CA 5CEYA 2WXFA 2WVVA 2Z6FA 3RGVB 4RMTA 1FAIH 3BPNB 3OXGA 3UOAB 5H4ZA 4YNYA 2IH3B 1AGDA 2X6IA 1AGFB 3NSFA 2AJSH 5G05J 3QXVA 2X38A 1FFNB 2E9JA 3SDAA 1HQ4A 3KL5A 3A0OA 2BOBB 4LCWD 4LL9A 4MCYB 4XI0A 4ZQKB 1H5BA 2DWYA 1S46A 1DQIA 5JS3E 4PY8J 3FT3B 2BLFA 2PLTA 5FM8A 2X10A 4YL9A 1T21B 1JFHA 1OALA 4WTQA 1I82A 4GAEA 4WNFA 4RFEA 4XPTH 5TF0A 2J5WA 3HR6A 2ZWKA 2FHBA 3DO7A 4TMNE 3BQUD 5EOCH 2P8LB 4FNRA 1E4KC 3Q47B 4YC2C 5BMFL 3IWUA 4IHBA 4W9ZA 4Y88A 1E4WH 4UT7H 3S4SB 1TYQG 4P2QA 3CZLA 1UWGL 3SKMB 1KZPA 4JG9A 1VGEL 3DBXB 3MJ8B 3ZPDA 1HJCA 4EZJA 3MNDA 1OAJA 2GJ6A 3FN3A 4CSTA 4BA0A 2H6FA 5TE6L 4P5KB 2HJKB 5D72H 4PGEA 2BP3A 5TH2B 4NX0A 1KJ2A 1LE5B 2D9CA 3EHNA 3KGSA 5D1ZD 3TMNE 1GCFA 2DYSE 1AQMA 5DIZA 4XP1L 1BD2B 3FL7A 1CMOA 2R4SH 3EDJA 5ERWA 4P04A 2F5AH 5EU5B 2GEEA 1EEZA 5SX5H 1OP9A 3VWKB 4Q9BA 1M6UA 2WHZA 3IGKA 3VWJD 4J3OC 4QHKI 3P77B 4KUCF 1OSEA 4HIEA 1NFDB 1MQSA 3DX3A 2IOSA 2IQAB 5HY9B 2D9QB 6TLIA 4YUEH 3FPYA 2HTLC 2HVKB 1ASQA 5FDWA 2E86A 4NURA 4HD9A 4PRDB 3UGXA 1S7XA 4XO3A 3MNZB 5F7DB 1PY4A 1TG8A 5B3NA 4PG2C 4NO3A 4K3EL 3QC5X 1HU3A 5T5FL 1KCVL 1XMEB 4MASA 1Z5YD 5DJ8B 1PKQA 5DWUL 3BFOA 3SCMB 3CVBA 5EO9A 5GRVL 1KC5L 3N44B 2CO6B 2WBJC 3LB6D 3QQDA 3ZQWA 2B9AA 1OP5H 2KERA 4A67A 1IQRA 3CCHB 4FE9A 4UU9B 1V7NH 2AXGA 3MRRB 3SGJC 3BH9B 2BP8B 5J1SC 4GQQA 3HG0A 3RGBA 5HS0A 1JNLL 5AQ9A 2FT8A 3LQZB 5DRWB 3S8WA 5TLIA 3BD3A 1P1ZA 3LZOA 4W9FC 5LCWJ 3QRFM 4HP5A 1F6FB 3DUUB 1UJJA 1PNDA 1EJOL 5I6XB 3ZJAA 2KUTA 2DZNA 1IGCL 4MDRA 5KJMA 4HWZB 3RWIB 4ZDHB 5C9KA 1P4IL 3GMLB 1E9OB 5EOCL 1OUVA 4XPGH 5BRZA 3X11B 4NN6C 4UF7C 3RWIA 3AS2A 4GRWB 4DX7D 1VGEH 3UQ3A 4Q9QL 1Z3GL 2BSTA 1MFAH 3QDGA 4OGZA 4F5CA 3HRAA 1K8IA 3AU0A 2QFPA 3B37A 2V9RA 4M4PA 5J1TC 2V0AA 1T89A 3OTNA 2VDKL 4XPBL 4B93B 4DKFH 5IVZA 2LVEA 3VGBA 4GMTL 5FUCE 1JZJA 4ODSH 4ZX3A 5K9KB 1DBKL 4HLEA 3BJ91 4ACKA 2WINA 3U9UA 1IU1A 2NNCA 2IDFA 3MBED 3UCRA 3IDGA 3CIQA 5IT2H 3Q8FA 4B9IA 2FH6A 2HFFA 4XZUB 5DD3L 3MRQA 2H32H 1WG3A 3NMEA 3AS1A 3KPSE 3FRUA 2NY3D 3DURB 5LKNA 4IRSA 1CDHA 4N2QA 2OSLB 4NN7C 3TBYB 4PWKA 1F4XH 5EWIL 1LF8A 2ZX7A 4QRQB 3QFDB 5FQ8A 3ARBC 5F3BA 4B95C 1KCVH 2ICEA 3MA9L 2NY4D 2EIZB 4UWHA 4U1GC 3CVWA 1EGJA 4WFHE 4M6NL 4RDBA 5DPFE 3T87A 3IKKA 3IMVA 2E74C 1P7KB 2E6PA 3BAYA 1A3RL 3ASGA 3TAXA 1V7NL 4NWUH 4IOSA 4MXVE 2XKSA 2E6QA 4NNXA 5F1KC 4E9XA 3ML8A 4BQCA 3UTOA 1BZDA 3DX6B 1H3WM 3RTQA 5JOFA 3T2HE 1QFWM 4QHLB 4Z3GA 4U0ZA 2N7AA 5IWLA 4LLUA 5D7IA 4WEEA 4ZMLA 2RACA 5IFJB 1MCEA 2CRYA 4P23A 2ZOKA 2ADIB 3F3HA 3R8BB 5I1KL 5B39G 4LNRA 5E5RB 3CFCL 4IYKA 2EILE 4CVUA 8CGTA 4S0HA 1CE1L 2XV0A 1R47A 5AN8A 5IHUL 3NJXA 2YS4A 5T1JA 5A6MA 4I0PA 2AXFA 1H8SA 3CSPA 4WI3A 2F7IA 4LASL 5EHFA 1GZPA 4IRJA 4BKTC 2AABH 3ARWA 3J2PA 4YHKH 5CKAA 3HG1A 5I1GH 3IBOA 3QUYA 1GGCL 1U3DA 1UKSA 1NA3A 5L7XH 1CYXA 4TVUA 3BHBB 4Z76A 3X2QB 1IKFL 3EIQC 3UINC 4X98A 4LPTA 4C83B 3SQOL 3H7BB 4HUXA 1QQDA 3FFCA 3VVLA 3WLWC 3TYGH 3BXNA 3GLZA 2WP3O 3K71B 4A39A 5ESQB 1OCZE 4APOA 3PWPD 4HZLB 1ZU2A 3AAZA 3MZLB 1UM5H 1FG2B 4MFHA 3KPNB 4UDUB 5CSZA 5GGRA 1ZWIA 4KJQD 4JHWH 4OD1L 1QFUL 1PY1A 4M8RA 4UAHA 1WQVT 2ENQA 1BVKA 3QJVB 4IBQA 7PAZA 5E76A 2W9EH 5GGVL 5EWIH 4N3CA 1LGVA 5FK9A 3AG4E 2HTKC 2FGWL 3ESUF 4I7ZC 4LHUG 3TWCL 4A2DA 1J11A 2X7LA 4ZTPH 4HAKA 4G9DB 3TLRA 5HRYA 3BISA 3GSNL 3PQYB 4M6NH 4X9BA 1YEIH 4UMSA 1G4MA 1I3VA 4NNYA 3RO3A 2AK4B 3P4OB 2FHFA 3T8DA 4JPVH 5IW1A 2WV3A 2WMOA 5DJZB 4QY8B 1NI1A 4ADIA 4FQQA 2OZ4H 1TNBA 2D3NA 3ULUF 2AJUH 2P8PA 3CH8A 4TRPH 1CR9L 1O7SA 2EYTA 4RLDA 4YR6B 3F7PC 2W92A 4P3CL 5E8PB 2IQCA 1EUUA 2HZHA 3IJSA 3WTUA 4GW1A 2J6EA 2K78A 2LU4A 4NDMA 3OLEA 4LCYB 4MX7A 4HF5H 4XNXH 4G8KA 3K1KC 4LFHG 5K9QI 3NG5A 4FN0A 1FZKA 3TWSA 5FECB 5EUOE 3SOBH 1MRCH 1IHGA 3GZQA 2GSGB 4ONOA 3I3DA 4Z95H 4B6ZA 4DGVL 5F9JB 1ED3B 4JCMA 4LQFH 4DOHE 5TGBA 1KIUA 4AC2A 1HKLH 1KBGH 4V1DE 1NOAA 2CUIA 4LF3A 5F96L 1OGPA 1P5UB 4P2OC 1CF8L 3NIGF 5FFLA 1UM4L 1N0QA 2CPUA 2OSLA 4PJGE 3TBYA 3EYOB 3KM1A 1H6EA 2OW6A 3PP4H 4TSBH 2GTQA 4FHKA 4WWKD 4Z7VE 2VISB 4XNQA 4KKLD 4MJ4A 5GQBA 1X5LA 2HFGH 4ANXA 2OSXA 4JRFA 2E9IA 4TUKL 1J1PL 4ANKA 2DQTH 4EKJA 2DIJA 3QQ9C 2YXMA 1NMCB 1NOFA 1U58B 1AY1H 1KWGA 3FN0H 5FT9A 3T73A 4X8QA 2COVD 2A9AA 2HLEB 5IB1B 2HT3C 4RFOH 2VUOA 3O3DA 3PEUB 4X4YA 3OXRB 5HGAA 3KPTA 3QH3A 3T0WA 1RZKL 5FIOA 2ZSWB 4ICXA 5FLUA 1EJFA 4IEFA 1CDCA 1NDGA 2CHZA 1R3IL 3MROA 2BSCA 3O6KH 2WZAA 4H8PA 4UIMB 1IM3B 4PG2A 1X5IA 5GRYA 1YAZA 1JZ4A 2H3XC 4N3BA 4HAGA 3D85A 4NKOA 2ZXWE 1DUYB 1YJDH 4JZNA 4WWKB 5DJCB 1L9QA 4QUOA 5BUAA 2NY6D 1FFPB 2VIRA 2X5PA 4WW2A 1FO0B 1IAIL 3FCGA 3LHPL 2GUYA 1PG7H 1CD8A 5IBLD 1JGLL 4NZTH 3MX3A 2XXCB 1FNAA 4U2ZA 2ATAA 3C09C 1EH9A 3LXCA 3NIFB 4TXQA 4XNMB 3KCPB 3WY4A 1U8PA 4ZYKA 2KDGA 5IB3B 3FXPA 4EHMA 1QWUA 1X4XA 3P7QE 3RDTA 2IALB 3CH1A 3P73A 4J4PA 4PJEF 3LQAC 5JO5B 1E5AA 2NTSP 4YBQD 4XPHL 2CHNA 2AVFA 1JERA 4HF5L 1OZUA 5B7EA 2OSYA 3Q6FA 4X7FC 3SOBL 3MRFA 5L6YH 4AVKA 3A14A 2PXYB 4IHOA 2Y1ZA 4Y5XC 3H42H 2DL2A 3HNTL 5L2KB 4OD2A 3SE4A 4B9CA 4P46D 1YMME 4P2YA 3RTQD 4PAZA 1ODUA 2Q2LA 1X4ZA 3QR0A 2XQ0A 3L9RA 4GINA 1A47A 5IHHA 4AYFA 3LS5L 3NIDE 3R0IA 3D9HA 3HS0A 4NZ8A 4WUUE 4DVRH 4LVOB 3DX8B 4X9HA 3I6LD 3LN9A 4AZ8B 2VUYA 5C0IA 1VKXB 2HFGL 1N18A 5HJDA 2F8IA 4PJ5D 4DZ8A 4HIEB 3VG9B 3GYZA 1MFDL 5JW3H 1FH5H 3WL9A 4FJZA 5DJXB 3BP6B 5TLNA 2KCKA 1QFPA 1RUKH 1OTUD 4L9LC 1YYML 2VR9A 3MCLL 4LCUA 3TC9A 4ILIA 3QNKA 3C5RA 4FF9A 4J39A 1PD1A 1F3JA 3FB7B 1WBXB 4GH7B 4UZGA 1KYUA 4N2FA 2B08A 2DKMA 4PGJA 3BN9D 2A0LD 2BOCB 3A23A 3TL5A 2V2WB 1IT9L 4AVJA 4TV3A 2Z4TA 1AOZA 2ETWA 2QGCA 4NM8L 3KVPA 4EMZA 4WEBH 1OTTC 3P7TE 3RIAF 3QWNA 4A7QA 5JW5A 2QVWA 3T2QA 5B1CA 4WCYH 3FCSB 4R4FH 4UIKL 2IXQB 2FZ3A 5FYJE 4Q97A 4O9HL 2DQHH 5K59E 4ZQTA 4ANVA 2G2RA 3TJHD 1PTZA 1DQDL 4QYAA 5C09B 5D1QD 2J5LB 3LN4A 1XX9C 4CC1A 5FV2A 3UMNA 3EOBB 5EO1B 4BSVA 2B6CA 1FL6A 5DD6B 4WHYH 3KWWB 4H0GA 5LUMA 2YFNA 1IM9A 2JTDA 1M42A 2KL6A 1V54B 3UTMA 2OFQA 3CX2A 2IBZY 4XOBA 4TXRA 2MCMA 4MNHB 3ULUD 1SM3H 3CHOA 1JVOA 5J11B 3OMNB 4I3SH 1BLXB 4AG4L 3RQ3A 3EO1A 2X6FA 2VB5A 4A7GF 2BVPB 2XN9A 2L7QA 2DWXA 3HI6L 3H42L 4KDTA 1URIA 2FATH 3OZ9H 4BQ9A 3FTZA 3GFUA 1NCOA 1MCOH 4MJIB 3HAEG 3VLFA 5I5JA 4B89A 3F01A 4HOSA 4R7LA 1L4IA 3I84A 3K0WA 3K6IA 3GTTA 3K4DA 5KOMC 5BS0D 3HE7C 1CICD 4UQ3A 1GGIH 3BUYA 4OF3A 3BP5A 4ESKA 1XIWD 1XO8A 4NO0B 1I9IL 2MYOA 4TL4A 4JPSA 5FCSH 4LRNH 1N4QA 3RDJA 1X7QA 1G9NL 1MFDH 4I0PC 1RCYA 1UZ8A 4DP4X 1WAPA 4J28A 2VXUH 1KF9B 2YA2A 4F2MA 1NC4D 1JGIA 4UQYA 3ETBJ 2OP4H 5E5MA 5I1DA 4JO5A 1IAII 2AJZA 3B2VH 1XXDC 2V8MA 2W65A 3I74A 4IM8A 3FHAA 1KR6A 4GQZA 3Q73A 4H8WC 1KN2H 3QUYB 1NKRA 1KBVA 3WU1A 3RC8A 4G6JH 2X44D 3HHMA 4F9PA 3LZFL 4JGNA 3LDBB 4G9FD 2VH5L 3RIBA 2YHEA 2RCSH 2RQEA 3SGEI 3T0AA 3DRQA 3WE1A 4ZX4A 2V9TA 4ETQA 4EDXA 3OWRA 3D25B 4KHXL 4L8BB 4R4FL 4EBAA 4MTMA 3VH8A 4DEPB 3UIZA 3FXSA 2X6BA 5AJLA 3TEWA 2HT4C 2QQKH 1KBBA 1EFQA 3VH8B 15C8H 4QKTA 1WWAX 4KFZC 1FFQA 1TNMA 3KS0J 3SSGA 1KS7A 4BEPA 3IDXL 2BPBA 4O5LL 4UDUA 3UJTL 1JHLH 5AL0A 3J07A 3QORB 5IFJA 2KS0A 3AQXA 1NGXA 5F88B 3IJYA 3CXBA 4MCMA 3VXSA 2MOVA 5HNFA 4PJXF 4PV8B 4UUJA 3ARZA 4W6XB 1IARB 1E7VA 2ZCZA 3D1MC 4GT7A 1KIPA 2EC9T 2BVTA 2PM7A 2IV9A 2BSDA 3FLFA 2GK2A 4KNTA 5EUOB 3V0AC 2ZKXA 1CGWA 4JDEB 3STLA 3GSNB 3E9UA 3MBWA 3TA3C 1I9RH 4UI9C 3OF6D 5I6MA 3CVVA 1EHAA 1Z5LA 4D0BB 4XP5H 3M1BB 1Q38A 4K90A 1SQ2N 5TQ0H 5HPMB 2NW3B 1MJUH 2JKTM 1A0QH 1F3DH 3LEXA 4NRYA 4HNAD 3LH9A 3JWNE 4C56A 3KR3H 4LXFA 35C8L 1RZPA 3MV9E 3DSNA 2UWEF 3GIZL 1I1AC 4KKLC 4HJ0C 5EO0B 2R2BA 4Z8FH 1WIOA 2EVFA 2YPLA 2FJGB 4DKEL 3EOTH 2F58L 4JFDA 2CD0A 3U30B 5E75A 1GC1L 1I8LC 3R06A 1GC1C 4N8VB 3FUEA 4X80L 3I2CL 4KZEH 2X4RA 4B8CB 5LWYH 4KVNL 4GMLA 3TXAA 4RQQB 4IBUA 2XZTG 5C08D 2OSWA 3O4ZA 1OPGH 3RL2B 3AM8C 2YD3A 5EUKB 1NCCH 5BZDA 5JDJA 2VGXB 5C0GB 1IM9B 1M6OB 1KZYA 3FQNA 4RH4A 4RAUA 2WZGA 3GMQB 5BZZA 3G5YA 1X5FA 5C0BE 1WBZA 2V9QA 1D9KD 4Q9RH 2X2JA 1OHZA 5FS5A 5EU6D 3US1A 5F6IB 2DWEB 5AAWC 5AZUA 3TZVA 5EDSA 4QT5B 4Z6AT 3BZEA 1C8QA 3C08L 1AG0A 2P5ED 3PAZA 5EZIL 2BF0X 1KXQA 4H13C 4OGQC 3ZI0A 2MAPA 3D0LB 3CSGA 1U4FA 1N6UA 3HRZB 3MLYH 1JS4A 4F37K 3RP1A 3UKUG 3T2NH 1QR1B 2A9BA 3CN2A 3FSVA 2GRPB 2W0KA 3OX8A 4RGOH 4JUSA 4CUCA 2ID5A 3PLYA 2F15A 4YHIB 5KBAA 2B4CL 1ZA6A 1PYWB 3ORJA 4GXVH 5CEZH 2KLTA 2XN0A 1PE8A 4X0NA 5HHVH 4PJHA 2NY0C 3MXVH 3HC4H 1BOYA 4LCWB 5F0MB 1S9VB 4FXTA 1U2CA 1T0OA 4AUUA 2VXQH 3LIZA 1NEZG 4O2FA 3BVXA 2MCPL 1MJUL 3RO2A 3M45A 3VMNA 5EIBE 4NN6B 3X12A 4IRZL 4N68A 1FORL 1I3RB 3C9NA 5DJYB 2CXKA 3ILQC 1QP1A 2DWTA 8TLIA 4CVZA 4O1OA 3MFFB 4BX8A 3RY5A 1CN4A 2JJSA 2W38A 1OCOB 5AOJA 3LJ3A 5CGBA 4WK0B 5KYYA 2FSDA 1E9QA 3DX7A 4BGLA 5IY5E 3FQXB 3N3EA 3U4KA 2C9VA 3L3OC 3K72A 4LSPH 1KWKA 1JYNA 3L4YA 2F8XK 4F7KA 4UCFA 2Z7ZA 5IZ7A 2JJTA 3IGUA 1HXKA 4OLUL 4A2MA 4CJ1A 4M7LL 3S35H 3DSTA 5DZAA 3U7AA 1J86A 1R4XA 4HXAL 5D2NB 2DYRB 4FG6C 3MRRA 4P99A 5D8JL 2Y4SA 2P80A 2AV7A 1ZGLP 2VL5B 5IQMA 1FIGH 2O72A 2F54A 2XXFA 2EH8H 8FABA 1QFWL 2IALA 3CH1B 3P73B 5DSCA 5LJYH 1A14L 4TQEL 3L7EA 5C8JA 4YIQA 2R2CA 4JS7A 2OJZH 2MQGA 3MLTA 4EI0A 1KB3A 5FWQA 2LABA 3LRGA 1HSAA 3B6SB 4HCRH 2PO6B 3QXAB 3HJ0A 3FMGH 4PR5B 4UM9B 4AM0A 2IAMB 1H8LA 2C3VB 1SXNA 5GS1C 3C12A 1NBZB 4K5CA 5IQOA 4L2LA 4XEIG 1E2ZA 1H3UA 1ZIBA 3CFKB 3IFLH 1EFXD 2WIIA 3V2OA 5DLML 2CKBL 2GBAA 2BNRE 4JZJB 1AD9B 1ZGLB 4BWUA 3KW8A 5E2WH 1CF1A 5FJYA 1ORQB 2FD6H 4BE6A 2WJ5A 4GQ9H 3MJWA 1N0LA 3DROB 2CA3A 2NXYB 3L2NA 4IDLA 5IBUG 1KNOB 5GSVA 3HC4L 3PABA 2JLPA 5JLZA 5DC9B 2Y5QA 3ECVA 1TSHA 4PGCB 2DKUA 4C57C 4XAKD 4FTVA 1JCRA 5KUMA 4YPJA 2J4WH 3IXTA 4C8XA 1IGYB 5HP5A 4HGMA 4ZNEA 4N0UB 3SDDA 3HE6A 1MQKL 4W9CC 4N39A 4JFEB 3T8CA 5CJOL 4N86A 2VDMB 2MPAL 4Q89A 5ECJE 3VM7A 3LEVH 4LLVB 1BQSA 3RNQB 4AL8H 1QSEE 2R56L 4GA2A 2GTZB 5FO8A 3VJ6A 3WLWD 2DQFA 3G3LA 2YGVA 1UYWL 3T1FB 3NIGE 1WWCA 4CL7A 1HWHB 1FVHA 1ASPA 1XF4B 3ARBD 4JL2A 5EN5D 1E5YA 5IROC 3B34A 3AB0C 1M3IA 3MV2B 3AY4A 3FTGB 4PMFA 1MJ7L 1QBLL 1XGUA 2NR6D 1OV8A 3HE7A 4C55A 3REWB 3NA4A 4YDZA 5IR1B 5IJVB 1T83A 3VI4A 5F2FA 2CU9A 4F8PA 4FQCH 3EJUA 4YNYB 3HG1E 3QZBA 1G87A 1MI5E 2HFFB 5JIDA 4XN2A 3ATBA 3OJDB 4J6RH 5HVHB 4EIBA 4ZW6A 1VERA 1QFWH 3IJEA 4ZMAT 2A6JB 3F6QA 1ZPLA 4MA7L 2W9DL 4NHUA 5A3IC 4YX2L 3PV7A 4HCRA 4M6OH 3SKJH 1UT2A 4Y5YC 4JM4L 3ZYOA 4MJ5B 1V3JA 3O6MH 1MAMH 4APXA 5F70A 4K55A 1OSZA 4QY8A 4XCFH 5B1JC 3FYEB 3VFVB 2ALAA 4APXB 2OMYB 3W1ZA 4KTEL 5ETUB 2BC4B 3ZYKA 4LK4A 4FQIL 2QQLH 4X9FA 1QPXA 3VDCA 2WCSA 4DPBX 1SPDA 1B89A 4CVWA 4R5TA 1E28A 4K3JL 1IC4H 4G8IA 2R5SA 2HX8A 2E8YA 3P30L 1ZANH 3ZRFC 2XZAL 2NW2A 3EFOB 1B0GB 1H3TA 1O5DT 3L3HA 1AXSA 3IWVA 1HH9A 1Q9KA 3QZPA 5IVNA 4OJAA 4Y6SA 3S36L 3PJLA 4KROD 1D5ZA 4EIZC 5J56B 4M4RA 5EYPF 1FFOB 1JRHH 1W15A 4O51A 4NKQB 4GQPH 5H94B 4BKLA 4N25A 2BNRA 3JUIA 3GYRA 1BOGB 2ZISA 4D9RE 1MG2C 1PPIA 3WQSB 1HO8A 1P4LA 4KI1A 3ESNA 3TNMB 3ZDXB 4DN3L 2WXPA 2B3RA 3PWJA 4BWTA 3VX1A 3V6OC 1P6WA 4MMZC 4Z7UE 5ABDE 3PDDA 1FYTD 1BZQK 2IMNA 4UV7H 3CC5A 5FOJA 1NWOA 1N19A 1L9TA 3OQ3B 3Q6GL 3OKEB 2MTAA 3CDCA 2MNWA 4CYMD 3IFPA 3VFPA 1N8OE 1RHHA 4M48H 3CSYB 2H6HA 1VZGA 4QRTB 3FT2B 3RDTB 4F7EB 3MA7B 4L1DA 4FFVC 1EZLA 3P7UE 2F7RA 3JWNC 5JC1A 4E42A 4IS6B 43C9A 2JIXD 4PJ9A 3ARGD 3P3RA 1XZWA 1GYVA 2BW5A 2YN3A 4XN4A 2E9GA 3FFDA 3ZDZF 4BXSV 4E9SA 3ULUH 1T1XA 1H0DA 4JM2B 4J3XA 5I1JL 4FL4B 3KNBA 2WTRB 1HYRC 4YHNA 1OF2A 1UXMA 4QNPF 5C0CA 2C3WA 5JQ6H 1UCBL 2ZUQB 1D6VL 2B5IC 5CD3B 5HHOB 3RASA 5BRZE 2CG9X 2Q76B 5BT1A 4K23H 2XPGB 4WFEE 4I3GA 1MJ8H 4MYPA 4H57A 4KRNA 1KGIA 3BPCB 2DWDB 5TPWH 1VKXA 1BFSA 3KD7A 2ZNXA 3TONA 2XPGA 8PAZA 2OLDA 3GRWL 1U8MA 3V0HA 3GMMA 2IQ9H 4ATZD 3QB7C 3EBIA 4NPYA 4RSVA 1S8DA 2GRMA 1FHNA 4NAJA 4RCAA 5LCVL 5FO9B 1EHKB 5GS0C 4L1TA 1UASA 3LY8A 3PWUA 4JKKA 5DA4A 2G3MA 1NEZB 3GINA 4PJBB 4X6EA 3CU7A 1QRKA 4E5XB 3WJLA 1SYVB 1OK8A 4H5SA 2F53A 2K4WA 4X6EB 5A2AA 4TUMA 3D06A 2OS7A 3EHBD 2YKLH 1RLBA 2IDQA 5E2TH 4N2IA 4DUIA 2W0LA 3Q5MA 3GJEB 1UURA 4GTOA 3PABB 2R69L 3FUDA 4Y16C 4BCYA 1ZXKA 5LNDA 1KIUB 1BD8A 3C72A 1B6DA 1ELRA 1PD0A 2N1KA 2PPDA 3EH4B 5T3ZL 4MS8C 2V5RA 2YMOA 3ASDA 1PQZB 1NGQL 2WSPA 3R9AB 3OBAA 5ENOD 2OPCA 1OCCE 3HIZA 1AIFB 2FT7A 1QBML 4JB9L 1OGSA 3NJGA 3O2WL 3EF4A 1BX2B 5AG8A 3UAJA 4TTDC 2G5BB 4BZ1L 2AEIT 4Z7OE 2JJSC 3ZOAA 4U6XB 2LXMA 1CICB 3EOYG 3JV6A 3KPLA 3O6FC 3RYMA 1Z3XA 4HWBA 5BS0B 1W3BA 1K6QH 1FAKT 2Y7OA 3DJZA 3P0YL 1AMYA 4JPKH 4DP6X 1OE2A 5C09E 1CGSH 1YEKH 5K1VA 2LR4A 4G7VL 4MRCA 4BHUI 1MHHA 2UVFA 3L1FA 1H6FA 5FC9A 2APXA 4GG6A 2V7HA 3E1ZA 1LNDE 1LL1A 2YPLE 1FNGA 4HX1A 1ZVHA 1NBYA 2A73B 2WUBH 3F6JA 4WY7L 1REIA 4OQ1A 4BZ2L 4K23L 2WVUA 1TEGA 3RFRA 1XWVA 5MENE 4CDHA 4ODVL 1LP9A 3MV9A 1NBYB 2C9SA 5E9AA 5HYJE 1MAJA 3MOBH 4YL4A 2IO2C 2B0OE 2IQ9L 1XD0A 2X1QA 3EH3B 2OMYA 4RESB 1BOGA 5IIEB 2J6WA 4APQA 5KNGA 3KH3A 3MDJA 4O2EB 4N8PA 3GK8L 3EYQC 4BQBA 3MFFA 5C2YA 3DX0A 3L3IB 2NRDA 3UERA 3WS3B 4NT6A 3FQWB 2I9LB 2VXTL 3HI1A 3KPRA 3QCVH 3V8OA 3D9PA 3HLKA 1HXMA 2WVTA 2YMTA 2JF1A 3TPKA 5F3HA 4EBQH 3NBNB 5CAYB 2NW2B 3EFOA 4OCRH 5LGJA 3LJNA 1QATA 4YXLL 3I9IA 3II2A 1ZDQA 3GO1L 4G6AC 3DHPA 3OAYK 1RZJC 5HHPB 1BZ7B 1IAOA 2WQXA 1XIWC 2ZCKH 2J44A 4NP4L 5T3ZH 2Y69E 1YMMB 3T2PA 3UJIL 3ALPA 2DICA 1Y7VA 4GAJH 4NQSB 3LIUA 4GAFB 5IESL 1CL7I 3KH4A 4L4VB 4EUPH 3HFML 4WRLA 3MV7E 4Y5YA 3N21A 1W91A 1E5CA 5E8NA 1IM9D 1TYEB 3KBFA 1F4HA 2YD5A 5AVUB 4LLMB 4X42A 2IDSA 2XZCH 2IFUA 4JQVA 3LPPA 4XODA 5SWSE 3RWDA 1R3HB 2XKNB 5KVDL 5CFHA 2APSA 5KSBE 2JELL 4J3WA 2OMUA 3IS1X 5FYKD 4HQQL 2X3BA 3B83A 4FQJL 1A7PH 4JUTA 1HOEA 4KRPC 5A2BA 4TMPA 3DTXB 3UTSA 2Q3AA 5AW1B 3TU6A 5D2NC 1CGSL 3SE3C 5L3UE 2Y7SA 3B9VA 3DVIA 2PUSA 3W11D 2KPWA 1EMTH 2E9BA 2Q86A 3VXUA 1J8KA 4PJ7A 2YD7A 5E99H 3HB3D 3VDBA 1G9NC 5LBSA 3D12B 4F2ME 1NSNL 3RZCA 2XWDA 1ZLVH 4QYOA 4CVXA 1BWWA 1DFBH 3LKOB 3CFKA 3CLFL 4IW4C 4KJWC 3EJJX 1XR9B 3GKWH 4ZX6A 3ISYA 1C1EL 2N4IA 2V33A 4YE4H 2OK0L 4PW4A 1A1OB 1OP3K 2NX5A 3PZ2A 4JRYE 1NGWA 2ADJB 4HWEL 4JY4B 2L4OA 4QGTA 5E6UB 4KV5F 2YAHA 2CLVB 1TMQA 2WAHA 1J87A 1QNIA 3E2HC 4PJ5A 5KAQG 5A6IA 1OGAE 2G0KA 2FGZA 2RFXA 5FGBA 3SE8H 3D4YA 1OE1A 3MRHB 4I2WA 5FQ7A 3ZKNC 2VMEA 5DLHA 3D48R 2X3CA 3CV5A 3QUHA 1BGXH 5HPMA 3QNXB 4Y9CA 1M4KA 4AIOA 1MF2L 5AKSA 3PAYA 1KYAA <