2XPYA

Structure of native leukotriene a4 hydrolase from saccharomyces cerevisiae
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
632
structure length
628
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEGKNKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUKOTRIENE A-4 HYDROLASE
publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 216
structure length 628
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpyA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpyA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpyA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpyA01
4XO3A 3QGOA 3KEDA 4XMZA 4FYQA 3FTSA 3B7RL 4MKTA 5TMNE 5L3UE 1LNFE 2DQMA 4OW3A 4XN7A 3FUMA 4R5TA 3FV4A 1KL6A 5AB0A 3DO0A 5K7TA 4XMXA 5HQDA 4XNBA 5TLNA 1TLIA 3FUJA 3NQXA 1LNDE 3CHRA 5JT9E 4XMTA 5DYFA 1FJTA 3PUUA 4KXAA 3FU0A 7TLNA 3B2XA 1TLPE 3FUKA 1FJVA 3T8DA 3DBKA 1SQMA 4MWPE 3B7TA 4J3BA 1Z9GE 4TLNA 1KEIA 6TMNE 4RSYA 5DPFE 4ZX5A 3P7QE 1HS6A 5DLHA 4FYRA 4R5XA 4QHPA 5FWQA 4XN1A 3CHOA 1LNBE 4XN4A 5JSSE 3NN7A 1TLXA 4ZW3A 1FJQA 3FTYA 3FUEA 2WI0A 3B7UX 4D91A 1Z5HA 2YD0A 2HPTA 4FYSA 4PW4A 3B2PA 3SE6A 4XN9A 4KXDA 4PVBA 2HPOA 1KS7A 1KTOA 3FXSA 4B52A 3DO1A 3B34A 4QUOA 3NQYB 3FTXA 2ZXGA 3FU3A 1FJ3A 6TLIA 4OU3A 1ZDPE 3B7SA 3SSBA 1Z1WA 4Q4EA 4ZW6A 4FKEA 3P7VE 3T8CA 3B3BA 1QF2A 4R5VA 3P7PE 4R7LA 4K89A 3FUNA 5TLIA 4XNDA 4MZNE 3P7RE 4ZW8A 4QMEA 4QIRA 5JS3E 1PE8A 2WHZA 4N4EE 3FUIA 4XO5A 5L41E 1OS0A 3Q43A 1LNEE 4KXCA 4ZQTA 1KROA 3P7WE 4KX8A 3N21A 5C97A 2XPYA 3DNZA 2TLXA 2VQXA 5DPEE 5LHDA 3FTVA 3B37A 2VJ8A 3FVPA 3CHSA 4WZ9A 1H19A 4D9WA 4XO4A 4PU2A 4K5NA 3Q44A 3FORA 7TLIA 4K5MA 3T2IE 1GXWA 5LDSA 3FXPA 4ZW7A 5JVIE 4ZX4A 3ZI6A 1FJWA 4KX9A 3T2JE 3T73A 5K1VA 5CU5A 4XN8A 4K90A 1GW6A 3QH5A 3MS3A 1FJUA 3FUHA 4NZ8A 3P7SE 4QPEA 4Q4IA 5FXNA 2DQ6A 4ZX6A 3FULA 1FJOA 5LWDE 4PJ6A 3FUDA 5J6SA 3MSNA 4FKHA 5A3YA 4N5PE 4K5PA 1TRLA 2XPZA 3T74A 2G4ZA 5DLLA 1EZMA 3P7TE 1BQBA 4L2LA 3TMNE 3CHQA 1HYTA 5LG6A 3FLFA 4H57A 1LNAE 4FKKA 1QF1A 1KKKA 2XQ0A 3FU5A 3T87A 3Q7JA 5FSJA 1L3FE 4Z7IA 3FTUA 3DO2A 4X2UA 4MTWE 4N66E 4TLIA 3FCQA 2TMNE 1TMNE 3QNFA 3FTZA 5BPPA 4E36A 4XMWA 3FUFA 1QF0A 1NPCA 4XMVA 4ZX3A 5FSPA 4XN2A 4MXJE 2GTQA 5JXNE 3CHPA 3EBHA 5L8PE 3MDJA 1KJOA 4FYTA 3EBGA 5AB2A 3T8HA 3NQZB 4KXBA 3FGDA 3QJXA 8TLNE 3FH5A 3FH8A 4NAQA 1Y3GE 4MS6A 4JBSA 4XNAA 1U4GA 1ESPA 4ZW5A 3F2PA 3MSFA 4GERA 4TNLA 3P7UE 3FHEA 4P8QA 4TMNE 3T8FA 3FU6A 3QH1A 1THLA 3CIAA 3FB0A 4DPRA 3EIMA 4XMUA 3FTWA 5LIFE 8TLIA 4F5CA 3T2HE 5FSSA 1KR6A 4XN5A 2TLIA 1KJPA 4KX7A 1PE5A 4OI5E 1LNCE 3T8GA 4HOMA 1PE7A 4M65A 2R59A 3TLIA 3FBOA 3EBIA 4K5OA 5AENA 4RVBA 3T8VA 3LS7A 4K5LA 3MSAA 3U9WA 3F28A 3FH7A 2A7GE 4GAAA
chains in the Genus database with same CATH superfamily
4P2QB 5B38G 2J1WA 4WEEA 2VRQA 2LLNA 3KYMA 4MA8H 3GHBL 1E9QB 3W81A 3WN5B 5KVFE 1D5BB 3L5JA 3EOTH 5TQ0L 4U1NB 4H88H 5BOZG 1L7TL 4AIZA 1T5XA 1Q72H 4PJXF 5SWSA 4XCCL 2NQCA 4WVRA 4XODA 1N9AA 3B9EA 3ZDWA 1FPPA 1JG9A 2LU4A 4YXKH 1AXIB 3KPRB 2MRYA 3TN0A 4AM0Q 1WF5A 1MFEH 4CU8A 4N8PA 1UJ3C 4OW3A 1RU9L 4H1LH 1N12A 3L16A 5FO8B 5E4AA 4OKVA 3QZWG 4HS8H 5C0FB 4BX9A 5HGHB 1TJCA 1BQLH 2QVMA 3UC0L 4PRPA 5AB0A 2B20A 1OK8A 3DX4A 3ROLA 4B60A 5JA8B 1H3GA 3IJEA 2ZX7A 4KOCA 2QZ5A 4I1OB 3PU7A 3ZYMA 4QTHB 3RU8L 2W92A 4TTDD 2GRLA 2RACA 4KUZL 2WMPB 1LNDE 1THAA 4GO6B 4PJEA 1MHHA 5AYQA 5CCHE 4Z77B 3VTXA 3GMQB 5LB1A 1VEPA 3MNZA 1P6FA 4MJIB 4GZ5A 1RH8A 4LPYA 1LE5B 3ZE1E 5DYFA 3DJZA 5I15H 1CXEA 4JFSA 3VSUA 1PQZA 5AZEL 4L2YA 1WIUA 3MKQA 3D18A 2NPLX 1GGUA 4PG2C 4B5EA 2BNRB 4JW3A 3GSVA 4MMXC 3B2XA 1MLCA 3JBG7 4WKZB 3T3PB 4XKCA 1JRHH 4HIIA 2XRAL 3TJEH 3EO9H 1OPOA 4EJ1C 4OJAA 2WAHA 4PB0L 3FU7A 1MF2H 1XH2A 3QPQC 3T8XA 1N59B 4GW1A 5DK2B 1OTTD 1Z5LA 3IU4H 1CIDA 2CLVA 2DQGL 3L7EA 5FGCE 1H8LA 4L8CB 1IBDA 5IQLA 4F15B 4XI9A 1SLUA 3GI9H 2JEKA 2EQDA 5HJBA 5I0ZA 2Y4TA 4HGWB 3Q48A 4PRAA 4N6QA 4ADGA 3O8XD 2WZPA 2IGFH 4A7TA 1LNBE 1I82A 5C0ND 4LT7A 1XSIA 3GBMH 1TLXA 1P5UB 2JI1A 4WSGA 3PCYA 1J0ZA 3GSOB 3B2MA 4NRYA 1J1XH 2EIME 2WLHA 1WD8A 4NQXB 2XN1A 5IROD 3FO9B 3O11B 5I2IB 3MGTB 2YD0A 5FGBC 2OSWA 2G5BB 4C4KT 1BZ7A 3EOBA 2ITEA 3RKDC 2NXPA 4ZFOA 1PY0A 3C6SA 4XN9A 2X4UB 3SDXA 2WQ7A 3P2TA 1UD4A 1R24B 2LLLA 4RMBA 3M17A 4I3RH 1AGFB 5IBTL 1ACZA 3GK8L 4WHYG 2EXTA 1WFNA 3ZL1A 1NIDA 3I6LD 4WENB 4QUOA 2V7HA 3SBRA 3FU3A 2ZUWA 3TWWA 4F1PA 5CEAA 3K4AA 4J3OG 4KTGA 2G2PA 3BGAA 3TFKC 4OF3A 5C0GB 5E8OB 4Q4EA 4RG9A 2V8LA 3AZUA 2KZWA 4P49A 3PDDA 2M63A 5MENA 3QPXL 3T8CA 3OKMA 4U0SA 4JDTL 4OLUL 4A04A 2VGYA 1VSCA 1FZMA 1KNOA 3EXLA 2GTZB 1JZGA 2K4WA 4WNJA 3DEOA 1EEYB 1YEEL 3L6AA 3GYZA 3LKNB 4YH6A 4GBXB 1SHXA 1QTPA 3VGGA 4UQ9A 5HDBE 4LGRB 5CERB 5GS0L 3GIVA 1FFNA 3NB2A 4Y4FD 3RIFF 4JNXA 2P44B 1BMZA 1F0LA 3PJSA 4EN3D 5J7CC 5ES4B 2ARWA 3BT0A 1Q9WB 4KQ4H 4OIBA 5C07B 4J3XA 1U3JA 3KH4A 4NQCB 3T0VA 2VSNA 4KJWC 1I1AB 1XB8A 1EJ8A 3HG5A 1G9MH 4XO5A 4ONGL 4CVZA 4ZI8A 5GRXG 1MI5B 4I5BB 1ZHNA 3TG4A 1AZZC 4LOFA 1ETZB 3WNKA 1T89A 5IG7A 2BCMA 2DB8A 4KXCA 2YA1A 4L0PB 4ONHA 1DQLH 2ARJQ 2JVUA 2R2CA 3L5XH 1U8NB 1N5AB 4I9WD 3SEPA 3I4GA 1IJNA 2EACA 4U6HB 4GZDA 4HS3A 5J1SC 5GJTH 3VFMA 3DETC 1EFQA 1GOFA 2VOTA 4FABH 5HYFA 2H8PB 2JKIS 1EYHA 4HRNA 2TLXA 5C6PB 4P9HL 2OYMA 5F8RC 4XHJD 2H2PD 2NY3B 3T6VA 4IOIB 4KZEL 3RK6A 1BIHA 3WBDA 3VFPA 1F1DA 1JCKA 3GBNH 4UAOC 2Q7AA 5IW6B 3UCRA 1SUJA 1G87A 4Q58C 5EF3A 4R90H 4KKLC 1T6BX 5MERA 1KXQE 2JK5A 2DICA 3RWDB 1VACA 4E9LA 1YUHA 1BDYA 2E4FA 4JPQA 1I1YA 2H3NB 4P99A 2J6EH 1FAIL 1DYZA 1HXYA 1MCPH 4NUGH 4NXSA 3BKML 4HA1A 2BERA 3WY2A 1S7TA 3IAQA 4K5MA 3R1GH 3PRZA 2BIMA 5LCVA 3VRLF 3SE4A 4LLMB 5KSAC 2XQYK 3MJ6A 3FXPA 1DJIA 3Q8FA 2FQEA 1DJSA 2WZ5A 2DQHH 5FV1L 1JD7A 2ZF9A 3P40A 4KK8C 4XPTH 3RPIB 1XGUB 2P9SG 2PR4H 1QLFA 2YXFA 3CFMA 4P5KA 3BT2H 4XCEA 2KDYA 3WGUB 1JF6A 4JFYB 4ZMAT 1JAEA 1HHGB 3I9IA 1H5BB 2O26U 2IANE 4H8UA 4U1JB 5EIDA 1NBCA 1TXKA 4IBVA 3BSZH 5I6MA 4UUJA 3E6FA 1A3RH 3DJTA 3ZDZB 4WSJA 1N7ML 1A7PH 3KEHA 3FQXA 1T2QL 2GBAA 1P5QA 4YDMA 1TZIB 1WCBB 4Y5XA 5BZWB 5JQ6L 4KBPA 5D7JA 5FDYA 1G9NC 2ZCLH 4ATZD 3CVNA 1AI1H 5E5RB 5LGYA 3MSNA 3VGFA 1X7TA 2TSBA 2VW7A 4WV1A 1U3HA 1PG7X 4I3SH 4PJ9C 4XE5B 5E9NA 1E28B 4PJGE 3O4LD 3RWJB 4UTAH 3T74A 5IB5A 1T21A 1OP3H 2VN5A 2QMJA 2YOAA 1P7QD 2XEVA 1TJGL 5CN2A 5E1HB 2GSGA 5JW3H 2X6BA 1RUQL 1MX6A 3FT4A 5CKGA 5FDWB 4X50A 5F7DB 4JFFA 2R8SH 4W9HC 3SKOB 2R0WH 3SSGA 1TNUA 3LEYH 1HFUA 1I1CA 2E9BA 3WIIL 2F8XK 2ZXWE 1D2OA 2HFTA 4GRWB 4DW2H 1JPSL 5FZSA 3GB7B 1FVCA 4QHKI 2WY3B 2VXTL 4P2QD 5JOEA 4XNUL 4YFEA 4HLJA 3PDOA 3AG2B 3KEZA 3NRQA 1NFDF 4U33A 4H25A 5HHVH 5F1OB 3VE0B 1XGTB 2HKHH 2X4PB 3CC5A 3HW2A 1AP7A 3OPZH 4KH9A 3NRPA 1S7RA 4OF7A 1E5UI 3K8MA 4Z18A 4S1RL 4IYPA 3KPRD 2HFEA 1JPST 3QGVA 4L8SB 2DI8A 3QUHA 2PCPB 3DO2A 3MV9E 3U2SA 3VO0A 4G26A 1FL3A 4YDJA 4WUUA 2A83A 5CEZD 3KGSA 5D93B 1IZKA 1RZFH 4NI6A 4KUCF 2DMKA 2XA8L 4H0GA 1L6ZA 3CDGB 4MMZC 4E2OA 4O58L 4BA8A 3VXME 2K70A 5E08H 3U0WH 3P3SA 3ZHFA 4QXTA 4Y7MA 2CRZA 5EIVA 4L48A 4IOSA 2HUHA 4ODTH 1AO7D 3DKHA 5EBGA 4NM4L 4PM1A 4X6EA 1DC2A 2A4EA 2H3KA 2LU5A 2EH8H 5IGXH 4MJID 4ZD3H 1IT9L 1KOAA 3QWRA 3CN3A 4MXWH 5DF0A 4ZTPL 3WY4A 5FUOL 2ZCKL 3ZT7A 2BDNL 3EDKA 4Y4HC 2BNRD 1WZMA 4AQ8C 1BZEA 3B1UA 1I9RL 2MH4A 2VLMD 2VN6A 4MB5A 3HR5B 1HWWA 4AT6A 3VXRE 1OT8A 3EBGA 1I7UB 2FJHB 4QHMB 3BUDA 3T8HA 4HCIA 5SWZB 3RWEA 1UEMA 4N5UA 1WFIA 3CX5J 2A9NH 5H37A 4AV4A 2WB1A 1XMWA 4RFEA 4NERA 4AGQA 5IMLA 2DIEA 2XWBA 3QWWA 1AYOA 3EFDL 5IHZB 4H26B 3QDGE 5F9DC 3C8KA 3LS4L 3GSQA 3JWOC 2AGJL 3HPJA 1A3QA 3CDZB 3IJHA 4JM2A 1Z9PA 4M4RA 2AXUA 4XT1C 5KAQF 2WINA 2X10A 4A7SA 4XNXL 2FNWA 4ACTA 2X38A 5GRZA 3AROA 4XVSH 3VXSB 1AG0A 2EDRA 3ZK0A 4JFPA 1TTRA 3V31A 4FTDA 1NMCB 2UVEA 5AW1B 5IVXE 3BEWA 1JK8A 4YDOA 1WISA 1NUGA 4UV7L 1RFDH 4ODHH 3P3RA 2J56A 4D9RE 2OKMA 2WBKA 3FSWA 4IKLA 4AY0A 4Y6PA 2VLKE 3NZSA 1KYOK 2XQBH 3CFJB 3UJTH 1QBBA 1G9HA 3DSNB 3G5YA 3I3BA 1J11A 3EO1A 3WXVH 2X05A 1HDMB 3LS5H 1NAMB 3QQ9D 2KPWA 4E68A 1Z9LA 2RQEA 4A2LA 1YNLL 1I8KA 2VR5A 5JHLL 1IAIH 2AVFA 4A2DA 3BYYA 1NGXA 1NCWL 1C12A 2B3RA 1AFVH 4CJ0A 1H8OA 3IRZA 4KAQH 4HZLB 3AU8A 2HFFA 5H2BA 4A37A 2BS8A 1CXHA 2C3VB 3UOAB 1FNSL 1ZY9A 3OWRA 4IBZA 4OCYH 5I1HL 4JJ5A 1ELWA 1X4ZA 4X6DF 3L3IA 3ZGQA 3K1DA 1VFUA 4UOZA 2CIIA 2K8MA 3K6IA 4F80A 1LEIA 1XD1A 3QZLA 4GBXD 3BWSA 5IESL 4LVOC 1YMME 3OJMB 5B1CA 1J0HA 4QLRA 4B8AA 1N10A 2H32B 1KULA 3N1MC 2P80A 1IGML 5AN8A 4B9IA 1PLGL 3RNQA 5DJZB 5C0NC 1A1MB 1T80A 2BH0A 4KY1L 4P5MB 2EVJA 2BOCA 5CEZH 2FZ3B 4CC4C 4NQCD 2Y4UA 1EDHA 1I8IB 4BRVA 5CZRA 1E9OB 1LNCE 2XV0A 1I1AD 4KPHL 4HOMA 4AV5A 5IHHA 2OMYB 4R8WH 2R59A 1MI5D 3AM8C 1FT1A 4JZOB 4AEIH 1PZSA 1AD9A 1Q1JL 1RZ7L 4GKSA 5D6DC 3VWKB 2ZWLT 3A4DA 4YHKH 4X7FC 3I6GA 3K2UH 4GW5A 4NURA 4AGLA 4J8QA 4TULH 1IGIL 3K8KA 4LNBA 3OKLA 1TETL 1HIML 4ENED 3H55A 1JWGA 4LUNU 4QNPF 5F88A 5AOIA 3DYPA 1X5MA 1IARB 3ZN3A 3F28A 4OCXL 3VFVA 3MR9B 4OZGF 2ZOKB 2F74A 5E2TL 4FQPA 4HRMB 3HMXH 4NP9A 5HDOA 3B8SA 1UTDA 1IMHC 3VM5A 4JO3L 3VXOB 2JD1A 1R5WA 2NY3D 3WNIA 5B1BE 2F6AA 5E99L 1KG0A 5D70L 3N1PC 3TZVA 4WWNA 3SO5A 2OP4L 3RIFK 1JZ7A 3GD1C 4OI8A 1G6RB 1WHOA 4U1MA 4MDIA 3MLTB 4X7SL 5C0CE 4BQ8A 4LCIL 4GTVA 4ZMYA 4JDZA 3DTXA 4GPMA 4WFFE 2FSDA 3CVHL 2F18A 3DBXA 3GO1L 3IDYC 5FUZL 2OV0A 4RDQF 2YSSA 3SE9L 3V4UL 3X1BA 1SMOA 1UB5B 3PYCA 1JV2A 4W9FC 4N2MA 3OX8B 2R4SL 1E6JL 4UMGA 6TAAA 3X11B 2DQUH 5AVWB 4HK3N 4EN3C 4OQ1A 1X5FA 1YQVL 1F90L 2BVOA 1NQBA 4WU5B 1MIEH 3V2OA 4Q52A 5HHNB 3U4AA 1ECYA 2JI3A 4PGBA 1C08B 3FSVA 3FUJA 3ZE2B 2GSIB 5DI8B 3ZSTA 1HU3A 3EXJA 3LKUA 3UZEA 3TX4A 5JUEH 4PGDA 2G9KA 3H4HA 3VTTA 4TQPA 5F7FA 2GJPA 2WMOA 1PEZA 3MRMB 2DLFH 2XBTA 3QUGA 4EI6A 1JNHB 5D7IB 1OW0A 1JK9B 2W0PA 4ELKB 4APOA 1U6AH 1XMEB 3STBA 3FUKA 1QNFA 1IBGH 3RGVB 4FN0A 1IEAA 1U8QA 2VSMB 1UCBH 4YQXL 5LN8A 4PJ7F 1QQDB 4DQOH 4YHZL 4DP7X 3ZMNA 2OMNA 4PJ5E 5JQIB 3H42L 4TLNA 2ORBH 2UUDH 5IHBA 2CKBL 1FWXA 3WFEL 4M5SA 2X44D 3QDAA 2YMOA 5F89A 5EZJB 1GZHA 3NFPA 5AJLA 1HQ4B 3KLQA 4OD1H 1SOXA 4UQCA 4Y88A 2XQYG 4Q6IB 1UH3A 4HULB 3TJPA 3IXAA 2IALB 4A68A 4LOVA 3GTVA 5JIPA 3DGGB 4L9PA 1U8OB 2YN5A 2OTUB 5A2LH 4N3BA 1BQHA 4E9QA 5BZDA 3ILDA 1VDGA 2VXQH 1K8KG 3NIFF 1R3HA 2YGVA 5KSBE 3JWNC 3D9PA 2Y69B 3V0EA 5E95B 3N71A 2WI0A 1TQVA 5E8PA 1KCLA 1XX9C 1JGVH 5DJAA 3MOAL 2V4HC 3B2PA 1FGNL 1WZ1L 1MW3A 4IJ3C 3EFFB 2L6JA 1NCBH 1UZ6F 1B0WA 1MFVA 2ZOOA 4NJAH 3LKSA 3MO1B 1BVLB 2HPOA 4HSQA 1K3IA 1YN6B 1Q0YL 4ZFFB 1T0NA 3Q6GL 1KS7A 2VYRE 1AR1B 3AUWB 3B9KC 3FO1A 3T0AA 2HN7A 2BSTB 4JKPH 3SKJH 3O3BA 4ZMLA 2AQSA 4GMSL 2WBJA 3NFNB 3SQVA 1BEXA 3PWVB 2QL1A 3F85A 2R1YB 3C6LB 2Y2TA 43CAB 3GSXB 1O6SB 4I9CA 2VMFA 3DURB 2YRBA 2F8OA 1KT0A 4G8GB 4MX7A 5FLUA 5JZ7C 1MRDL 2VERA 1AQ8A 2B1AL 2XWTA 3R0MA 5DK0A 5EMYA 4YHYB 2FF4A 2R02A 1JYXA 3JXIA 2F1AA 4XNMB 2J55A 4PJCB 1Y18B 2BIPA 2VW4A 4OCRH 4ZOAA 3QDJE 1F4AA 3KXFB 3KR3L 3GKZA 3FO0L 4PLKC 4OJFL 5C1DA 1DQVA 5CEXB 4KROB 4UILH 2PXYA 4WWKB 5LBGA 3UZVB 3MCLH 3RAUA 1E9PA 5BO0D 3MV2B 3QEHA 5EBWA 5GISH 3IHVA 1USZA 1X44A 3A0OA 5L41E 2NYJA 3CQGB 2HZHA 3Q2CA 2VR3A 5SWZD 1NGYA 3UROR 1CFVH 2IXQA 3NESA 3QJTB 4KFMA 2GG1A 4P4KA 5BVPH 2JJTC 5I1AA 5C1MB 1I3GH 4BEPA 1D9KB 5TE7L 5DFWH 2CDGB 3FHQA 4CSPA 2G75B 4U2ZA 4PGEB 3JYCA 1NGQH 1X5GA 2E75C 4I1MA 5FTPA 3QULB 3BKJL 1ODUA 2XPYA 4B94A 3CE1A 2JCWA 4XC3H 2WVTA 2AV7B 4RX4D 3VH8A 5EU6E 3CFCL 4M9PA 1ZS8B 2CK2A 3SGJC 1XEUA 3UDWA 2PZIA 3RX5A 3WFBH 3AB0B 3ILPB 1KGXA 1JUFB 3LRKA 4UT6H 5ANME 3VXSD 5IVOA 1F8TL 2MMXA 5A6IA 1LP9A 2QYJA 1COBA 2EDFA 3D87B 1YECH 4QWWD 4H7YA 5JOFB 1YEKL 3SHFA 12E8L 1SUHA 1KLUA 5CXPA 4HEPG 2BVQB 1NBYB 2Y6SD 3SKUD 4ZZKA 2BHUA 4MLIA 4PU2A 5HDQL 3GGWB 1OXYA 2X3CA 5AARA 1HHIB 2R2HA 4CBPA 5G2NA 1MJJA 3CKBA 4JZJB 4PRBB 4Y5YB 1F4YL 5FK9A 2E7DA 4CU7A 4L9LA 5KYXA 5KS9F 1AOZA 3D8MA 1S7SB 4TNFA 1TJXA 3GMLA 1BI7B 3AY2A 3KPQB 5J89A 1H6EA 3NJIA 5L2JA 2VM9A 3SQBB 4NCC1 3VI4F 2VERN 4AV7A 1NEZG 4R7DB 3OSVA 3VXUE 2WXIA 4KKPA 3X14A 1FJWA 2UWEE 3MBEB 4FQXA 4O2CA 3VCLB 5E6IA 3Q9UC 5T1KA 3GJFA 5IB3B 3B5HA 3P4OB 4K90A 3ARPA 2Y1DA 3T5XA 3CJJA 4CDMA 2QKIA 1KIPB 4F15C 2F0CA 2Y06H 5FGRA 5IFJA 5GS2D 4AH2A 5E2VL 3TWUA 3UBFA 3IDMB 4NQQA 3WGVB 1D2PA 1W8NA 2DQEH 1MCKA 1P5UC 1DSFL 2NCMA 1F4XL 2ESVE 4OGXH 1NFAA 3SQOH 3ZKJA 5AWNH 2WGXA 5EBMA 1KCSH 1FL6B 4N0YH 5T3ZD 2BZDA 4RRPM 3VWKD 1NBVL 2XNAB 4MA7H 4HAFA 2OPCA 1ID5I 3D4CA 3RY4A 5BXFB 3U7YL 4XCYA 4G2AA 5AB9A 1E65A 4YDLB 2H6OA 1DCQA 1HXIA 1FFPA 1EZMA 3HCVB 5IHUH 1WFMA 3VTMA 5CD3A 3DWLG 1ITBB 2L9BA 3P7TE 4ATGA 2FJGB 2WK2A 3D4GA 4FQ2L 2G3XA 2A74C 4H5SB 5HI7A 4JB9L 4K71B 3DRQA 4MHHG 4OLYL 2PYFA 5GGTH 5C3IA 2Z65C 5JNYB 4JRYB 1EQWA 3TWVA 3FB6B 3V4VL 5C6TL 3BRGC 4WUKH 5J12B 2ICEA 3DPBB 4WHDA 5IW3A 3BZEB 4J3TA 4K7FB 4NO3A 4H57A 3WIHH 1JRHI 2EC8A 1TTFA 2MPAL 2ETWA 2HVKB 3WNLA 1BF2A 4JG5A 5SX4H 2GFBB 3FU5A 3QH3A 4NKQB 2VQ1B 3HVDA 3QC1A 3R8BB 3VD5A 4OGYH 2ZOTA 1L3FE 1JGUH 2BSED 1G0YR 1J88A 2X89D 1S7WA 4XPBH 1PY4A 1GAFL 3MA7A 4Y2DC 2AXFB 5BV0A 1F3DJ 4DI4A 1CQKA 1ONQA 2MHAA 4LSTL 3QRGH 3AT8A 4N66E 2WQUA 3B6SA 4QJ4B 1MQ8A 2PP7A 2EYRB 2YGQA 4J8SA 1HQRB 3RDJA 2YJLA 5AVSB 5DIZA 1T3FB 1DCEA 2ETCA 2KZBA 4UNUA 4Y2OA 3RVTC 1K72A 2HJLB 3HKZA 3V6ZB 4CNIA 5DUPL 4NPYA 1A7NH 4ZO9A 1FVDB 5AKTA 2UX7A 3LY9A 1N6VA 2P28B 1OSZB 5B8CA 4R7NA 4QQIA 1FZJA 3W11C 3D39B 3L3DA 1Z2KA 4H8VA 3DLQR 1JSYA 1P9MA 2RHEA 3GSWB 3GDBA 4N68A 1LL1A 3PWPA 3RBGA 1M6OB 4UDTA 4K73A 4GG6F 1O5MA 2YPLB 3HC4L 1R5IA 4U96D 2HA1A 4ENEC 2OV8A 1DZ0A 2FYVA 1SLWA 5GIRB 2EUZA 3ME0B 3OKNB 1FRGH 1NAMH 4XAWL 4JFOB 2B9AA 2C0LA 3AS0A 1DVXA 5JJ6A 4ODXB 4CILA 4LLVB 3RL1A 1XGRA 4ZO8A 1NLBL 3ISWA 4PWKA 3RGVD 3TWRA 1T7ZA 4H0IA 1U93A 2NY3C 2YINA 1DBBL 2EH7L 3F62A 3APFA 2PKDA 1GYAA 3CFEB 4OM1L 3RIAF 4M8RA 5KJRL 2B3IA 5ID1A 4ZSOE 5KYUB 4BHUI 1Z0NA 3FCBA 4NQTA 2JCCE 2Q3XA 4Z7OF 4AUJA 1LNUA 4OD3L 2A74A 1MAMH 3MV8B 1IKFH 1SXSA 1FE8L 2QQLH 4XAKD 1IXVA 4FC3E 3ULVE 3QR2A 4LSPL 4C56A 3RRMB 3HZYB 3B9DA 5ENWA 2DQFB 2H32H 3R0IA 2QZAA 4Y19B 3EUVA 1RZJL 2EIJB 3HNVH 3H54A 2IJ0C 3AAZA 5KSUA 5GSRA 3D0VA 2YD4A 4DEPB 1BFVH 5HD8C 3GI8H 3SYAA 3FS9A 4U2YA 3ILQC 1HHJA 1XXDC 1CCZA 4HIEA 1AMXA 5T3ZH 2IQAA 3LRHA 3QHZH 2EINE 5M7QA 3LYRA 3MLXH 3AS1A 5IKCB 3ESNA 4Y2DA 5I71B 4Q6KA 4E41A 4F7KA 1AR1D 4KNTA 5PAZA 3S8FB 3UTSA 3FCSB 2W9DL 1S5HA 2EDKA 2A9BA 4NKMB 3D9AH 4YHIB 2JB6B 2Y24A 3C6LD 5C0DB 3CVPA 5FUCC 1EMTL 1X5ZA 4DNLA 4M7JL 1AIFA 4G8GD 4YSPA 4ZFHA 3WKML 3MRPA 4C83B 1QEWA 1G6RH 1F13A 3EYQD 3H2WA 4GO9A 3I6LE 5JHLA 5TDPB 3T0EA 4AM9A 3UKUG 4TM9A 2C1PA 2Y36L 2QV2A 4B0MB 3GXIA 3DARA 3N85H 3QB7C 1KR6A 4B41A 4AL8H 4KOBA 4NQVA 5DUBA 3N42B 2L7EA 4IRZH 4G6MH 3KXFD 2CSPA 3P4NA 4FDWA 4GKZA 3ZDYF 1KJPA 3TT3L 4KROD 3OR7B 2V5TA 4WWKD 4EBQH 1IAOB 3WMPA 1D7BA 5KG9B 2OMZA 4U1GC 2ZAGA 3ULSB 4EZKA 3EHQA 2XYCA 5GS3A 1ZS2A 4RMTA 2AXHA 3NACH 3WTVA 3KGRA 2KC0A 4HS6B 1CE1H 4HJ0D 3D08A 4NKIH 3DIFA 1W15A 5I8OL 2VXSL 1D9KD 1JHLH 4BFEA 2I9LB 4KI5D 4M1GL 3HN5A 4RMWA 4WQOA 5EEVA 2QHRL 3TV8A 3UAJC 1FNFA 5TGBB 3PNWB 1J0IA 1S8DB 2A77L 3CFDA 5EC2A 2HG0A 3FQRA 1S7QB 1TT6A 3WFZA 5A40E 4EDXA 1H6PA 1HILA 1ICTA 2ZXCA 3BGFB 4M1CD 4CDHA 2WV3A 4MZIA 2NTFB 3S88L 3IPEA 4Z3IA 3ZXSA 4GFTB 1Y8MA 1JWUA 5AIJA 4BFFA 2CXGA 5DMKA 3T6XA 4XMZA 3WO3B 3FRPA 4GUCA 3M1CA 4KI1A 4P5TA 3DXMG 2X4RB 5IREA 3R0NA 2UZPA 4M6NH 1RY7B 3DOHA 2ADFH 2XBZA 4MS8D 1ORSB 2CUHA 3O0LA 1GYVA 2CR6A 1LNFE 2W9LA 4AXWB 3IDNB 3FB7A 5EIIG 4N2OA 1A14H 4KTYA 5I19H 3FUMA 3KNBB 1VPOH 1OAJA 5KVMC 4CDNA 3JTSA 1D5ZA 2F15A 1IC5H 5EN3A 2J1KA 5GGRA 1R3LA 3LXCA 3P73B 2ATPB 1AWCB 4D8PA 2EJ1A 3CVHA 2ARJB 2R2EA 2ENJA 4X8JA 5J11C 4U1KA 3WNNA 2AXGA 2IU1A 1ED3B 4E42B 2V5MA 2UZXA 2WXJA 2I60H 2E47A 3CVIL 3MBED 1VFAA 5HHQB 3V6OE 1GC1H 4ZMXA 5KNHD 1MNNA 2FYYA 1KJ3L 4EPZA 2R2BA 2E7LA 3CVWA 1JP5A 2ITDA 3RG1C 1EF1C 4M7ZC 1QFUH 5DFVC 1FNGB 1XF4B 4HIPA 3TNNA 3CQCB 2H6PB 3PWJB 1WS7A 4OCNC 1IAIM 2FO8A 5T5NG 1UT1A 4IIZA 3MODH 3PWNA 4F3FA 5KWYC 1F11A 1IQWL 1H3PL 3WLWD 1O9ZA 4OI9A 3PGCA 2GRPB 2BIOA 3MJ7A 4G1MA 2LO6A 1UXWB 1FZKA 3SZ6A 2WLKA 2FB4H 3VMPA 2CLZA 5GQBA 1SBSH 4NZTL 4H2CA 1INEH 2VE6B 3PWLB 3RC8A 2AJ3B 1JWSB 4WGKA 3QUYB 3S6CA 4KYOB 4WW2B 2LV4A 2WUCH 4IIQA 4Z7VF 5ICYB 4WO4C 3DRTB 2NLJB 4WJ5A 3TPKA 4M6OH 4MAYC 5IM7A 2VDLL 1VDYA 4XN1A 4F8NA 2NZ9C 5HGBA 3RGBA 4DK5A 2VQ2A 4ZDHA 3TBWA 2QPUA 3CN0A 4LOUD 4GTPA 2VZUA 4YSRA 2JLLA 4XWGL 1V3KA 3JV6A 1ELRA 2BVYA 4JRYD 2MFNA 1ASQA 3KDMB 1BZ8A 2ATKB 2CKBA 4PVNA 5F7HA 1FJQA 5EUOB 5HHOB 4U8HA 4P9MH 2GYSA 2WPGA 5F0LB 5GGQH 4KTDH 4GI9A 4YNYA 3WCYA 5I6LA 2C9VA 4GQPH 3G6JF 1Z5HA 1CK0H 1D9SA 3IS0X 3ROOA 1RMFL 4XBEH 3ULUH 3P0VL 3NN8A 2XVBA 3CH1B 1OSPH 4TL4A 3P30H 3UG4A 1HI6A 2GTWB 4AENB 3RU0A 3KS0H 3S3SA 5M94B 2O72A 1RUKH 3HC3H 1UXSA 1O6TA 3NIDF 5IWLA 1U3NA 4AXHA 4P2QE 4C4KO 2BRQA 2NW3B 2WTRA 3MUJA 4HIQA 5DQ9A 3ZTNL 5L88H 4PWEA 5LOZA 2OMTB 1NA0A 5EO0A 1UH4A 1NOFA 3CLFH 1OAZL 5DA0B 4MA8L 2GIYA 4OU3A 3VG0H 4BFKA 1J48A 1F2QA 2NNCA 3EOTL 2Q87A 4H88L 1OB1B 5DO2D 2IDFA 1Q72L 3PNLB 2ITCA 4ATWA 2LT9A 5F21B 3UTTB 4NHUA 1ZE3C 2NY5C 5DD3H 4YXKL 1QF2A 1MFEL 4CZ2D 5CEZE 1NI1A 4ZPVA 4Q74A 3D39D 1JWFA 3VD9A 4ZHBA 4PBXA 4MZNE 2YPLD 3MI6A 2X1PA 4HS8L 3SY0B 3U0TA 1FFQA 3QIWC 5KBNC 3SPVA 4UCFA 3WNOA 2J8SD 4OGAC 1BQLL 5DEZA 2W1NA 3CGTA 3QORB 4QOKA 4ZW8A 2VIRA 4QIRA 2VLLB 4EI5A 1H0AA 4KHXH 3GXDA 2FL5A 3P3TA 4XI5C 4YZWA 5GRWA 2Y22A 1QRNB 1YEWA 2ZT9C 5IW1A 3K74B 4XOEA 5TF1H 3B5GA 4PVMA 4MJIE 1IAII 4LASH 3U36A 3JTTB 3LKPB 1RZIA 4PJHB 4WI0B 3BWAB 5I1DB 1S7XB 1KXQA 2NNFA 1G84A 4ZQEA 4RBPK 1MHCB 4HYTB 1QR1A 5FC9A 2VSXE 3T4YB 5I0YA 2VNCA 4WO4A 5I15L 1JXFA 5K93A 4MB4A 2DKMA 4WTXA 3T3PE 1LP9F 2C34A 2VLME 1YMHB 3D9JA 4FQCH 1I1FB 1JRHL 1AYRA 3MV8D 5EX3A 4HPYH 1KT2A 3TJEL 5BQ7B 3EO9L 4ZMTA 1QBML 3H2QA 4Y19D 3S36H 2R1WB 4J6RH 1MF2L 3BG0B 3WEOA 3EADA 4MMYB 4W4OA 6CGTA 3IU4L 4NP4H 5AW6B 1WV7T 3AG4B 5TTRA 2IANA 3HG1B 5D7KE 4OAUC 3B13A 2ZWKA 4HOWA 1N19A 1HSAB 2IGFL 5JW4R 5FYLH 5HBBA 4K5NA 1IKNA 1F58H 2XA3A 4JZNA 2W94A 3AS8A 3WJJA 3P4MA 3RIAK 3GBML 5I1KH 4ZS7H 5EEWA 5CILH 5FLVA 1MQKL 4AYID 1J1XL 3UP6A 3Q5OA 1CGUA 2YC1B 4MJ4A 1DNPA 2WKLA 2JIXA 3HZMA 1JPFA 1SXAA 4ZBJA 3I3DA 2A6JB 3AXLB 4I2XA 1MSPA 4Y4KC 2BWQA 3D85A 2ADGA 3NCJH 2HB0A 4PJGA 3KW8A 4QHKJ 2HT4C 3RGVC 1GJUA 1ZVSA 1NJ9B 1KCWA 2X9YA 3DK0A 5EN2B 3GNMH 4I3RL 3F12A 4AP2A 3ZKNC 4HHAA 3QO1B 3IT8D 4LNRA 5T8IA 5FZQA 5C8JB 1CS6A 3QIWA 4AYBA 4UQ2B 3N6YA 4GQRA 2K6ZA 1T04B 3P77B 1N70A 2V2XA 5J6SA 5HLTA 1IC0A 3IHYA 1ODAA 3RTLA 3IE9A 2C3XA 4JRLA 3SBQA 3U4EA 5CP3H 4N5PE 4IRUA 5I28A 1QTSA 4GINA 4BSWB 1MJUH 3VWJC 3FBKA 3R19A 2FD6H 4A1RA 2VDMH 3IJSA 4BK4A 5T3RA 3TF7C 1P7KB 3OJDB 2UYLB 2P8LA 5D7EA 4B9GA 4Z6AT 5C09E 2N4IA 5D1QB 5C07E 3RVVD 3QG7H 3MV9A 4NQCE 5GZOA 3C5JA 2Z35A 1TSHA 4KQ4L 4OZIE 2DLHA 5DRXB 4Z7WB 3HUJF 1N9PA 4J8DA 5IQNA 3PV6B 1G9ML 4AQAB 1EAOA 2VSKB 4D0BB 1MREH 3RIBA 2B14A 3VXMA 1A7QH 4JPIA 1BMWA 3CU1A 4MD0B 1R5VB 4PTTB 3AC0A 1QWHA 1CVRA 4G8FA 2OCCE 3CVQA 2XG4A 1YCSA 3TWTA 3QP3A 5BUGA 5IVNA 1DQLL 5T3XD 1U8LA 4KMOA 3L5XL 5E00A 3MUGA 2FHCA 2AITA 3T3MB 8CGTA 1BG9A 1D6VH 2CBQA 5GJTL 3IEAA 1HG2A 2W95A 4ELMA 3V4VA 5IBUB 4FABL 2R5SA 5TH2B 3VGAB 2BHFA 5ITBL 2CJSA 1MVFA 1A1OB 2RJMA 5T1LB 3X3FH 2G3ZA 4JRFA 1PD6A 5TK2A 1NFIB 5JO0A 1TU2B 3GBNL 1UKQA 3VD1A 3VXRA 5JIMA 5EF0A 1HSBB 4R90L 2R27A 5I30H 3ULVL 4H13C 3JZ7A 4Y9FA 3OHXA 1Y6IA 1RK1A 5I74B 5TE6H 3C9NA 5BPPA 4GXVH 2ZE0A 3OVUB 4GAYB 4CKVX 1XR8B 2J6EL 2OLDA 3FW6A 2I1JA 3FL7A 4UWHA 1MCPL 2EAEA 1Y07A 1J8HB 3QDGA 3BZFA 4NUGL 2CDFA 1PAZA 4LARH 5GRUH 1QA9B 2XIBA 1T1SA 3R1GL 1SN0A 3L08A 4YDVA 3EF4A 4Y6SA 1X5IA 5KJKA 4K9JA 2ZXQA 4HAGA 3QUXC 1HZKA 3MUZ1 3T2NH 5BXOA 2EDLA 3M7FB 1UUNA 1CFSA 4NWTH 2DQHL 4YFLF 4XPTL 4RGNE 4IS6B 5IVXA 3W5NA 1BV8A 4M1CC 1ET5A 3O6FB 2QSQA 1IEHA 4MCNA 5TDOB 3QJVB 1AGCA 3ZDZE 4WGWB 5CSZA 3ZUNC 1EZVY 3ETSA 5HJGA 3VI3B 2VLKA 4X8QA 1AC6A 2PL2A 2ZYIA 1A3RL 2W8CA 3QUYD 1J9CT 4PRDA 4QLWA 2P8MA 1OP4A 4PWFA 2EZ0C 1A7PL 2YLKA 3UYRL 4IDJH 8TLNE 1HKLH 3RWIB 1XZWA 2CR0A 4YHLH 4AQ1B 4JG0H 1BYOA 1GCFA 1Y3GE 4GFXA 1TVHB 5HNHA 2ZCLL 1AI1L 4FLBA 2CHWA 1M7IA 3HYMB 2AF2A 1XCWA 3K0YA 1IAKB 3W37A 4I3SL 3H7BA 5HHOD 2VAAA 4LHUB 1B0RB 3HN3A 2AK4A 4UTAL 3CZSA 1DBAH 4EHMA 2FX9H 3G5WA 2B9BA 3QHTC 5KANI 5J6HA 4OJYA 4O2EA 2FLRT 3HI5H 3MRRB 2AJUH 1J9SA 3WS6C 1S9XB 5GS1B 5JW3L 4ZPTA 3MPCA 3MJ8A 5D2NC 3L3OB 3Q2NA 1CTOA 1S2EA 2Z92A 3WIAA 1YMMA 4N1CA 2JF1A 3QDMA 1HOEA 2R8SL 3C5SA 2R0WL 2WIIB 3O2DH 1F41A 4PTUA 5E6RB 3LEYL 4FQQA 2IAMA 4JAMA 4PV8A 4YGVA 1GHFH 2PO6B 4JY5H 4DW2L 3F6IA 4QRQA 5C0AB 1K2DA 3OAYK 4P3CH 3S36X 4LCYB 3AG2E 2XFXB 1KYFA 1N2RA 5HKPA 4M8UA 5G5DB 4AW7A 5HHVL 4K3EH 4XMUA 2HKHL 4DT2A 2R69H 1BFOB 3T71A 3OPZL 5LBSH 4YLBA 4TSAH 4J8RB 3UTTD 2COVD 4TNGA 3H1ZA 4WKXA 4XPFH 4YDZA 5LXVA 2Z93A 3ZHLA 1EVUA 4JANB 2AEOA 1T1XB 4UBDD 4XX1E 3S98A 1DDHB 5IB4A 3VB8A 4O2FB 3W0WB 3THMH 5GZNC 4L18A 2BF0X 5F7NC 3ZMRA 3WO4C 4N2QA 4ZQFA 4LMQE 2X4NA 1DQMH 2J12B 1RZFL 4O51B 4RAVB 2LW3A 2X9ZA 3HS0B 4PRHE 2F61A 3HLAB 3AXHA 3TA3D 4GYOA 1NDGB 3QORD 5D55A 2EYSB 4LOUC 1C16B 4JFQA 2E46A 2YRZA 4LBEA 4WJKB 5EZIH 4PSRA 3B2UD 5I0XA 2ERJC 5E08L 1MJ0A 4U8YD 1QRND 1ZA3B 4CGTA 2YQGA 1A9BA 4ODTL 3D52A 4H2AA 1X9LA 5C0CA 1N8ZB 1OTSD 3FBOA 2CCVA 4GTMA 3RWFB 2EH8L 2EXWD 3DI3B 4ZD3L 5IGXL 4YZFE 5IEHA 2WXPA 4N39A 1BIIA 4MXWL 5EYLA 1MUJA 3FNKA 1MH5A 5I5MA 4HKZB 1WAPA 5DJYB 4QXVA 1QHOA 1TPXC 1CJYA 2JKJA 4XBPA 5CMYA 3Q5MA 1ZT1A 5ALBH 5F9AC 3S7GA 5CEDB 3QNXB 4F7MB 3HNSH 3L54A 2H1XA 4G9FB 5E2UH 5SWZE 4DZBB 2WUBH 4HX1B 2Y1CA 3RUGB 3TH3T 3S5LA 4RFNB 2A9NL 4O4YH 5LVEA 1OGSA 3WYRA 4W6XB 4KWUA 4OAWA 1BREA 3CBJB 1BPOA 2BINA 2VUKA 3MJ9H 1WQVT 3HG1D 2F5AH 4MJ2A 4XIFA 3HXBA 3IF1A 1MELA 3ZXPA 3TCXA 1UD3A 2C1OB 5TMNE 2C3GA 4LMQI 2R51A 1T5KA 4EKXA 4X0KB 4E5XA 3A67L 3TIDB 4X4YB 3QQDA 1Z3YA 4XVSL 1JCRA 3MRCA 4Z9KB 3HVEA 6FABH 4Z95H 1EJ6A 1XR9B 1I9IH 3MV3B 1FORH 1UA6H 3QUMB 3D2UA 2VKWA 3GMRB 4K7PY 5JW5A 4XGZA 2TRYA 4ODHL 2D3LA 1HHHA 4G80A 1QI4A 2NNXA 3QS2A 2F7OA 5HPMB 2HUEA 1N4PA 3QNKA 3SDCA 2XQBL 2YQ3A 3D4YA 4P2OB 3UJTL 4PJ5A 2OSYA 1MY7A 1SFDA 3AREB 3G6DH 2JCXA 4D7PA 4R4FH 3ZLQC 5F3BB 5CEYB 4LCUB 4N8VB 4GRWF 1RHFA 3WXVL 1E8YA 3LS5L 3BP6B 4EZLA 1QW9A 3Q01A 5A2AA 3OKEB 4PJAE 4UM9B 4KXAA 2XKNA 4Y16C 1AFVL 5JXED 5SX4I 2HT2C 3FU0A 4KAQL 3EYFA 4OZHB 5I6KA 5HXMA 4R4ND 3CSYB 2XWCA 5KSBA 3T8DA 4OCYL 1MHEB 3PL6A 2K9FB 4NN6B 3UM1A 4ODSH 3WAJA 5CO1A 3GXNA 2N7AA 3GJFK 1AD0A 3NJHA 3UP1A 5CCMA 1HINH 2B0SL 3L1OH 2R7EB 2XXGA 1AH1A 3N44F 3Q7FA 2HYZA 4HU8A 2Z91B 5FF6B 4NFBA 5A16B 3II1A 5D1QD 1K4CB 3UMVA 2WQVA 3ARBA 5C2BH 2AXJA 5CLTA 5E4EC 4R83A 5DYOA 4WNQB 4CW1A 3AU1B 5CEZL 3SDAA 5HDBF 2F68X 1YEIH 2W07A 3NJVA 3BD4A 4AIOA 4R8WL 1UXLA 4NT6B 4RQQA 4FNRA 2FEZA 2D7QA 4AEIL 5FB8B 2AJXH 1RLBA 2VITB 4YHKL 1OWLA 3SYCA 3K2UL 2Q2EB 4TULL 5E5MA 4N0CC 3SGDH 3WXWH 1LWRA 3VTYA 3LN5A 5E7FA 4UNIA 3QJOA 2WSPA 2FO4B 1GYWA 3QDJA 3SGHA 2IH3B 1D8EA 4LNUD 1NC2B 3DROA 2WZFA 4NM8H 3HMXL 5E9DB 1PY9A 2NUTA 2J2ZA 3RI5F 3TTYA 3SDDA 4FCAA 4PIBA 4YSTA 1OAKH 2PW1A 3O3AA 4MWFA 4U7SA 3G2UA 2W65A 3NQYB 3VQ1C 5T1LD 4GMTH 1VZHA 4JUSA 4K0RA 2K1MA 5HI4D 3IGLA 2J5WA 1ZV5A 4M3KB 2VISA 1XGQB 1BM3L 2FQGA 4I77H 3P7VE 3D9MA 3FCTB 4BK8A 4K9EH 3VFRA 1VKXB 3B3BA 3MNVA 4Y5VC 1QWNA 1CZ8H 4B27A 4HCRH 3X12A 1L9MA 1J8HD 4QCIA 4MQ7A 4ISVB 5BRZB 3EH2A 4K89A 4MXQC 1QVOB 1FC1A 4Y16A 3P3YA 5HGGS 1CFTA 1GZPA 3W5MA 3MROA 2DQUL 1JHTB 4GTTA 1S5IH 5EU6A 2IO3C 1AHWB 5FO7B 4D10C 1ID2A 5ANMA 1MIEL 1T5WA 3GXTA 1G7MA 4PIRF 1YSOA 4JHZA 2XZAH 1BOGB 5DZLA 2CM6A 4H1LA 2A7OA 1S0PA 4BH8B 3O6FD 4LXFA 3GM0A 4I43A 2NY0B 3PY9A 1KLFB 1YYLH 4B9PA 3G04A 1TO4A 5JUEL 4BKXA 4F7TA 2H6IA 3VFUA 3VVWA 3REVA 5D7IE 1H6KA 1FP5A 3MQIA 2DLFL 4CA4A 4HIHA 1J05B 4YUEH 4M6AA 1ZLWK 3X2QB 3NZUA 1AGDA 4QDGA 1U6AL 3W39A 2Z7YA 1EPFA 3N0PB 2CWRA 3UT8A 1IBGL 3MNDA 4JPKH 2PMZA 4L4TB 1O0VA 3DO7B 5B4MD 4P23C 3DNZA 1UCBL 2CALA 2WYTA 3WE6A 1F3RB 4G7SB 4JN2A 4LHUD 1AE6H 3VXUA 3OR6A 2Q3ZA 5D2LB 2H6UA 2UWEA 3HA0A 3V4PB 4PVLA 1SOQA 4LPCA 3B2VH 1D6EA 4LF3A 3TH2T 3LIUA 4N2IA 5AQ7A 2HLAB 3ZHEA 2VDNB 5JC1A 3X1FA 1N18A 2VJ8A 4HWBL 4OD1L 2V9RA 3DMMC 2IPTH 3X13A 3ZQXA 1B0IA 1PIGA 4NO5B 1OE2A 4PJGF 5EPMA 2QSCH 1H3XA 2YD6A 5DSCA 4JKLA 3LPPA 5I0VA 2JELH 3V95A 3T77A 2VXQL 2JKTM 4K03A 2PO6D 4LSSH 3SOBH 2R17C 2GI0A 5C0AD 1JWMA 4X6CA 5HYSG 3NZHH 5HI3C 2HTLD 4UQ3B 4GAGH 4F7EB 2V8SE 4QO1B 3GKWH 1JGVL 2YGPA 4K0OA 2NW2A 1KJVB 3BD5A 5IB1B 2MKWA 4HJJH 5E1GA 2RG8A 3ZI6A 1NCBL 1Z66A 4NJAL 2A6KB 1CGWA 4YIQB 1PD1A 4RESB 1X3DA 2OX5B 2A6DB 1PJWA 2XTJC 1BEYH 2YHEA 4V1DB 2SEBA 5B39B 4KITB 1UA3A 5JMRA 1ZHBA 4XN8A 4FZ8H 2FAUA 5HY9A 1A6VH 1T7VA 4JKPL 3SKJL 2IEJA 5ACZB 1U21A 1Z9SB 3I2CH 4HALA 1EEZB 3MS3A 1SJHA 1IGYB 4JPWH 4POZD 4U1LA 5ESQB 5T1MB 4R2GB 4HH9A 2OXHA 4HFUL 4LCWB 5L4MA 5DHYA 1Z3GL 2ED8A 3NA4A 2DWZA 4G8GE 3ULVC 1UXMA 2QJDA 5AQ0A 4ZQGA 5IY5B 1BBDH 2J8UF 3F7YA 4KV5F 4ZUUB 1YYCA 5DQJB 1UW4B 5EU5A 3ZYLA 2DQIH 2D3VA 3K5SA 3KYOB 4JKMA 5K9OB 3LV3B 4MJJA 4HT1H 1G7HA 3PAZA 5JPNA 1BQHG 4AKOA 2XPZA 2P9RA 2HO1A 3I02A 1IGJA 3QEUA 3X1NA 1ZWIA 3KXFE 4OCRL 2V2TA 2N0KA 4NRXB 4N2DA 2ADJB 3U6XS 4GG8A 1S7UB 4NN5C 3RFZB 4IK7A 4BHUA 4MD4A 4LPUA 4BTAA 1I9EA 2E74C 2YXVA 3OMZA 5C0IB 5D5ME 4DCQA 1JE6A 4UILL 3MLPA 2AMGA 3ULUE 2DS4A 4MCYB 2V9QA 4RRPA 5GISL 4UQDA 4G9FD 5FV2A 4BGDA 3GMNA 3TBTB 2DIWA 3BH9B 1P2CA 1T1WB 4Z7UA 3KPMB 5IMOB 4JFDE 4OB5H 1CFVL 2NNAA 2WLIA 1G7LA 3KEAA 4G8AC 4GXUN 5BVPL 5HYSB 1ASOA 3VFNA 1I3GL 1YNTF 5I1LB 2P47B 4DP6X 3F00A 5A1AA 4AKPA 1NGQL 1DTUA 2YSTA 5KYUA 1K5NA 3DUSA 3VXQB 3GSRB 4XC3L 1CGTA 4DO5A 3COOA 5CRUA 3DVIA 3L1FA 3GDCA 3LY8A 1WAAE 2XN9D 1CFQB 3S2CA 1RUMH 2XG5A 3WFBL 2AP2A 3MRDB 4S1SH 1NICA 2PGGA 4UT6L 4X98A 4TNVK 4LKCA 3MMEB 4HG4J 1UZ8A 4F37K 1XDTT 1WWCA 5AL8A 5DWUH 3TA3C 3VFGL 4DUVA 4DHLA 4RNRA 1KJ2H 4KJQD 5JORB 2OR8A 5IEKB 4P2OD 1TMNE 1VRSA 5H4ZA 3ARED 4K3HA 4LSZE 4IGBD 3A21A 3U6RA 1SW6A 4KQ0A 1BAWA 4ZSOA 2WKGA 2MKLC 1VJSA 3LEXB 4L1HA 3IBOA 4NQEB 5CNHA 1NPCA 2KT6A 1EAPA 1H2TC 1U8JB 4YVOA 1JGDA 3KG5A 5K5YA 2IONA 2YRPA 2P48B 2DWXA 4XMVA 2CG3A 4UM9D 1PDKA 3GRWH 4IBYA 1UYWH 4YSCA 1Q9KA 2J4DA 1LK3H 3EGDB 5JDJA 3H0TB 1ET8A 2XRYA 5K9JL 2P5WE 1ZOXA 3X1EA 2A9CA 3JQ0A 2J6EA 3KPOB 3BPOB 3JV4A 2ZSWB 2J44A 5G04C 3UBXB 5I24A 4TRQA 1GJIA 3G7TA 1CLOH 1J8KA 1FN4B 3MLSH 5MEQA 4GXFA 3ISRA 3PQYB 4YC2C 1AZBA 4D0CA 3VH8G 1OP5H 1J5OH 2ZG3A 3MRLA 1NMAH 2Y1YA 5DT1H 3CXHJ 5JHBA 2F2HA 3BGMA 3VYOA 2Q7NA 3U4BH 4LCCB 3QJXA 1ADWA 4RCAA 3LCYA 2WZGA 2YPKB 5IROA 3RVWC 2EUWA 4W70A 1IBBA 3GBDA 3V10A 4PP1D 2X2YA 1LDPH 4Y6RA 2DQEL 3HHRB 3FQNB 3BSZA 4B93B 4PP2A 4OGXL 4HKBA 3SQOL 3E32A 2M8XA 1CLZH 2NY6D 5AWNL 3TBSA 1JPGA 1KCSL 2MYOA 2EDQA 2XT1B 3LH2H 4PJCF 5FYLE 4ZW5A 3T65A 4OV5A 2FI7A 5E5UB 4PY8J 4X4ZA 1Q2ZA 1HH6B 2UXGA 4NSKB 1KGUA 4MA7L 3TM6A 3L7FA 3KGUA 5DTFB 2E9IA 3V5HA 4U63A 1I3RA 3OXRA 4YSAA 3QYMA 1WG0A 5IHUL 1W3BA 3FOMB 1A5FH 1JZ3A 1E5BA 1DUZA 1ZV9A 3FHEA 5CLZA 4QYOA 5GGTL 2H41A 4UTAA 1NC2D 4OJEH 5E9DD 1U30A 4TUJA 1YG9A 1RIUH 2IJGX 1TJIL 4XOAA 2FGWH 2LR4A 3TIEB 2YAMA 2Y7SA 4ICXA 4LRIC 5LQBH 1QSFE 5K39B 3QXVA 4E85A 2GJ6E 3WIHL 3KLDA 3FY4A 1UN9A 5LNGA 5EOCH 3HRZB 2FR4A 2KZ1B 4L1DA 4Z76B 1NM9A 4UWKA 3QC6X 3UYOD 4Y4FA 4L37A 4OGYL 3O3EB 3KVPA 4XR8C 1JGUL 4U8VD 1NIFA 2PWDA 4XPBL 1T66D 1HAWA 5FSSA 5CAYB 4KNSA 5AQBA 1I3UA 2XCBA 3H9ZA 4TPRH 5BRZD 3L4TA 4PJFF 3N41F 4NQWA 3QRGL 1JPTH 5ILTH 1E8XA 5D1QC 3K72B 1IGCH 2BMKB 2I25N 1FYTB 5JW4M 3Q9QA 4K8RD 5I76A 4IHBA 3LZFH 2ALAA 3L95A 1EH9A 2YZ1A 5EBLB 1NLDH 4YDYA 3LIZH 4R0LB 5C0BB 1MZCA 4G42B 1PKOA 3RNKB 4KJPD 4L29B 3S3DB 4EUPB 5MHSD 1F00I 4D3CH 2NY0D 5BOPA 1IGTB 1X4XA 2LXMA 3VAEA 4QRPE 2YPLE 5G4OA 3CZNA 4PR5B 4B5ZA 5FW7A 5J3HC 1OHQA 3MRBA 1W0VB 2FULA 1FG2A 3MRJA 3HAEB 4M1DH 1NAML 5L8KB 1RAMA 2B8OT 2QSTA 2R0KH 2VRKA 4ZFZA 4L4TD 1ZLDA 1DQJA 1D7DA 2O5YH 4OV6F 2PTVA 8FABA 3V79C 4Z3GA 3R8QA 1QO3B 4XOBA 1FVEA 3IDGA 4WCYH 3QGOA 3F64A 3FQ4A 3GXUB 1MJ8H 2IBGA 3ZQ9A 3V6OA 5HP5A 3GMOB 4XZUB 3EDDA 5JPMB 1A9EA 3I85A 3M1OA 3KD4A 3TYFB 5LWYH 1OZTG 3MV8E 4KRMB 3GMMA 4Y89A 5IVZB 2A6IB 1DJGA 2OMUA 4N2SA 5HYJB 2BSDA 3T4AB 5EU7C 1IKFL 4UQYA 2Z1PA 2QQLL 3CVBA 3VGDA 3I5PA 4P3DA 4Y19E 4B0MM 4GZ6A 4N5CA 4JJOA 2EIJE 3ATEA 1S9VB 2JJWA 4PJBA 2O6FA 4PH8A 5D6CB 4HUXA 3BP7B 2ED6A 5I73C 3HNVL 2AXZA 3VGEA 4Z1PA 2A73A 4LDCA 2EGHA 4LFHG 5K59E 1BFVL 3IGUA 4B9KC 3GI8L 1N0LA 2WGNB 1DL7H 2WXLA 2CHXA 2ZU6B 3NABH 3T08A 4ELDA 1BD8A 5T3ZL 4XNBA 3QHZL 5KSBF 3D09A 1TLIA 4V1DD 4YO0B 3MLXL 4LLAA 4EIUA 5IHLB 4PV9A 3LB6D 3T0XA 3MLRH 4ZN6A 2QPSA 5ENQD 4X9BA 5CR1A 2VN7A 3FBQA 4WTWA 1FJTA 1DVZA 4R2GD 3ULYA 3D9AL 4LCWD 2A5EA 1XVSA 4HUMB 3O4LA 4YR6A 3TO2B 2F08A 4R3SA 5IR1B 4ZUSB 1AACA 2XV6B 2XTSA 4W68A 2BSBA 1TLPE 2Y1AA 4M61A 4K7PH 1FNEB 4X8GA 3L4CA 2Z0BA 3NCCB 3G5VB 1G6RL 2CH8A 5DS8B 3AMKA 4G82A 2Q86A 4IRJC 2XPIA 4LBAA 3N85L 5AYWD 3GSUA 1FJ1B 4AL8L 1DLHA 2CO2A 4DP9X 3DVGA 4IRZL 4G6ML 4AR1A 2R1XB 5L2KE 3OKDA 3M88A 1A6TB 3LXBA 4P2QA 1I4FB 1PL3A 3J07A 1RXLA 5GPRA 4XXWC 1E9QA 5JSSE 3EGSB 3WN5A 4EBQL 1D5BA 4U1NA 2DL2A 3BJ91 3BP4B 4CN4A 2DMGA 3EDEA 1QAWA 1NZRA 1AGEA 3T09A 3NACL 4K8RH 3DX7B 3RTQC 5LFAA 1F1AA 3KPRA 3MV7E 4MRCA 3VSVA 5B7FA 4J4PA 4NKIL 4N0FB 4PJXB 2HVBA 4U7EB 1HL5A 1TMCB 3ABZA 3HE6B 1JHLL 1UGKA 1G7JB 3UADA 2YQBA 3C60B 4KXDA 3BEVB 4PVBA 5C0FA 1LO2H 5EV7A 3IGAB 2DM3A 2V17H 4HP5A 5HGHA 5DJ6B 2HX7A 4K94C 4D8OA 4OW6A 1ND0B 4GPVA 4LG6A 5T1JA 2X41A 7CGTA 4POZC 3DO1A 4X80H 4F93B 1H3WM 2F19H 4HSCX 3QXDB 4QTHA 4NNXB 2LUHA 2CJUH 4JNDA 2WMPA 3HS0C 1CG9B 5TPWH 4Z77A 3SSBA 3GMQA 2PCYA 3KPSB 4MJIA 1LE5A 3Q5TA 4FHKA 3O9WB 3GXPA 4F2MB 2JV6A 4M6NL 1MKFA 3HMXA 4ICWA 3HXDA 1J7VR 4FL4B 2WLJA 2ADFL 4GMRA 2IFGA 3Q7AA 1HJCA 4GOSA 3V4PH 1FBIH 4NUJB 4MBGA 1ZLUH 2YS4A 4WKZA 5EF2A 2VDNH 1A14L 4MNQE 4NQED 3C5RA 2HRGA 2VM3A 2P42B 3CBRA 4WI5A 3FEYA 5I19L 1VPOL 2FHBA 4CXFA 2ZSVB 1IC5L 3JUYA 3KLAB 4JS7A 2WTOA 3F84A 5F9JB 3IS1X 4N0UB 5DMYA 4DI3A 2QVWA 4CJ1A 2XX0A 1WO2A 1RJCA 1N59A 3DSSA 3P2BA 4YNDA 2G30A 4GI6A 1UT9A 5DK2A 3N1GC 5B38A 2I60L 4L8CA 1GGBH 4A3TA 5KVEH 4WK0B 1GC1L 2P9NG 3CQQA 3EJZD 4HGWA 3BVUA 1BZDA 2NYYC 3PQYD 4RFNC 1QFUL 1BXUA 3NJGA 3GZPA 2R29H 5A7DB 5A2JH 2CNYA 1KPVA 3Q2LA 3MODL 4YAQB 2KCVA 3FRPG 3P7WE 3MCXA 2J43A 3FO9A 2ZICA 1M2VB 5BW7A 3O11A 4IBLT 5I2IA 3MGTA 3II2A 4TL5A 2G5BA 4ZXBB 4BZ1H 4YOKA 1S6NA 5CJ8A 5MI0C 3OC5A 4J3OC 4XP4L 2X4UA 4YXHH 5C9KA 2HX8A 3DEPA 4N8CH 1P0SE 1SBSL 4HKJB 4DKEL 1TDQA 1R24A 4HMEA 1AGFA 3G9AB 1YRKA 2NY2D 2ZUQB 1FAKT 3P9LB 4ABVA 2WUCL 1QWUA 1OSYA 3ANMA 2A9AA 4EMZA 4M6OL 4QGTA 4PWHA 2DN7A 4IGBC 5E1AB 1AC0A 3IMTA 5C0GA 5G4NA 5EUOE 2ZGDA 3ZU7B 1VCAA 3M07A 5BO1H 1MCHA 3II3A 4DESA 3U0PB 3FORA 1A6AB 3IWVA 4P9ML 4J8FA 2XACC 1SEBB 5GGQL 4KTDL 5LDSA 4ANUA 2GTZA 2V5SA 3QXTA 4RGNC 4BKTC 1EEYA 1CK0L 3N9GL 3TU6A 1AKPA 3LKNA 5F7AA 4ZW7A 2G2RB 4FNQA 4NZJA 3ULUL 4BFJA 5A2BA 3BQUB 5LAXB 3RHWF 1OSPL 3NMEA 3P30L 4AG4H 4DZ8B 2VXQA 4PREB 1DQQB 1TTBA 3N1FC 3NGBB 3RAJH 5D1ZC 4HFWB 1RUKL 3HC3L 2MNJB 1R3JB 1RJLB 1FYHB 1ZJAA 4M9OA 5C07A 3DJ9A 5C09A 4PGCB 2MIZA 5L88L 2VDOB 4NQCA 2QADC 5F72S 4EECA 4Y9CA 3BQVA 3TJHC 4LDLB 1N0QA 3CLFL 4QHUB 5CGYC 3ELAT 1MI5A 4I5BA 1FYTD 3VG0L 4Z68A 1ETZA 3UTMA 2ZAIA 4WU7B 4XE0A 3WKPA 3PREA 1LWHA 5I18H 1E3FA 2CIKB 5IJKA 2NY6C 3LEWA 5C0BD 5DD3L 4HJSA 1U8NA 1N5AA 2KDGA 4JGMA 4LLYB 4TOYH 1U8PB 2X2HA 5KOVC 3V9EA 4AV0A 5A2CA 1TRLA 2IY0C 4KO9A 1HYRC 2XEHA 4BESA 2C5DC 2H8PA 2IGTA 2P5EB 4JFZH 4RMQA 2AQ1A 4WY7H 2HLFC 3TYGH 5CIPB 3FSAA 1O7VA 4IOIA 4FMKA 2YD9A 2FEDC 1QRNE 2ZX9A 5AD0B 4QRTB 5HGAB 1F02I 4KHXL 2R2LA 4WLCA 5IW6A 4YHYC 1XAUA 4HUUB 4K7PX 1FUNA 3CZLA 3UZQB 2ZXEB 3BUPA 3DX9B 4F92B 3RWDA 1BQBA 4LASL 5I8KH 1UACH 3W2DH 3CHQA 2EKSB 2H3NA 1L5GB 3LSOB 1QFWH 3PGDB 5ID0B 1TYQG 5EO1B 3LZQA 3TBCA 1H15A 4JHJA 5ESAB 4FQCL 3ZL4H 5HYJD 1UWXK 4LLMA 1UB6B 1A1NB 3HNTH 4HPYL 3STZB 4KO6A 2AJZB 3VXTB 3LQAL 3CLEH 4BZ2H 2XI9A 1XGUA 5F9WC 3S36L 4JREC 3ZYKA 2JLPA 4DGVH 4I0PB 5D71L 4DUIA 5FA4B 2JCCF 4MGXA 3AG4E 1HHGA 1NCNA 2XV2A 1H5BA 4U1JA 3HG1E 4NP4L 4TLIA 2KLTA 4M4PA 3ULVF 2I07B 5DUMH 2WWOA 1YLBB 1FV1A 2J88H 4KJPC 1E5AA 5FYLL 1KB9J 2ZUSA 1GVIA 1KUMA 1TZIA 1F58L 1MXDA 1MFCH 1WCBA 1R1CA 5LCWJ 2WP3T 3O2VH 4UT6A 5BZWA 4DP4X 2A0LD 5I1KL 4ZS7L 5I9QC 2EUVA 1OY3D 5CILL 5HI5D 1G3NB 4JRXE 4F9PC 3O2WH 3BSGA 1MCRA 5CJXA 1E28A 2Q76B 4GUQA 3SGDI 2HMID 1JDDA 3RWJA 5C2UB 3NCJL 2J71A 1RVFH 1B0GB 3IXTB 2ZX6A 3CHPA 2AJVH 2OL3H 5JMWA 3BDXA 3W9DB 3V4LA 2OI9C 4HF5H 4B3EA 1IBHA 3GNML 3L3GB 2Y9RT 5FDWA 1QSEE 5F7DA 3VNYA 1HH8A 3GLEA 1LK2A 3AWEA 5FKAA 2EDTA 2HT3C 3SKOA 3OGOE 1YYHA 4FTVB 3B83A 1L3NA 2WLYA 1ZPLA 5KBKA 3FKUS 5J0BA 1KTLB 1DJZA 3GB7A 2VLAA 3TO4C 4P46B 5F7EH 4JLRB 1DFXA 4LL4A 4MS6A 2D2OA 4WHTB 3VE0A 4FMVA 2X4PA 1GSMA 4NLAA 2EE6A 1PLAA 2ZTBA 3LHPH 4D9QE 3QJZA 4PJDE 4X7TB 2WPVA 1MJUL 4PS4L 2HTKD 1RK0B 1NFDB 2FD6L 4RQIA 3P2DA 2VDML 3T6QC 3FT2B 3OBAA 3UH8A 3EYUH 4GUOA 1MVYA 1WA0X 1EV2E 3AY4C 3IDXH 4L8SA 4ZS6D 3V0IA 1IBZA 2PCPA 2X2IA 2A4CA 3HE6D 4MASA 3ZRFC 5IHWA 3V0WH 4A7VA 4EUPH 3P9MB 5KAQG 1WTGT 4Y1SA 1QPKA 2XBDA 2VSCA 3QG7L 3PJNA 4P2CG 4Z7WE 1DVFB 3C60D 4U1SA 4ADIA 4PRPE 2QEJA 2H4EA 2JI2A 3F7PC 4N9GB 3UTPD 3P7UE 4FLRA 5BS0E 5JBIA 3CDGA 3ESUF 3NFSH 1H2VC 3RRNB 1TQBC 4PJHF 4RMRA 3PHSA 4ATTA 3HAEH 1MREL 5KBLA 4HMDA 4YEEA 3QVAA 1A7QL 4FXKB 3ARDC 3S3PA 3FB8B 1AZUA 4NWUH 3T3ME 4YHOH 4OF8A 3KPSD 3O9WD 3IVKB 1T7XA 1JGLH 5GGTA 3RVUD 4X4KA 2WO2B 1SF3A 1D6VL 2VGLM 2XHNA 3VXNB 4EPSA 1WP6A 4PS3A 2P8PB 3QIBB 4FHBD 4WF7A 1JGEB 1GS7A 3V0FA 3WEXB 3C5ZC 1LO4H 2WVVB 3HR5A 2CJ3A 3WIHA 3ZFWA 3NBNB 1TEZA 3X3FL 3BHBB 5DS2A 4M93C 2J5LC 4YSQA 1I7UA 1KIRB 2FJHA 4QHMA 2ZOLB 1YAIA 5SWZA 3S3CB 1KYAA 5AKSA 5I30L 4KX7A 1CB4A 1HU8A 1OF0A 4CCAA 3S7JA 5TE6L 3I6KA 4GXVL 3QQNA 2ROYA 4H26A 5INCB 1J8HE 5IHZA 3PZ3A 2O5XH 2PTTB 3LH8A 4HD9A 4N3TA 3T0BA 3CDZA 5GRUL 4LARL 1Q8MA 1YDPB 2EEAA 1R4XA 1ETJA 4RX4A 3NJKA 1TCRB 5CUSH 4ANKA 3WHXB 2P46B 1YYML 2IVFC 1M4KA 3VXSA 3SBSA 4LEUA 1H6TA 4DVRH 1U3ZA 3T2NL 3LS7A 1QHQA 4NWTL 1IM3B 4CSTA 5KYWB 4JVPA 5ICZB 4FNTA 1EGJH 1RZ4A 1QSVA 2XV3A 4ZXBD 1V27A 5ICXA 4HXBH 3CFJA 3BAEH 2YD8A 4KRNA 3QI9B 4OUUB 2BM3A 4OFYD 3TNMB 5E6ZA 1WUNT 2PNNA 4GYYA 4TYUA 1HDMA 1ZGLA 1NAMA 4IDJL 1HKLL 3WIFA 1M1XB 2IPUG 1OTUD 4YHLL 2NSZA 5DLML 3AQYA 3CWGA 1JHKL 1EBPA 2PCXA 4UZUA 2DJMA 4PJAA 4HZLA 2K6WA 3D07A 4FXGB 3TWCH 3V7MA 2BY2A 4W93A 1A7RL 2C3VA 3MSPA 3SBWC 5JYLA 2GCYA 4KKBD 1GGYA 2XXMB 3STLB 3PGFH 1DBAL 2FX9L 3PHOB 2Z31B 1U8MB 1OF2B 3HI5L 2AJUL 4RSVA 4FNLL 3BPOC 4X6DB 3BQUD 2MJWA 3VFTB 1X9QA 4V33A 4ALAC 5KJLA 2H32A 5TLNA 5I75C 2ZKYA 3PV7A 1Q4NX 3O2DL 5CSBA 4AJ0A 4Y0GA 1HF8A 4NENB 5DJZA 1WZLA 4TQIA 1GHFL 2PUSA 1A1MA 2HP4A 2BIQA 4P5MA 4JY5L 4APQB 1UQSB 2FZ3A 3RRUA 1I8IA 1OCCB 1E9OA 4JCWA 4LSDA 4YPGB 2IOMA 2M2DA 4X6BB 1LEGB 2OMYA 3N50A 4Z5RA 3ZGHA 4K3EL 5F1NB 2LAHA 1V8HA 4DPAX 3VWKA 2R69L 4NQ0A 5LBSL 5JDSB 2WNXA 4XPFL 2LOEA 3W0WE 1TF4A 1JOIA 1IBYA 1IEBB 2NY2C 5D7HA 5LGHL 3THML 2LTQB 1UD2A 2EIZB 3MR9A 4OLVH 2ZOKA 4CVWA 3DO3A 5AAPA 1VCBC 4JHAH 2P5ED 1EX0A 6TMNE 1IC1A 3FQUA 4JO5A 1DQML 2KPNA 3RA7L 5AAMA 1BZ9B 4ZX5A 2MEJB 3KE0A 3VXOA 1YJDH 4OZGB 3QQ3B 1XF2A 5E51A 2NYKA 4LSRH 5EZIL 1E50A 1SNRA 1G6RA 1UH2A 4XN4A 2RGSA 3MLTA 3NN7A 1AQKH 3WKQA 4PJ8B 1GGCH 3BN9D 1T7YA 3VQMA 2LVEA 1RUAH 5D1XC 4IRZA 4OKVB 1Z6JT 4AE0A 1ZSDB 2BSEA 4PHZA 4D91A 1NM4A 4FYSA 4PW4A 3HRZC 3OX8A 4JY6B 3IJEB 4X7EC 1IUZA 1TQTA 3X11A 1MVUB 1M1SA 5ACMA 3BPNB 3HNSL 5I5IA 3CFUA 1G7IB 1KDJA 1MHHB 4WU5A 1BXVA 5E2UL 3TPUB 4AR9A 3NIGE 1I75A 4YK4B 5HHNA 3RUGE 2WUBL 1C08A 4I0PD 3L4UA 4O4YL 2GSIA 5DI8A 3MKQB 4XCFH 2C9RA 3GSVB 4ZW6A 2W80C 1MLCB 5K9QI 3MJ9L 2X6JA 1IHBA 3AJIA 3IDIA 5J9PA 3A14A 3MRMA 5EIQA 1JNHA 1MCSA 4ANXA 2OVBA 1RJYB 3FFCB 1R0KA 4R5VA 3MRNB 4G71B 5D7IA 1JK9A 3L4XA 3CZUB 5E4OA 5CGBA 4ELKA 4NJ9H 5H7PA 5CD5C 2WVSA 4XMLH 1NFKA 3WV0A 4Z95L 1I9IL 2CLVB 1FORL 1UA6L 2GHWB 2KXPC 3MRIB 4WI3A 1QQDA 5DK3A 3SE8L 3ULUC 2BTDA 1NINA 1A6WH 4PRAB 3R06B 4U07A 4IKIA 4PJ7B 3G6DL 1QABA 1YUKB 3DRAA 2EEFA 4BT8A 4FE9A 4JFFE 4R4FL 5EZJA 3I75A 1HQ4A 4NRYB 1MXGA 1MCIA 1XWVA 5I1IH 3Q43A 3PH0C 2IALA 1T0MA 3C08L 3DGGA 1U8OA 2Z9TA 2OTUA 5TJWK 1UENA 3K6FA 4FTVD 4WEBH 4G24A 1BZ7B 2X1QA 4ZFOB 1MCNA 3U2JA 2ICCA 4P46D 2VDOH 3M17B 4LK4A 1QACA 3WTUA 2KQMA 3NIFB 4GSDL 1D5XB 4ODSL 1KPSB 4UU9B 4Z0XB 2X28A 3O6MH 1QZ2A 1HINL 1BVLA 1MZYA 5EIBE 3MO1A 4KVNL 3K4ZA 4E5XG 1YN6A 1HH9B 4P2AA 4HW6A 2O61A 4FGMA 2X42A 3QRLA 2BSTA 5FAAA 1JDCA 2CR3A 4CVXB 2WNGA 5MENB 1O5PA 3CHSA 4Q0XH 4NQDB 1H19A 1DVFD 5C2BL 3CAFA 3OKMB 3PWVA 1AS6A 2R1YA 3C6LA 2F8XC 43CAA 1PCXA 1O6SA 2A0LC 4HKXB 4MLPA 3DURA 3Q44A 2XZTG 1YEIL 2K6YA 4J1UB 3KCPA 4G8GA 2UVFA 3BFWA 2YQ8A 4FEIA 4KK5D 3UGXA 1M42A 4KUCD 4RMVA 5FCUL 4Z7QB 2AJXL 1FFNB 5FFOA 4BIKA 4MMXB 4OZIF 3EJYD 3IE4A 1Y18A 2FCBA 3VFWB 4HJEA 4W9EC 5L4IA 4M02A 3VXPB 3KXFA 2AS5M 5E9DE 3MCKB 5K1VA 2JLBA 3LQAC 2W38A 3SKMB 3JT2A 1MHQA 3C3QA 1PBYA 1UM5H 5CZVH 4NM8L 5E94B 5K1NA 4K5BA 3QIBD 4WWKA 1P4LB 1OAKL 5D5MA 2BNQB 2B59B 5EN5D 1QFOA 4NC1C 4N26A 5D8JL 4N9OB 5B3SB 4QRSB 3OGCB 4GMTL 5FXNA 4I2ZA 2KM4A 4OAVB 3ZHKA 4DN4H 1AKJB 3ECWA 3LNDA 4O6FA 3HG0A 4U6TA 2GKIA 2YWZA 2DJUA 4I77L 2K78A 3VFMB 1YY8A 3NCXA 1D9KA 5J1AB 2CDGA 4K9EL 2JJUA 3UT7A 4MVBD 5I26A 4Q9CA 3CCHB 5BRZE 1CZ8L 4J3OF 4HCRL 5DJCB 1O7SA 3QULA 1ZVNA 4YBHA 3VFPB 2WTPA 3R4DA 2AVPA 1TR4A 4F7PB 2AV7A 4YBQC 4KZDH 1N11A 1ZS8A 1KCBA 3QJHB 1MX4A 3ILPA 4K3JL 1S5IL 3C60C 2V7NB 2JK5B 1WAAA 3D9KA 1ZTXH 5GSVA 1IM3D 2P9PG 5MHSE 1I1YB 2WYIA 4MCZA 2XZAL 5JOFA 3HRPA 2BVQA 1NBYA 3PABB 1YYLL 3PFQA 1A21A 1ANUA 2NXZC 3QI9D 4H8WH 3GGWA 4KKAD 4DP0X 1HHIA 4XMKL 4OBSA 1HYTA 2BXYA 5E8DH 3X2QE 2BZCA 2ZKHH 4LIQH 4Y5YA 3EYVB 4JZJA 4PRBA 4BZYA 1JZ6A 3RVUC 4YUEL 1YZZA 3ZKMD 5K1JA 3CSFA 4IBQA 3U79A 3T87A 4HDIB 1AY1H 4TS6A 4JA9A 2IDCA 3BIAX 4Z7IA 3KPQA 4JPKL 5EB9A 3MNWA 2DCPA 3SQBA 5KS9B 4ZOBA 1NGZB 3BAIA 3E6FB 2P5WA 1IYGA 3MBEA 2HWZH 2Y0SA 3BKCL 1UKSA 3GS0A 5F6IB 1AE6L 2ZJSH 5JIIA 1E2VA 5ELIA 2Z31D 3U66A 1LYQA 4MJHA 3FQXB 4PGJA 3VI4B 5HRYA 5IB3A 3B2VL 2CO3A 4IMKC 4X4ME 5F97E 5JIQA 5D7JB 3FCQA 1CT8B 1INQB 4CAGA 3GJEB 5DVKA 4LCVA 4JUTA 3E9TA 1KIPA 4U0QB 2IPTL 3UX9B 1L9QA 1L0YA 3WEAA 2X6FA 3MJGX 2QSCL 3RZCC 1BJ1J 2OJZH 3E30A 4H1LG 2JELL 2AI0H 3IDMA 4C55A 5KVEE 5IZ7A 2AEPH 2Y7LA 4GQ9H 4LSSL 1T21B 2Z4TA 3SOBL 4APQD 2PW2A 1WCQA 3PPSA 4IU2B 3D0AA 3NZHL 3DIVA 4GAGL 2KMWA 3GKWL 4R97C 2VLJB 5I5JA 2RMNA 1FL6A 1OT2A 1V3JA 1LJMA 3IKOB 3ZEFA 1NGPH 4HJJL 4V1DE 2XNAA 2XZZA 4ZXBC 1TFHA 5BXFA 1JN6B 4WFGD 4GIPD 1BEYL 3RBSA 5KJ7E 3J5QB 3HCVA 2JWYA 2R0ZH 1FVCB 3LKRA 4FZ8L 3TV3H 2K8QA 2CU9A 2FJGA 4H5SA 3QO0A 4BY6A 4UAOB 4LCWE 2ZUQC 4WW1B 5JNYA 4JPWL 1AZNA 2WO4A 4K07A 2C9UA 5JQHC 4H25B 3FB6A 5HHXH 2EVFA 4PJIF 5ANLA 1W0YT 1RZGB 2J4WH 3JUZA 4JDVA 4CGVA 3DPBA 1BBDL 2FLBT 4K7FA 3GRBA 4A39A 3KMDA 3OJVC 4AMWA 2DQIL 4P5RA 3GEFA 3TBBA 4X5RA 3ARQA 3ARTA 2DQDH 4EZJA 1RCYA 5CLYA 2GJ6A 1LMIA 1SDAB 4PJ8D 5FECB 1IQDB 1DJYA 2GFBA 3HE7C 2QQNH 1RK7A 2VQ1A 5KSAB 5EWIH 3WHE0 4AYFB 4NS0A 4DK3A 4I18C 5H8DA 4X7DC 5ENTD 2JQAA 4IOFD 5I0DA 2AXFA 2WCGA 3KW7A 4EBAA 2EYRA 4WFHD 3TLRA 1HQRA 3FFOA 5CP3A 2GUOA 4PLJD 4P8QA 4TMNE 1T3FA 3V6ZA 5CLXA 2HJLA 4YZFF 3RVXC 4IHOB 1QBAA 3JQ1A 2Y72A 3NCYP 1FVDA 3BG1B 3FT9A 3TWXA 1OSZA 1SM3H 2LFEA 2WB7A 3CIAA 2KZTB 4G8KA 1CGVA 2QTVA 4F6RD 3DSFH 1QFWM 3GYRA 4JDEB 3N40F 2A9ML 4PN6A 4RCVA 4QRPA 4R96B 2YPLA 4JJHA 4PJ9B 4X9HA 3ME0A 1P5VA 2VDQH 3FFCD 2NMSA 3T2HE 2UXTA 5EU4B 4JFOA 3O0RH 2WM9A 4ODXA 4GG6B 3H4FA 1RUML 4LLVA 4S1SL 4OBRA 3VMOA 4N5ED 1UWGH 3F65A 3D9IA 1GIGH 2XWBB 5F96H 4TNWF 5DWUL 4AK2A 4UI9K 4E6HA 1B90A 3C8KB 3CFEA 3Q8EA 1NCAH 1KJ2L 1OLLA 3HPJB 4BFRA 2F8IA 3IJHB 4HHGA 3NA9H 2DQJH 1LEKB 3QKYA 1TN8A 3V52L 3BN9C 4NQEE 2IF4A 3RC3A 3RFRA 3NQIA 2VH5H 1KIQB 3MV8A 1EXUB 5F0PB 4ZG1A 3BEWB 1DN2A 4L5FH 3HZYA 5B1KA 4Z7OB 4ZUVA 3GRWL 1UYWL 4Y19A 2IADA 1LK3L 4LP5A 3CVUA 1J87A 4ETQB 3L2NA 2JFCA 4YVQC 4GKNB 1OCRB 4HOSA 4GIAA 3K0WA 4I3GA 2MTPA 1BWMA 1CLOL 3EJPA 4PJAF 5J08A 3MLSL 4QFVA 1RZKC 5K9KB 3UUXA 4ESKA 4X6FB 3FZUC 1NIAA 4HOTA 2BSCA 1J5OL 1NMAL 3MLWH 3NCEB 3QJQB 4M43H 5DT1L 2X1XR 3BVNB 4MMZB 4U6YB 2X3MA 3CGHA 3TOPA 2YAOA 3U4BL 3FCSA 4PWJA 2HFFB 4XRCB 4UM8B 2B2XH 3SYOA 4A67A 5CCGE 5MEND 2QYUA 5ADOH 5AEAA 4NQDD 4NKMA 2JB6A 2VGXB 4JJ5B 4K23L 1LDPL 2XIDA 3PS6A 5C0DA 3TP4A 5C9JB 3ARFC 3N1QC 2WWMD 5FQ6A 2DQMA 1JI1A 1LEIB 3RL2B 3PE4A 1CLZL 1PJ9A 3BMVA 3LQZB 3LH2L 2C8NA 4UV4H 4C83A 3FV4A 2WW8A 4Y4HB 1D5IH 2VRAA 4UANA 3RNQB 1S9WA 2V4LA 1AZCA 5IQ7H 3EJNA 1MCWM 5ISZB 3V6FB 1SVBA 2ED7A 2BOCB 5KVGH 4LESA 1H3LA 1A5FL 2OMXB 3AS5A 3GQFA 1E96B 1MPAH 5DJ2A 3DHUA 4XNZC 3JWDC 1XCQA 3S34H 3QPQD 5L2KA 4PCYA 1T83C 3OR7A 1RIUL 1M3JA 2ZOUA 1IAOA 1QFWI 1QQEA 5EDSA 2BNQD 2FGWL 3D34A 5DWPA 5LCVL 5KG9A 1TITA 3I6GB 5EC1B 3S5YA 1UVQB 3ZDYB 3IFNH 5LQBL 2X6UA 3A24A 4MA1C 3K6SA 4AYSA 2WQRA 2NR6A 5IMMB 1AKJD 4HS6A 4G70B 1NCGA 5EOCL 4HGKC 3CMGA 3MXVH 3EYOB 3O2DA 3SDYH 1KEMH 4EIBA 2KERA 5A23A 1F4WH 4JMXA 4ILIA 3KM1A 3QA3B 3VDCA 2QGCA 5TGBA 3PNWA 1S8DA 3GSNH 2A5UA 1N67A 4TPRL 3V0DA 1IL1B 1JPTL 1FYTE 1S7QA 5ILTL 1I53A 2EE9A 2C7UB 4Z3FA 1BXAA 1MOEA 1ZXKA 2R69A 2ICWI 2DEYX 1IGCL 1SF5A 5DPFE 2NTFA 3D69B 5LBSA 3W9EA 4JDZB 3ZYQA 5DD6B 5FWQA 3LZFL 3CHOA 2N56A 4I6GA 3M1BB 5AUMB 4B3VA 3WTXA 2YSSB 1NLDL 2YFOA 2B4CH 3DJSA 4HRLA 4ZW3A