2XPYA

Structure of native leukotriene a4 hydrolase from saccharomyces cerevisiae
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
632
structure length
628
Chain Sequence
b'MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEGKNKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUKOTRIENE A-4 HYDROLASE
publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 216
structure length 628
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpyA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpyA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpyA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpyA01
5JS3E 3FULA 3B7UX 3QJXA 4MKTA 1LNFE 4WZ9A 1KTOA 1U4GA 5JXNE 5K1VA 4XN5A 5BPPA 4GAAA 4ZX4A 4P8QA 4H57A 3B2PA 3TMNE 5DPFE 3T8GA 4MWPE 1KKKA 4FKHA 4KXAA 2XQ0A 4DPRA 3P7PE 5JSSE 3P7QE 1LNCE 4XN1A 5JT9E 3T8FA 5JVIE 3F28A 4MXJE 2VQXA 4MS6A 3FLFA 3FUIA 3Q7JA 3B7TA 5HQDA 4QPEA 3FH5A 4K5PA 1ZDPE 1TLPE 3P7TE 1THLA 2DQMA 4XO4A 5FSSA 1HYTA 3Q43A 1SQMA 4NAQA 3DNZA 4TLNA 4Z7IA 4Q4EA 3T87A 5DLLA 3NQZB 4XMXA 3FXPA 4QIRA 4XN4A 4FYRA 4N66E 3MSFA 1LNDE 4KX8A 5LIFE 4XN2A 1FJOA 1FJQA 1FJVA 2WHZA 3P7RE 5AENA 1PE8A 3FUHA 1TLIA 4RSYA 1FJ3A 5L3UE 1LNEE 2TLIA 4JBSA 4K90A 3NQXA 4TNLA 4QHPA 4XMWA 4KX7A 3CHOA 3NQYB 4XO3A 3T8DA 3CHSA 4OW3A 4ZW7A 1QF2A 4K5MA 7TLNA 5LHDA 5LDSA 3FH8A 3T2IE 3B34A 4KXCA 4N4EE 4MZNE 3TLIA 2TMNE 1TLXA 3FUNA 5DPEE 3QNFA 4ZW5A 3FH7A 3ZI6A 4D9WA 4Q4IA 3QH5A 3FTUA 5C97A 1Z5HA 3FUJA 1ESPA 4XMVA 4X2UA 5TLIA 4B52A 4TMNE 4OI5E 3FV4A 4M65A 2A7GE 1BQBA 4F5CA 3FU3A 3N21A 3B2XA 3F2PA 3FB0A 8TLNE 3FTYA 3CIAA 3QH1A 4ZW6A 3CHRA 3P7SE 4FYTA 1L3FE 5LWDE 3FUFA 5FXNA 2XPZA 3FGDA 1GXWA 1FJWA 4XN9A 5FWQA 5TLNA 3FUEA 1TRLA 3MSNA 1FJUA 3DO2A 1KJPA 4FYSA 4KXBA 4FYQA 4J3BA 5AB2A 3NN7A 3FTZA 3FXSA 5FSJA 4XN7A 3EBGA 3FBOA 4TLIA 2G4ZA 4L2LA 5J6SA 1LNAE 4OU3A 1H19A 5K7TA 5L8PE 4MTWE 1KEIA 1Z1WA 3P7UE 4ZW8A 2TLXA 1FJTA 3SE6A 1PE7A 4QMEA 4R5XA 4R7LA 4R5TA 4XNAA 8TLIA 3SSBA 3Q44A 3B37A 4FKKA 3DO1A 4K5LA 5A3YA 3MSAA 3KEDA 4ZQTA 6TLIA 4FKEA 3P7VE 5DYFA 4RVBA 4ZW3A 5DLHA 4K5OA 3P7WE 3FUDA 3MDJA 3DBKA 3FTSA 3B3BA 3DO0A 1KJOA 1TMNE 4KX9A 4GERA 2GTQA 4XN8A 4XNBA 1Y3GE 5CU5A 1Z9GE 3EBHA 3FUMA 1PE5A 1OS0A 4XMZA 1LNBE 4K89A 1QF0A 3MS3A 4D91A 3T8HA 4PVBA 5TMNE 3U9WA 1NPCA 5AB0A 2YD0A 3T2HE 3T73A 3FTWA 4NZ8A 3FCQA 5FSPA 3T2JE 4XMUA 3T8VA 2DQ6A 4PW4A 2HPOA 3T74A 4E36A 4HOMA 1KR6A 2VJ8A 1KROA 3EBIA 5L41E 2XPYA 4R5VA 2ZXGA 3FU6A 3FORA 3PUUA 3FTVA 3EIMA 4ZX5A 4QUOA 4N5PE 7TLIA 4PU2A 1EZMA 3FUKA 4PJ6A 3T8CA 1QF1A 4XMTA 3CHQA 1HS6A 3FVPA 6TMNE 2HPTA 3B7RL 4ZX3A 4ZX6A 3FU5A 4XNDA 4KXDA 4XO5A 3LS7A 2R59A 1GW6A 1KL6A 3FHEA 1KS7A 2WI0A 3FU0A 3QGOA 3CHPA 3FTXA 3B7SA 5LG6A 4K5NA
chains in the Genus database with same CATH superfamily
3WNOA 3ESLA 1IFHH 2DH3A 1N64H 1UM5L 2EXYC 3PGDA 2XQBL 4UBDC 4WKXA 5FO7A 4YX2H 2HTLC 3BI9X 1WM5A 2P5WA 4M6OL 1LQSR 1IGYA 5B4MD 3UJJH 3BISA 3B5HA 3OMIB 2OYPA 4L8CB 2ZE0A 12E8L 4KVPA 3G2UA 4DGYL 5HVHC 2GK0A 3FN3A 4CCAA 3V0WL 3BZFA 4KROB 1OR7A 1FV1A 3EADA 2D9CA 3G5XB 4WFHD 1URLA 2HT3D 4BWWA 2D9QB 5HGDA 5T3XH 2GW1A 2RFMA 3FMGH 4NKDB 4NUJB 2JJSA 4RMSA 2ZXAA 3NFPA 1P7KA 1G87A 5D7EA 4IHQA 3D9JA 2JQMA 3ZDXF 4PG9B 4CMHB 2P9UG 5EC2A 3UJIL 3WTYA 2P8MA 3K74B 2F6AA 5IVXF 2DLTA 1N5AA 4RQIA 1R3JB 3QJTB 2A6JA 3RILA 3TEYA 4BDVA 2AZUA 2YD9A 4JANB 1LK3H 3MNWB 2WTPA 4U8YD 1ZLVH 3S4SG 1G6VK 5KAQG 4PJ7E 2DEXX 2E9JA 4P2QA 3IF1A 1HZ4A 4Y4HD 4CVXB 1J0HA 3PNWA 1JHTB 2Z3FA 3MR9B 5D2NA 3PYCA 1FFPA 3H9SD 3EJQA 5JVIE 2LLLA 2N1KA 3EW3B 1O7DE 3VW3H 3BCDA 3ULVD 3E8UH 4AKPA 4QLRA 4LSTL 4NRHB 2ETBA 2RFXA 1WEJH 2P9SG 1ZV2A 3D0AA 4K0OA 1YEGL 2F68X 4WK2B 4XOCA 1BLNA 1Q1JL 3CVCA 2X3AA 1XO8A 4BGDA 5DMKA 1I4FA 3MJWA 4MXQC 4RWYH 2WVSA 1TLPE 3QEHB 5J9PB 1VJSA 5C07A 4UB0H 1THLA 3RWDA 4I0PB 3VE0A 2C3WA 4GBXC 2Y69B 2X9ZA 3LZNA 4K7FA 5I1CH 3MV11 3OPUA 2NTSP 2P1YA 4AYID 1I8LA 4XPFH 3AUAA 4KK5C 2E74C 4XCCH 4PRBA 1SOSA 3MLSL 4ZFGH 4OF8A 4RNRA 1SLXA 3MNZB 4EVNA 1TZGL 1MCCA 3T71A 3T87A 2ZICA 3PWPD 1JCSA 3ARTA 4PHXA 5C08D 3QZLA 2RQ8A 1V7MH 4MAYC 1HEZA 1KPSB 4R96B 5HD8D 1ZCRA 2BSTA 1GA2A 1JGIA 4XE5B 4PJIF 4U6VH 5DU7A 4WHTA 2DLEA 2NY3C 3TIEA 2JCWA 5I6NA 3SDAA 2O5YL 3EFDH 4ZUTA 3RC3A 3QZMA 2MOVA 1F56A 3TBVA 4GUPB 2P9RA 5TPWH 1A7NL 4J2QA 3WKNA 1QUNA 3V8CA 4BSJA 4NURA 4I6GA 2FHBA 4BJLA 3WN5C 3ZUNC 2EEBA 3T0ED 1LM8V 2YKKA 1AJ7L 4QHKI 2XHNA 1V3LA 5D7JA 3HVDA 4OW6A 2IOLA 4ZAKA 3HHSB 4PGJA 2XN9A 5JDJA 3VM7A 1CDBA 5SX4I 3KYMB 3L22A 3P2DA 4JL0A 1OAYH 4GXVH 4UTAA 1OK0A 5CJXA 4ZXBA 1MWAL 4YEFA 4IBSA 4FADA 1TLIA 5M72A 4WUKL 4Y9CA 4Y5VB 4RAVA 4I48B 3URZA 2PPDA 4YE4L 1UJ3C 5FW6A 3U0TA 1U8HB 3RWEA 1RP3A 4RBPK 5C9JA 2G9HA 1LE5A 3ZYLA 5FYKE 2R9HD 1ACYH 4UQ9A 1L6PA 1ZEAL 1BQLH 2UZYA 3GPSA 4WW2B 4L8BB 1BA9A 1M4KA 4WI0B 1C12B 2VXUH 3HBGA 1QWHA 4X6CF 4K90A 2E6QA 2WXIA 2VKXA 2XWJA 4HA1A 4X8JA 4AV5A 3FBQA 1H2UA 2O6CA 3TWQA 3GI9H 4QRFA 3KH4A 3VD0A 2UZXA 2DYRE 2YGVA 2EAEA 2Z34A 3ROOB 5ERWB 2XYBA 3EHBB 2DCPA 5EKQD 1EFXB 1QPXA 1ZS8B 2CK0L 3BPOB 4FG4A 1J9TA 4XAKD 3IWVA 1JI1A 1DQJA 3VRLF 3GINA 2B08A 4FP8L 5EZJB 3OKOA 5FYJH 2WWKO 3Q47B 4N5EC 3UERA 1AP2A 1I1AB 1MEXH 3O3AA 1CURA 2CZNA 4Y19D 4G26A 3OZ9H 2PW2A 3CN0A 3VXUD 2V9TA 1TN7A 2IAAC 2ZF8A 2K4AA 2NZIA 4PJ7B 4S2SB 2VXQL 2IALB 3X1GA 4LARL 5GSRB 4BQ8A 3FT1A 1SFHA 4G5AA 3ETBJ 5IT2L 2JMRA 3ZYMA 3AXLB 5T5FL 4PREB 4N4EE 1JGVH 4QAMB 1DVFA 3KLQA 5JPNC 1CFTB 4I9WE 4CVUA 4QRPE 2TRHA 4JZJA 4JFYA 4N2GA 3RWHB 2DQDH 3CSBA 3WFCL 3FH7A 3OPZL 3L4XA 3BVWA 3GBNH 2BSRB 4YHML 4TTGA 4K7PH 1D5XA 2VRAA 5SWZD 4TPRL 3OKMB 5CBNA 1WFNA 5IJVA 3QDNA 4PS7A 1T0NB 2AVFA 1IHBA 3FT3B 2C82A 1IC7H 1IAIH 4NACA 5DQDL 3OVUB 3HRZA 3Q5YA 4CT0A 2WIMA 4A39A 3MRLA 5DVPA 4PR5A 5C2UB 3CLFH 3UP6A 1BQKA 1IIKA 5DO2C 3LDBC 1XF2A 4DX5D 3PF2A 1WSST 1Y07A 3FT2A 4C83B 1XGQA 1W2KT 5FHAH 2V8LA 4UQDA 4BH8A 1A7RH 2QHRL 3D33A 3TXNA 2F8XK 1IGML 4YXHL 3RKPA 3K71A 2H47C 2QFCA 4KJWC 4YFEA 2CJUH 3L8QA 2KQMA 2WVVA 3B9EA 4H1LH 4OCMC 4I3RL 4KKZA 1FFOA 2I60H 1YAIA 3NZSA 2E5EA 1JPTH 4F7CA 2LE9A 3V52H 1IEAA 2GITA 1IBGH 5JDSA 3U0WL 4MA7L 1N18A 4UUJA 5TQ2L 1JUFA 3VFOB 3W9EA 3NTCH 4L1SA 5CIPB 2VDLH 2BHUA 4QTHA 1GRWA 2BY1A 5B1JC 2NDGA 1UB6A 1MHQA 2OFQA 1XF5B 4GAYB 4N8UA 1VZHA 4UCFA 5DFVC 3VI4E 2C3VB 3ZHDA 3ZL2A 1HDMA 5D93C 4M8RA 3OXGA 1L9SA 3LSOB 5GIRB 3AXIA 4ZODA 1IQWL 1E8WA 4I1NB 1IL1B 4FFTA 2JQZA 1N7ML 4Y2OA 1BD8A 1OGTA 3I75B 3GMPB 5T3RA 2WZAA 4EPZA 4TUUA 3JSSA 4F27A 3LKUA 1I7UA 5FQ6A 4PB0H 3VWJB 1K1AA 1A3ZA 2R7EA 4JGJA 4XZUA 5F3FA 4D7PA 4G6JH 2OW7A 2GTWA 3APDA 1ETB1 1SJXA 4LSRH 2DYRB 5HJBA 4AG4L 5CMYA 1F6LL 3I50L 2EVHA 2EYSA 5AOLA 3AM8A 3PWUA 2VDPH 1XSIA 1Q9OA 2TLXA 3KM1A 1ZBPA 3WIAA 3IDMB 5DJ6A 1TMCB 4OCWH 3C60C 3H7BA 2MPAH 4PSPA 4A6YB 5EOQL 3JWDC 3KJ4C 4WIQA 4U8VD 3CJJA 2VMFA 2HZHA 4W9EC 5AIJA 4DVBA 7PCYA 1ULVA 1XGPB 2HRLA 2R23A 3INUL 2VDNH 4DESA 1TQUA 2RJIA 3DETC 1DJWA 2DQTL 4PP2B 5LNEA 1PLBA 1UUSA 3U48A 4TOYL 3WKPA 2FF4A 3IFNH 1M05A 2ROXA 3RFZB 1TO4A 3AS0A 3TWCH 4QRPB 4DW2L 4HJGA 2OQJA 4L9LC 2WK2A 3WIIL 1HF8A 4FTDA 3QXWA 4P9HH 3VH8G 1T4WA 1FL6B 2CWRA 3IGUA 3US9A 3P0YH 1NUGA 1QSFA 5JO5A 2B9AA 4I6EA 3SBSA 2NUTB 4YDKL 2PCYA 2Z6FA 4TVPH 4ZZFA 2C7FA 4JO1H 1GJIA 3D08A 3DTXA 3P7WE 2HX8A 4F7PA 2IOIA 1TTRA 5FZRA 3P9WB 4CGUB 2H1LM 2OZ4L 3FAWA 4Y0GA 4Y2LA 5FXCH 3IBEA 1II4E 5CD3B 2BZCA 3DO0A 2E7LA 5DD3H 2ZUQC 4R4BB 3EHNA 1M9SA 5FLVA 1OM3H 5D2LA 1IJ9A 1VADB 4UM9B 4PCSA 4WV1B 3G6JE 4HIEA 2FJHB 1CTMA 4PD4K 5KWYC 4M3KB 1T2QL 4ZJ9A 3SO3C 1PCXA 1TNNA 2IPKB 1FZMB 3IGAB 4XX5A 3GPEA 2YPKA 5IHWA 1MY5A 1UTDA 4AH2A 5GHWH 2ZG1A 3P69A 2JCCF 1SYVB 2VDOB 1SBBA 2ZWLT 2O5ZH 1GW0A 1WWWX 5AQ0A 4WFFD 1I85C 2W9EL 2EUVA 1AKJD 4Y9GA 4GFTB 4PY7B 4X4KA 5SWZA 1VA9A 4D9RE 3F2LA 3PPSA 4JFEE 3VMOA 1P4BL 4JZOB 3CVNA 3T5XA 3QG7L 1SOKA 4H1LA 4ODXB 4ONFL 3ZJAA 4X0NA 4PJCF 1LE9B 3UM3A 2BVEA 2FRGP 3Q73A 2BVUA 3VUAA 3U82B 3VI4B 3LMJH 3HFML 2GUYA 5AWNL 4ISVB 3IDYB 5IB4B 2F18A 2LSUA 4K03A 2Z93B 3F58L 5E2TL 2VM9A 4YFLI 2OMZA 5FM5O 4B3EA 1JPFA 3CFKB 3B2VL 3IXAA 2J25A 3FRPA 5CD5D 1QSZA 5E75A 4LB8A 2FEDC 3QIWC 1X3ZA 2XWBB 2AEPL 2KL6A 3CIQA 4WU7A 2W5PA 4UT9H 3HUJA 2CIKA 2DWXA 3O3EA 7PAZA 2VC2H 2ETCA 1WZ1L 3QYMA 2VH5H 2YSSB 1M6OA 3ZKMD 3QEQD 5JA4D 3C12A 1QRNA 1RIVH 2HKHL 4XXCA 4D0CA 3O81A 4OV5B 2B4CC 3BW9A 4NC1C 5AW5B 3BP4B 5CN1A 5AQBA 3EH1A 4RRPA 4XNXH 3SODB 5IHHA 2NY7L 4PYGA 4A7TA 2WXLA 3FTVA 3C09C 4NHCH 4HORA 3BEWB 5AW3B 3U1QA 1PDKA 1PLGH 4FFZL 1FG2B 2BIIA 2IG2L 1KJVA 3M86A 3VFTB 5I76B 2ZYIA 1BI8B 4GQ9H 5CM1A 5E4EC 5CBOA 3Q6GL 4EO5A 3BVVA 4XHQA 4IGBA 1QF1A 1M7IA 1L3NA 1SA5A 1YEDB 3LNFA 1KJMA 2WCSA 1S7QA 4P2OB 3QUYB 2WTOA 3S7BA 3NCXA 4MXWH 2WLIB 2EJ1A 2EDXA 4HIXH 1C8PA 1RHFA 4OM1H 4HUVA 3IXTB 4WTZG 5F88B 1EHKB 3PWVB 2J6EL 1WZLA 2XHEA 8FABB 2R59A 2IONA 1MCWW 1CFVL 2RG8A 3PDDA 3SEPA 3L3DB 1NANI 2W38A 4PJAA 4FD0A 4PDXA 4Y5XB 4WGKA 4YDLB 4ELME 3V5DA 2BOLA 4G8FA 3SJVA 2JXMB 4XXWC 4ZFZA 3UEQA 3MNMA 2VMDA 5AVXB 4KKLC 5EU7E 5AOIA 5TH2A 1XIWD 3IFPA 3FB7B 5MEOB 2B9BA 1TJIL 4Z68A 1HL4A 2LU3A 1OAKH 2FUTA 1P5UC 2OMYA 1IZKA 3AS1A 1ZLSL 3UDWA 1TQCC 3KAAA 3CSYA 4AY6A 3G6JB 3HKFA 1S3KH 4XCYB 1G7LB 4ELKA 3O6FB 5BS0D 2I27N 3BEVA 5A2KH 5C0JB 3DEPA 1LP9F 4OFYA 1E9QB 1F41A 1RUAL 3HZMA 3VTTA 2P9KG 4EN3D 4HNAD 1BFOA 5GISH 1SXZA 2ARJB 1E4XH 1KNOB 5E0FA 1FHGA 4LEOB 1ZK9A 3LD8B 4GEJA 5DEFA 4WENB 5E24E 1UYWH 4HQQH 4GI6A 1KGCE 2MOWA 4JFEB 2VL4A 1XL6A 3TMNE 5C0EA 2J56A 4LLWB 2WNXA 2WXNA 3LY9A 5KW9H 3GMQB 5D2LF 3E30A 3WKMH 5JHLL 1E9PB 4TTDC 5BQ7B 5ANMA 4B93B 3BRGC 4UZUA 4IRSD 4JO3L 4HB5A 1W15A 3FKUS 3NCJH 1E28A 5FYLL 1T04A 2NZ9C 3LN9A 3UACA 1I9RH 1XSOA 4OUUA 2XSKA 4GMTL 1R3IH 2X38A 1LNUA 3RZCD 4WW1A 1GIGL 2P43B 2J44A 3GBMH 3VQ2C 3HE6B 1JZFA 1D2PA 4XTRC 3FB5A 3IVKA 1KBGL 1MW2A 4K94L 1HE8A 1DR9A 2VO5A 3Q49B 1NFKA 2LGNA 3A5VA 4MDJB 3Q7JA 1GGTA 3EOAA 3B7TA 1EEYA 3QDJE 5FK9B 3D9KA 4QRRE 3MZLB 3M8OH 5TFSL 1M7DA 1BWMA 2A5UA 2FWOB 1WRFA 2LUHA 1XF3B 3E3QE 1UKTA 4EBAA 2Y6SD 4I0KA 4BBWA 3VRIB 2XKNB 5DO8A 4BKTC 5AVVB 1X9QA 5EIIG 3V0IA 1OOWA 2EIKE 15C8H 4MLSA 4HSCX 1OPGL 3QQ3A 1NBYB 4ZI8A 2OYLA 1RZQA 2YHEA 2EILE 3LRLA 5MENA 1WISA 3QCTH 2CO3A 3Q15A 1RJCA 1GGIH 3DNZA 4M1GH 1GC1L 2Z35A 2W81C 3IU4H 1HSBA 4HS6A 4XEIG 3LDZA 1ZV9A 3MCKA 4KK6D 4XCFL 1UWEH 1MJUH 2TSAA 3U9UB 3WFBL 4AEFA 3AS3A 5C0CA 5B4MC 1I9IL 5KWDA 5JXEC 5CEYA 5JNYA 2BRRL 2JSFA 1HQ4B 2XQYA 3IYLW 2YBRB 3ZKXB 2VLKE 3RTQD 2HT3C 4ZO7A 4XN4A 2DKSA 4X4XA 5JW4R 2WBWB 5SWSA 3QWOB 4YHNA 5J11B 4QKXB 1EXHA 1R47A 3L6FA 4ELMB 3WIHL 5D7IE 3TYFB 4AV4A 3IAQA 5BV7C 1K9TA 3GXTA 1HG2A 3L54A 3N43F 4NRXA 2YBGA 4I9XA 2KZBA 3PIQB 4I2XE 2LU5A 1IBZA 1NCCL 1WBXA 3MVSA 1UA6L 1U8QB 5IB2B 2OP4L 4LFHG 3DLQR 5AW1B 3QPXH 3ZSTA 1ZDSA 1TTFA 3C2AL 1MDTA 4JFOA 3ETSA 1MFUA 2NY4B 3C5SB 2TAAA 3Q48A 2XVKA 4Y1TA 3UBXI 2A77L 4OKVA 5C2BL 3N50A 1BIIA 1RZJL 2EE3A 5DMJB 4WWKA 2EUWA 4QHNA 4IHOB 3L3HB 4LASL 4PJAF 4UQAA 4WO4C 3O6MH 3AZUA 4RCAA 4KMTH 1NFIE 5T1DL 3ULVC 3PUKA 4LT7A 3MYVA 3ZRCC 1DQKA 1DQDH 1J48A 1WCBA 1ELRA 2DIBA 1K5NB 3UJTL 5C0GA 4WUUD 4Y6RA 1DNPA 1NBCA 1ONQA 2EE0A 3B1UA 4UM8B 1NAMB 3S2AA 4X42A 5IP4A 4HDIB 2FJUB 1HNGA 2F54E 5JIKA 3B8SA 5DZVA 3H54A 4PRHD 2IDQA 4J7WA 3HE7B 1IT9H 1KELH 1U8CB 3KPNA 1WIPA 4K2UL 1WC7B 4JHZA 1RZKL 1OV8A 3RASA 1DTUA 4N68A 4YBHA 2B77A 2NQ3A 3S0PA 4BWTA 2ESVD 3CC1A 4P3DA 1CXIA 3D4CA 4LCUB 3SE4C 4AY5A 3QG6A 5E6ID 3BUIA 3O8XB 5JHDE 1HHIB 4UIMB 3HNSH 3FO1A 3U6RA 3VI3A 1EHLH 2HRGA 1O7SA 2BSBA 2ZXCA 5HYSA 3IV0A 3U6XS 1Z5YD 4W9KC 1BMWA 3ARGD 1NGXA 4UT7H 5HD8C 4ARFA 2DBAA 3AITA 2XX1A 3BGFB 3C5ZC 5MI0B 3JV6A 3QNFA 3KWXA 2NC9A 3QDJB 3DRQA 4HI8A 3MBXH 3CMOH 3QFDA 4S1RL 5GGQL 4NRYA 2BEDA 5DZOA 3LVRE 3MODL 4OFIA 3NGBC 3AY4A 4FZEL 4OIBA 4RIRA 4W6YB 2D03H 4AIEA 1S7TA 5HVFB 1F90L 5D71L 1FO0H 3L2LA 1UH3A 2XG4B 3FUJA 3NH7L 4PRIA 4XMVA 4CMMA 1J8RA 3OWEA 2EIKB 4M1CC 4D8OA 2MQ3A 4HXAL 5DUBB 4AL8L 3LN5A 2EILB 1OQOA 5DBKA 3H3PH 4BSVA 3AU1A 3QEGH 5D70H 1VEPA 3PFQA 4PP1C 1MCFA 4DP7X 1QUPA 2QR0A 1IBBA 3Q06A 5AN8A 2WZ5A 3U2JA 3IE9A 2GK2A 2JLLA 1PZ2A 2QLVB 4POUB 3SDCD 1KTDB 5IGXL 4CAGA 3S88H 5HGBB 3CVDA 2ZPKH 5E2WH 5EWIL 4F5CA 2B39A 3ARZA 5KBDA 4HG4J 2EACA 1GGBH 3OKKB 4ENEC 1XB8A 3N21A 1GZQB 1MUJA 5ICYA 1NLBL 3ILQC 3ZRFC 3LQAL 3GMLA 4N5CA 2BM3A 2XIBA 2D31B 1KCUL 5DULA 4ZS7H 1JVLA 1TNOA 2VLKB 5GRUH 2ODHA 1PS3A 4AEIL 3ZZ1A 5IUSA 2IWGA 1HL9A 1OLLA 2EXSA 4YPGB 4FYTA 5EU3A 1BFTA 3SGEH 5JOPD 5GS1A 3NEEA 4Z7OF 3IN2A 2DVWA 1KY7A 4PJXE 3SKUD 2HMIC 2NZ1A 4B9JA 4I2XB 2I26N 4JQIA 1L5JA 2JIXB 2L0TB 2IXQB 4ODVL 3DXAA 3BFQG 1TU2A 5EU5A 4LCVA 1V5JA 4WKZB 2HFFA 3U25A 2YXFA 4PS4L 1MLBB 2DYPD 3BQUD 3O9WC 5IW6A 4EZJA 1T21A 3BSHA 5I1DB 3PV6A 4E85A 1MFCL 2HH0L 1E50A 3C6SB 4MJ5B 1MCJA 3IRCA 1CWVA 1KXHA 4ICWA 4GXUN 4AQ8C 1DJZA 2CMRH 5A6LA 2AQNA 3RUGE 5GGUA 4B53A 5FUCE 3WXWL 1NFIB 2EDQA 3KDPB 4UU9A 3RWFB 3KL5A 5JYMA 3US0A 5LGKA 4H7VA 4NKOA 5I6MA 3C9NB 3ZTNL 2KCLA 4MBGA 3DVNA 3QIBB 3D39B 3S5LG 5KVGH 3PJSA 1QASA 1T20B 4UV7H 1TR7A 3NFNB 4XP9L 1NZNA 3MBEA 2F54B 2GCYB 1T22B 3FNKA 2E75C 1LO4H 5KOVC 1AQDB 1FJTA 4GY4A 1M6UA 5AUMB 5ISZA 1PMYA 5I23A 4JQXC 2XY1A 2RBLA 3W38A 1LO3H 4Y67A 3KM2A 3QULB 4TM9A 4WF7A 2YWZA 2E56A 4ZTPL 3BJLA 4E9VA 3V4VH 5CGTA 5DRZB 43C9A 4PJGE 2XACC 3IDXL 2ZUUA 3GSVA 2N7AA 1PNCA 3B9KC 5TDPA 5IQ7H 1HKLL 2AK4E 2YHGA 5D2MC 4KPHL 3DO7B 4OZ4A 5BRZD 4X7FC 4U0ZA 4KKPA 4TUJA 5JBIA 3QNZB 3ZKND 5T3ZD 3U7WL 1XZWA 1FP5A 3AUVA 1A5EA 3VG9B 2R8SL 3H4FA 1JTTA 4LF3A 4JFXA 4FKEA 2XKUA 1SUHA 1IEBA 3A4EA 1HI6B 2IV9A 4XI0A 1ZANL 1JXJA 1TOXA 5E9DD 4TSBL 4J6RL 3BAWA 4N25A 3TXAA 5IJCC 2Q8BH 4XWOD 5IV2B 3D9IA 2PQRA 4LVOC 3BOVA 1JK8A 1WZKA 3SD2A 4PGEB 4AVIA 4C58B 3MDJA 1NDTA 4EQFA 4K7PX 1JF1B 1JNLL 2X1XR 4JFFE 5HHOE 4Q9QH 1FO0A 2Y7LA 2L7UA 5IB3B 4D3CH 1J10A 3ONLA 1A6ZB 3LV3B 4XVJH 1NFDF 3VXOB 2KCKA 2FT8A 2XPGA 5ID0B 1OWNA 3JTSB 1CDUA 4JS7A 1NAKH 2YZ1A 3ARGA 2AXVA 3P30L 2XICA 2FJGB 5CCLA 1T0OA 1PE5A 1UOHA 4CN1A 3LZOA 1QFWH 5I15H 1N0LB 1EJ6A 5D1QD 3GLEA 2XV0A 4OZGA 5E1GA 3OXFA 2NY0D 4G2AA 2IAMA 3TZVB 2AEIT 2IWEA 1UVQA 4PJXB 1OGAA 5TMNE 4AUJA 3PDOA 4HPOL 1VESA 2O5NA 1EX0A 3CVHL 4LU5H 3RY6C 5C2BH 2XX0A 1HH8A 3QQXA 3H1ZA 3D30A 1E2WA 3B2DC 1RIUL 4OI8A 1N19A 2XRAH 1DUYB 1AD0A 3A0OA 4HWEL 3UC0H 4PJBE 3S34L 4HUKB 1VB9A 2XYCA 3MCXA 1WDYA 4YEEA 3TC9A 1HNFA 3V6OC 3IEAA 3MRQB 4M7LT 5FKPB 3RTLA 1RZIB 1A64A 4J23A 1N3NB 4J3OC 4R4ND 1EAPA 3A4FA 2WXFA 4G7VH 3RUGB 1A9EB 4L8CA 4NQEE 3NFSL 3UOAB 3ES6A 2CDEB 3NDYE 1KR6A 1NGPL 3QIUB 2GIMA 5F1SA 1GSKA 4PJFE 1CB4A 3HR6A 3EJTA 5A7BA 1RPQA 2A6IB 1RU9L 1ND0A 3V0AC 4DK5A 4H8QA 4NQCA 1I8KA 2KATA 2GSIA 2HJKA 4UINH 2VR9A 4XOAA 3SDYH 5JHAA 4S1SL 3PUUA 3WTUA 1TVBA 4Y6WA 5I1GL 2XWDA 1LO5B 1PAMA 2DMKA 2J4BA 4E0RA 4LSQL 5E7BA 1T5XA 3OLEA 1KIQB 5JA8B 4KGJA 3V55A 1WA0X 1BECA 3LRMA 3RY5A 3BH8A 4QYAA 2HG5B 4B50A 2VLLB 3T2NH 2J7LA 3D0VA 1PIGA 3NP3A 4PJGB 1AMXA 3CFEA 5CSBA 1XH3B 4KDTC 1K4DA 4O2CB 2AK4B 1NMAH 2P24B 4PWGA 2V2WA 5CS7A 1HFAA 2C9RA 1JPLA 1FE8L 2IH1B 1D5IL 2V7NB 3E80A 4NO0D 4YSRA 5F1IA 5HHNA 3B7RL 3CX5J 3T9KA 4Q6KA 3V2AR 4BZ1L 1QZNA 4PRDB 2E8ZA 4ODSL 3LPGA 3V4VA 4FNRA 4QKTA 3IKOB 2I24N 4U1JA 3HXFA 3LHPH 4LMQI 4KXZH 3GUTA 4UDUB 2CO6A 1RZ4A 1EK3A 4ODBD 2FX8L 1VGEH 3Q2CA 4J4PC 3RYMA 5FO9A 3V0DA 2VQUA 3Q78A 2VSXE 1R5IB 2MKWA 4OF6A 4DGVL 1S7WB 3DVFA 1ES0A 4H8HA 3TTSA 3FU0A 4FL4B 5EUOF 4BEIA 5A40E 1INZA 3QDMD 2PW1B 4KI5C 4CMHC 4MBOA 1CG9A 4NFDA 4CJ1A 5I0XA 5KN5A 4Z8FH 5IY5E 1N8ZB 4JFFB 4BFGA 5LNDA 5HHOB 1NCOA 1BAFL 2IAND 3DUUB 4W81A 2VTBA 3P0VL 4ZUUA 3ZQXA 2FAUA 1JGEB 1OQXA 5AVUB 4OLYL 5JS3E 3LZFH 1NC2D 3P2BA 2HFEB 4YGAB 5DJXA 2ZUTA 2B3IA 6PCYA 3DRTA 1KEGL 2KZTB 5EORL 5CD5C 5H4ZA 1JN6A 2ZU6B 4YHLH 2CLRB 3H3BC 4LRZA 3ZKQD 3IJSA 1U4GA 4RA0C 2ZNWA 5C0AD 2WUBL 3O2DH 5KJNA 1HNYA 4MAUH 1BMZA 1BQHA 2B1HH 3F83A 2WZPD 2XNAB 3G2SA 2JK5B 5DHDA 3THML 3L4ZA 4Y2DD 4GYBA 3WN5A 1OWMA 5KJMA 3UUXA 3I85A 1RIHH 3EFFA 3JQ0A 1MJ8L 3A23A 3SDXE 4D0DA 4DZ8A 5EF1A 2JLBA 1QBAA 1B4RA 4HZ1A 1C7TA 1A47A 2EIEA 2Q7FA 3CSTA 1A3RL 2FHFA 3FQNA 3GHPA 2V9RA 4PJBB 2AW6A 4OZHA 4KO5A 5FUZH 3RU8L 2V8SE 3E37A 5ANHA 5J57B 3P7QE 1BF8A 3E4BA 3AT0A 1UJ3A 1P4IL 1M1XB 1QX1A 3FB8B 3NJIA 2ZOLA 4PCYA 5L8JB 2YAQA 1WFMA 3Q1SH 3EFOA 4KOBA 4GW4B 3ASHA 4OQTL 5CP7A 4AYMC 4NQEB 4F92B 2H0EA 2VSKB 3N9GL 1HL8A 1WS8A 5I8KL 2HVJA 2ADIB 3VVWA 4TQEH 4X5LA 4FNPA 4PJFB 2NX5E 1FGNH 2IDTA 5F7HA 4ANXA 3JWDH 2ZP0T 3UG5A 1EEZB 5H4YA 4NQVA 3HC2A 4JHBA 2Y36L 2CFZA 2QDWA 4OLVH 1OAZL 1XH2A 3QFJD 2A4CA 2FIRT 3DURA 4HC1A 2PO6A 4QT5A 4B60A 1SQMA 5CZVL 4B0MM 3ULUD 1KYUA 1YMPA 5TQ0H 3LXBA 4PMEA 4JDVB 4RZKA 5C0RL 3TONA 4HQDA 1CLOH 3OR7A 4YK4C 2L6JA 3TN0B 3WE6B 5IB5B 3D3VE 3R06A 2XIDA 5ENPD 1OARL 1S9WB 2ZUVA 3QFGA 4KITB 5CGMA 1IX2A 4UNVA 4F33A 1PZCA 4G11A 1CGWA 1XZ0A 2OMVB 5KANI 3T1FB 1NCTA 3T3PF 1B0IA 2EDLA 2C0LA 2H7WA 2RR3A 3MLUH 2X4TB 4PWEA 4JB8P 5G2NA 5D6CA 2NR6D 4A37A 2DYSE 1OWWA 4URKA 1TIUA 3GRWL 1T5KA 1EAJA 4RH4A 1U8OA 2P52A 4IOIA 4O2EB 1FIEA 2DEYX 4UOJA 5F0JB 4YHIB 4FI6A 2YOAA 1TZ8A 4ODHL 2ITDA 5DWUH 1FH5L 5I74C 4LCYA 4UI9C 1IIIA 5DQ9B 1FJQA 3MLTB 5HGHA 1YY8B 4ODTL 1H6OA 4IK7A 5IY5B 5ACZA 5CEZH 3RA7L 4PJEE 1YN6B 2FO1E 1EZUA 2YMXL 4IRSC 3GSXB 3FUHA 3CZGA 5E8OA 2JJUA 3ATEA 3T0XA 3ONKA 1VPOL 2XKSA 3WLBB 3ARFC 4NKMA 3EOTL 4LEEA 5C09A 3U4EA 5HGAB 2CD0A 1FDLH 4MX7B 1FJ3A 4W4NA 5L3UE 3LY8A 3L3OB 2AMUA 2DQEL 2GUOA 3KW8A 4AQZA 3TBWA 5AW8B 1IB5A 3MUUA 4G3YH 3CZJA 5F7UA 3BMWA 2VXSL 1J5OH 4IKJA 2UVFA 1EDUA 1XQ4A 2EC9T 2HLFC 4HU2A 4Q9CA 2BIQA 3OAUH 5BRPA 5C0BD 1Y8MA 1J1XL 2XXFA 3CDGA 3MRHB 1LF8A 1OY3B 2CGZA 4PJDE 3HG1D 3RURA 1D5BA 2WLLA 2IPTH 4EZLA 2XY2A 4JM4H 4TSCH 3ARBC 4LLAA 4IOSA 4OD1L 4UQ3A 4XGZA 3O2DA 3SDXB 3PZ4A 1J9CT 1TTGA 4XRCB 2ATAA 2W91A 5B1JA 2Y1YA 2EDOA 2AJAA 3H0TB 4RX4D 5D1XC 3RIFF 4YVUA 2UYLA 3L4VA 3Q2WA 3CHSA 3NZHH 5K9OA 2G0KA 2NY6B 3QHFL 5AOZA 3R9MA 2IANA 5EPMA 4G6KL 4NN6B 3PP3K 1BD2A 2WO2B 2PETA 2Y5TA 4JVPA 4X6EA 4HAFA 3NT0A 2B4CH 3EDTB 2QELA 3T2IE 3R7RA 1C5CH 2DQFA 2WNKA 3G3LA 5B3NA 1JZJA 1CO1A 4OQ1A 4WJ5B 1I1FB 3TLIA 3UAFA 3H42L 4L1TA 3VB9A 1TLXA 1BXVA 5AVQB 2ZSWB 1QQDB 3I6LD 5T33L 4AYFA 1A0QL 1SEQL 4LIQH 5E5MA 4O5LH 3EGXB 3X13A 1HZLA 1UT2A 2F58L 2ADJA 3UTSE 4AGOA 4LSDA 2WINA 4LNVA 1T83C 4JPIA 1RMFH 5C0DB 2C2LA 1GTFA 4KHXH 1HJBC 2C4FT 1CL7H 4X8QA 3LS5L 3MRKA 4IJ3B 3DOHA 5IVXE 2ZJSH 2VYIA 5SX5H 3C60A 3CQCB 3MLRL 3WMPA 3ARSA 1NPJA 3GFUA 4GI8A 5D55A 3O4ZA 4GJTB 4M62H 2HWZL 3U4AA 4QWWD 1BZ9A 4U04A 3IDGB 5FOBA 1G6RB 1Z9SA 1BQBA 2Q3XA 3D3VB 5D9SA 3L6AA 5I5RA 3PH0C 4U05A 4PJ8B 3RHWK 1NSNL 4BFEA 4A2LA 4L9LA 4MNQE 2GRMA 1BAGA 1EDYA 2FEZA 2CGRH 2J8UA 2KYIA 4JAMB 4LBAA 2DYSB 3SFZA 2BS71 2Y7QA 3SYPA 4AIZA 4ZW6A 1BREA 1KGWA 2UXFA 1QEWB 3WTTA 4P2AA 1R0AH 1S5IH 1NCWL 7CGTA 2VZSA 2XPZA 4AC4A 3MOBH 4GYOA 1ORQA 1ORSA 3HB3B 4EDXA 3TFKD 1MCNA 3U4TA 2Q3AA 4LP5A 5LX8A 5DJDB 4Z7VA 4F57H 2WQVA 2FECI 3W81A 3HMWL 1FJUA 4JRYD 4PJEB 4JDEA 4LEUA 3QUXC 1S63A 3I4RB 2IOMA 1NDGA 2WGXA 3D69B 3UYPB 4FQJL 4GZ3A 4QFVA 1KJPA 4PRPD 1JHLH 1E27B 4HUXA 3NPSC 1NMCB 3CU7A 5KSAC 2R1YA 4QHLB 5LAXA 3V0VA 1E6JH 5CEXB 1JNHA 2G5UA 1HHKA 5J89A 1FWXA 3ILPB 4KRNA 5GS3A 1HJCA 4PJIE 3G5VA 3OG4B 3BVNA 3UTPE 4OCXH 3NCYP 2BSED 1MFBH 4BX8A 3RFZC 3ZXPA 1Y1UA 4F7MB 5B8CB 3K72A 1CC3A 2LABA 5E23A 5ENWA 3U0PB 5GZND 1ZLVK 4K9EL 2A6KA 3CSGA 3OJDA 2N56A 4PJDB 2QYJA 2BNRD 4N4YB 4XWGH 2ITEA 2IBGA 3UAAA 4M02A 2EP6A 1H19A 1P53A 2BFVL 1Y6NR 4FTVE 4P2RA 1AZUA 2VQTA 3PS6A 5LGYA 1UQSA 4OIFA 4YBQC 5A23A 3QO0B 4ZW8A 1KCWA 3IE4A 2CBTA 2QLYA 3L7EB 1MN4A 2H0PA 3B8YA 1ZRUA 4MD0A 4L0YA 3G04B 1C7SA 1G1YA 2BVPA 2L8AA 5DC9B 1G0DA 4N90D 1L5GB 3ARDA 1OP3H 3EJRA 5JIMA 3LPFA 4BQBA 3SDCC 3KPPA 2G2NA 3QIWA 1IGIL 2H26A 2YA0A 3WV0A 3U3WA 4JFHD 1NM4A 4V2CB 5CGYD 1N11A 5DURB 4CVZA 2EDNA 2KLSA 1PG7H 1D9KB 3X3GH 5TK2A 2YEZB 4AXWA 1A6UH 4X6CE 1HXMB 4IJTA 2Z65C 5FFGA 3SOBL 4HEPG 3VFUA 5HHQB 2WXOA 2MAPA 1RUPH 5IFJA 6TLIA 2B14A 3DSFH 1E5BA 3DSNB 3QUZD 5C0BA 3QR2A 1XDTT 3UTSB 4A7GA 3ISYA 5DYFA 5AQ7A 5I0ZA 2FGZA 1JZ3A 2VCOA 2HM8A 5IOPA 1R0LA 2GGFA 1K2DA 5EN2B 3IMTA 3VRLE 3VDBA 1M71A 3KPRD 3K4DA 4RRPM 5IVXB 3FY4A 5IB1A 4XE0A 1QFPA 3Q3GB 4XBEL 3V0JA 2DBLH 2WXGA 4F7KA 1EO8H 5K9JH 3VXQB 4LEXL 3U30B 1Q9LA 1MVUB 1URIA 3D7PA 3X11B 4ODUB 1KT2A 4NNPH 4D9QD 4XNBA 3BQUC 4C4KO 4FGMA 4FULA 2VB5A 1BZ7A 1FNLA 1FL5A 5CU5A 1XHHA 2GSMB 2P4AB 3FO9A 1RUKH 4MNQB 3O4OB 4NUMA 4XB3A 5IMMA 4JZNB 5HDQL 2E9BA 3DHUA 5BV7H 2XXCB 3HC3L 3GTVA 4IEFA 4JHJA 2ZKWA 3EAKA 3AREC 3BX7C 1WQVT 3QI9D 1YNTF 5I19L 2UY6A 2XVLA 1IM3B 4QTIL 3MLPA 3QQ4B 4YGVB 1Z3RA 2O5XL 5CWSA 3WHXB 4P2QE 4JNXA 2A73A 4F7TA 2WSKA 1Z5LB 3E6HB 5D2NE 5HI3D 1J9QA 1F1DA 2IO5A 2OMTB 1G0XA 3DPYA 4L9DA 3NIDE 4AK1A 2FX9H 1BX2A 1ZLUK 4L05A 1P5UA 4OCYH 4TV3A 3ULVH 2LVEA 2H6GA 4LVNB 4HJ1A 2VL5A 3HS0A 4GT7A 2OI9C 3TYGH 2JKTM 3RDTB 1P4LA 2NY2D 3R4RA 4LCWD 2WXJA 1OTSC 4KUZH 2H2SD 2YGNA 4PJIB 5FFOA 5CRUA 1MH5B 4NM8H 2PCPB 3KXFD 1SLUA 1YDPA 3S7JA 5B1BE 2BSDA 3SQBB 1X5YA 4Q6IA 4BTBA 4AYEC 1YCSB 1O5PA 5AW6B 2GJZA 4FNLH 4TUMA 4LPWA 1XT5A 4P4KB 2X6FA 3QZBA 4LNRB 4XH2A 4UI9J 4IU3B 3CZUB 3QJHA 4XPHH 4BKLB 4D9LH 4J28A 3PL6B 4FTVB 1V7NH 1QOKA 3IJ8A 4XWOC 3ML8A 4YN3A 3M7FB 1UXMA 4OIIL 3WFHB 4NQXA 4WFGE 3RBGA 4GG6F 1HILA 1J8KA 4GSXA 4J8QA 3DX2A 1H5BA 5K39B 4FXLA 3ZMRA 4TNWF 5EFIB 3KZ8A 2OL3B 2C1PA 2P9IG 5D7SH 1AI1L 4LLMA 3QKYA 3V79K 3CQFA 1SXNA 4YC2C 3HIZA 4F2FA 1CLZL 3HEIB 4ZOAA 2OK0L 2W07B 4QHMB 5AW2B 3BE1H 2WZGA 2X0WA 5EBWA 3F04A 2JKXA 2DLGA 3BXNB 3Q0HA 3WJMA 2EH7L 4LOFA 3ZT5A 4R2GC 5HYJA 4XO5A 4O1OA 3CVVA 5ADPH 5TE4H 5D1QC 3GIZL 5PAZA 4F1ZA 1BYNA 1BBDH 3PGDB 1F3JB 4HJIA 1R3KA 2JKLA 5FO7B 3EZ8A 1MXDA 2G75A 1PX4A 3QARA 1EYHA 4R4FL 4W6WB 1IGYB 3ZYOA 4DUWA 5I16A 1QWUA 4N0UA 4U1IB 5I24A 1ZIAA 5CUSL 1NBVL 4UYPA 5GGSY 3S3CB 4LOEA 1MCEA 2GK0B 3CHPA 4PWJA 1AP7A 5FIEA 3TBYA 2FEEL 4ACLA 1N12A 5EA0L 1QBMH 4OH2A 5HGDB 3FDWA 2PP8A 3WFEL 1LD8A 2D0HA 1AH1A 2FO8A 4DGWC 2PPCA 2XBZA 4YBLC 1OUVA 5JXEA 4Y1AA 3NFPB 2JLPA 3BUYA 2YUXA 5EC2B 1ONNA 2P8MB 4JO5A 4XCEA 2EVJA 1K8IA 4CW1A 2A6JB 3OHXB 4BDVB 1NGYB 4H2CA 1YYHA 1OT2A 1S7UA 3DJ9A 5T3XE 2OYKA 2QGDA 4JGNA 4KO7A 1G94A 3QWQB 1IC4L 4P2QB 3IF1B 4J27A 3UTTE 1XCQA 3B2PA 4OFDA 5D2NB 3D9MA 1XCTA 4EZKA 1JSYA 2XZQL 3LEYL 1FFPB 3PU7A 4MWPE 5HI4D 5CJ5A 3NIDB 2C7UA 4FKHA 3R1GH 1CQYA 2X10A 3MUZ1 4FQPA 4ZSOA 2CKBH 2RFXB 5LBSL 3ETTA 5HJ3A 1NCHA 4PVNA 4A7VA 1CU4H 1BLNB 1I4FB 1FNGA 3EOBB 3STZB 3BKMH 4FFYL 3BPCB 3H53A 1KGXA 4JKNA 1G7PB 4Y9EA 3JUZA 3N40F 3T04D 4WCYL 4WO4A 1CTOA 5B1BB 4JM2C 1FT2A 3RWDB 1NEPA 5BUGA 2Z4QA 3BN9C 1U6AH 4APQC 5IREA 5DJ8A 1WAAF 2OTPA 4K7FB 1IARB 1JGLH 3QC1A 3EGDB 2PUQT 4WHCA 1CGYA 4EBQH 3S6CA 4FC8A 4ZHBA 1FNEA 1HYRC 2Y1AA 2FJSA 3QJQB 4PRBB 5ICUA 1MCWM 2Y2TA 4ME2A 4B9ZA 4RNRB 4M9OA 5DD0H 1FZJA 4POZC 3S9DB 4PJCE 3RAJH 3EJZC 2QVIA 2WWNA 3MUJA 4HFUL 1QW8A 1LEGB 3GXPA 2F8XC 2VDKB 2X9XA 1XH1A 4ES9A 4LSPH 1D5MA 3NA9L 3HZVA 2BIHA 4XP6H 2Z31B 4KKNA 3EXLA 2DZNA 4WHTB 2Z7UA 3TIEB 2GY7B 1TTCA 2GAZA 4DTGL 4ZUTB 5JOFA 3MCG1 5GJTH 5HDLA 5DEGA 2MRYA 1T1YB 3E34A 3IGKA 4GAGL 4HLEA 5GGTL 3QZOA 4E9TA 2NY4C 5FYLD 2CBOA 5ILTH 3KLHD 1UN9A 3U2SB 2ARJQ 3GSNB 4MMZC 3UG4A 3HXBA 3SQRA 4XMXA 5D7JB 2FD6L 3C5ZA 1O75A 1MNUH 4TN9A 4ZAKB 2LT9A 4OCSH 1I31A 3M1BA 5D72H 3GHBH 5I8OL 5FCUL 1EDHA 1UD8A 4L4VA 1QRKA 3IPEA 4LSUH 1QSVA 1GKEA 3B5GA 4MQXD 4ZXBB 4Y2DC 2CH8A 1BQSA 1IKND 2X4QA 3N41F 1A6WH 3IDNA 2LU7A 3WDHA 2A4ZA 1ZVSA 4EN2A 3FFCD 3ABME 3EZJB 2X87A 3BKYL 2HJLA 4ZUSA 5LIFE 4AOFA 5C9JB 2OOEA 1C5BL 2G9HB 4UT6L 2RCSH 3VJ6A 1NGWA 4LSVH 4FQIH 2BNQD 3S3DB 3QQ9C 5EU4B 5MP6H 1KCSH 1FAIH 4KRLB 4NIKB 4QOKD 1HG5A 1YN7B 4XOEA 43CAB 2VR3A 2BMKA 4X8JB 3POCA 3IIEA 3ECVA 7TAAA 3ZHEA 4RGNC 4HZLA 4JCWA 7FABL 4PHZA 1CT8B 4Z3EA 5IMLA 4O02B 1DBMH 5F9WB 3WFZA 4HV8A 1DQJB 1SHWA 3L4UA 2QMKA 3QEUA 3ZZSA 1O9WA 3OKOB 3VXSE 2XN2A 2QSVA 3CFNA 4X7DC 4U1SB 4X8XA 4JBSA 1TZHA 3BWAA 2PW2B 1RAMA 3MKQA 2W0KA 4N2OA 3HLKA 4AWJC 1G84A 1IGTB 4XNUH 2E8YA 4JFDA 4D8PB 1PZ5A 2WOYA 3SE8L 2ZX8A 3HI1A 3CHOA 3D8MA 5KVFL 1YMMA 2XRZA 4YVNA 4H25A 4DP1X 2PXYC 2H8PB 2IV8A 3BAYA 1LWRA 3GBDA 2WNGA 4J3OH 4NXSA 5FYJE 3KJ6H 1ZB1A 2HUHA 4XO3A 3T8DA 1DVFB 1GKOA 2WBKA 4LAQL 5EILA 3VFSA 2FX7H 2LXLA 4JZJB 4OW3A 4JFYB 5DHMC 4EI0A 3O9WA 2WLHA 4ZW7A 4RGMB 4HU8A 1TQBC 1ZTMA 1OXJA 1TO5A 4MTMA 5CLYA 1HYSC 1QSFE 2VGEA 2OXGA 1LP9E 4AQ8A 2YEVB 2ADGA 5DEJA 3U64A 4LCIH 5K9KA 4AV7A 1KIUB 3AB0B 3GQFA 4NP9A 1NCDH 3HN8A 4KROD 3Q7FA 3MRBA 4HH8A 3HRZB 1Q94A 2GT9B 1MRFH 1O0VA 4KZCA 1OGPA 3QCUH 4PJHA 1XF2B 3OR6B 4HJTA 3FTUA 2FHCA 4HLZG 2JEKA 3FT2B 4PJCB 4I1MA 1DVQA 4MJHA 1XGQB 1RZ7L 4UNTA 5DR5L 4JRXE 5A2IH 3VD1A 1FGVH 4OGYH 1T6VN 3CFUA 3QISA 4AY0A 5CZKA 1IAOB 1W0VA 4JQXA 4L3EA 5GPRA 4XMPL 3T3MF 4HUNB 3LB6C 5D5MA 3QS2A 4B52A 1WTGT 3ULVF 1JFQH 4ZTEA 1FFOB 2EEAA 1U3DA 2GRPB 4FFVC 5E00A 3MX3A 5M95B 4F7CB 1OCWH 2B2XH 3B9KA 1TMQA 2A7GE 3G6AA 5I30L 3N85H 1IEAB 3NJLA 2FDBP 5AVYB 5JDSB 2PP7A 4TQHA 1JUFB 3L9EA 3MV8A 2IMMA 2VN3A 1TSRA 1TYEB 4QTHB 3SOTA 3ZTJH 3RGHA 5EIIA 2NW3A 3BT2H 1UB6B 3ZKJA 1KDIA 3Q8BA 4HMCA 4X8CA 4X5XA 2NCMA 1HDMB 4UWLA 1ECYA 1UACL 3UAJC 5L0QC 1QZ2A 4PBDA 1E2ZA 2R03A 3UPVA 4NZTL 4Y2OB 3FGDA 2ZNXA 5JUEH 5BNWA 3VVVA 1KLGA 3FF7A 4I0PD 4PI0A 4ZMTA 1ANUA 2DIAA 5HHMB 5L2JA 1D7BA 3UADA 3AU9A 4GZ6A 4UTBH 1I7UB 4BFKA 1E90A 3F85A 1F3DJ 1RURH 1AZVA 1ZA6A 2R7EB 3MRDB 2HYMA 4XZUB 1B0RA 1U3HB 3FHQA 3BRDA 3VD2A 1RZ8A 2Z1PA 4PWHA 3KYOA 4M6ML 4MASA 2AXJA 1PSKL 1JV5B 1QRNE 3W9DB 3GZ2A 5HYFA 1JXDA 1C5DA 1NI1A 3KPOA 3SKOA 5DZPA 1LEIA 3GNMH 5FKAB 2EYSB 3BKJH 4JPQA 3PWUB 2VGXB 2GQHA 1Q9OB 2VMCA 3NZ8A 3FTZA 3VXSB 4XN7A 1CXFA 2YJQA 3H7BB 1O1TA 3UTTA 1DCEA 4I3SL 1UZGA 1QP1A 4HHAB 4PV9A 4LHUA 1DLFH 1YEIH 1ONPA 4TVSa 4DVBB 4XBGA 1RK1A 5C0ND 1FSKB 5TE4L 5AB1A 4FQ2L 3UFIA 3UP1A 4A2MA 1SFDA 3KGTA 3P3YA 1YEWA 5GGVL 5IIEB 1YQVL 5T1KD 3FFCA 3RY6A 4QJ5B 4NBZB 5I1AA 4LDOB 4PY8J 3PG2A 5F7BA 1VFBA 4Z76A 3TO4C 4F15B 3LEVH 2OQJB 2PWDA 4JG9A 3OGCB 3N0PB 3PP4L 2P49B 3TBCA 4HUCA 4UIKL 1Q0LA 1QSFB 5JO5B 3B43A 1LP9B 2HRHA 3MREB 1J5HA 1MIEL 3G5YB 3KLKA 4PJAE 4YHZH 4N0YL 1WV7T 3BVXA 3D9AH 4HIIB 1QW9A 2IBZY 1CI3M 1AGCA 3SJVE 4N8VA 4P4RB 4DKFL 2VDQH 1KXTA 1FPTL 4URTB 3PRZA 5TTRA 4K5LA 3EYOA 1WS7A 2VSMB 2XGMA 3V7AE 3P7VE 2VN7A 4ZFOL 5SX4H 5FV2A 3LVQE 4TVPE 2QV4A 1LXMA 3KYKL 5D2LB 1A8ZA 3I02A 1OB0A 4HIEB 3EYQD 4JRXB 4LGSB 4LCTA 1QBLL 3EHBD 5E1HB 3DX9A 5F89B 3FYEB 4X5PA 4JY5H 2VW4A 1FPPA 4XNQA 1F8TH 3ZXSA 2YPKB 4GTSA 3IJ9A 5EZIL 1I1AD 3TA3D 3CDZA 2B7DT 5TGBB 1G6RL 1RULH 5AJDA 3LRSA 4HGWA 5K33A 1EEUA 4N2LA 2AJUH 2AFNA 4UYQA 4IBUA 5JPMC 1XGYH 2J71A 1CPUA 2YXWA 5E95B 2DJ4A 1BSIA 5FIOA 1JZHA 4DGUA 1SG7A 1CDYA 2E7DA 3HLAB 5DJZA 3H6AA 4H1LB 1S9VA 1QKZH 5FUCC 4I17A 5E1QA 3I9PA 1S9XA 4Y6PA 2WQ6A 4PLOB 4V11A 1I75A 1QF0A 4NZUH 1FORH 3BVDB 4J4PA 3GZQA 4GKNB 1EO5A 1W8NA 2A0LD 4HKJA 1IRAY 2JV7A 2CDGA 2OMZB 1ZPUA 5IUCA 2F53D 2YMOA 2VDLB 2PPFA 3OHMB 4PIRF 4PI2A 3JXAA 2EDEA 4GMSL 1OP5H 3PFUA 1SXCA 4U0SA 2DQIL 4WU7B 3Q6FA 2CIKB 3O3EB 4JFPB 2KBXA 1BYOA 2ATPA 1M6OB 1CDHA 5LCVH 1QRNB 2I9LA 4NGHL 4CVXA 4D0CB 3RVTD 4DN3H 3K0WA 1F2XK 3BW9B 1JHTA 4NQDA 5A7DB 1EERB 2BP8A 5E2JA 5IBTH 3ZDZF 4UTBA 1HWHB 5DMIL 1TFHA 2C1OA 3SE3C 2MKLC 5D96C 3COOA 3V4PH 3DOSB 4BFBD 1PDKB 4HALA 4WGWB 3W2DL 3DI3B 3I2CH 1KT0A 4YHYB 4AQAA 5EN3A 3VFPB 2QZ5A 3JV4B 1I8MA 1L9RA 1BJMA 3DX7B 4IGBB 5DD1H 4JFVA 4Z7OE 2YD7A 1MZCA 1M7IB 2BHZA 2VDPB 2F8YA 1F0LA 4PM1A 5ESAB 3EDFA 3QEHA 2XWRA 1KJMB 2KQNA 4CC4C 1QNIA 1UWFA 4OVUA 4MJIA 5H37H 3KGUA 2AVPA 4I0PA 2R2HB 3TURA 4KK9D 1I3UA 4OM0L 1S7VA 4KJPD 4HUVB 1P7BA 2ZUXA 4PU2A 2EIME 4CDHA 4JA7A 4GIPD 1RVFL 2VDNB 3TTYA 3V6ZA 3ATDA 3CVYA 3MNZA 3P4LA 4M8VA 3DWTA 1WUNT 4XMTA 2EECA 5EU6A 4PJAB 4ZYKB 3S97C 5IMOA 1U8MB 3L1OL 5SWSE 3BDYH 5DHYB 3RK6A 4JJ5A 3V5DB 4QNPE 1WHOA 4GQPH 4R96A 3CAFA 5E99H 3SJVB 4PJ9C 3HMXH 4MZIA 3S35L 3T6XA 3V9EA 1KWKA 2HJFA 3EGSA 4P9ML 4G6ML 4U7SA 5H8DA 5TH2B 4WK0B 4XNDA 5DD5L 4L4JA 1IO4C 3QI9C 5E2UH 1DBAL 2QVFB 2A1WH 2OMYB 3WSQH 3F5WA 4EAEA 3CSYB 3JQ1A 1QNZH 3S3JA 4X6DA 4ANKA 1PG7X 5BNXD 4ELKB 3BIAX 3BEVB 3BMVA 1AWCB 1P6AB 2OR9H 3IN0A 4TQIA 4OJFL 5HI3C 1IVLA 5HI5C 1DDHB 2ILLA 3MTXA 4IBZA 4JR9L 3HZMB 2OTUA 3BWUF 1S5HB 1DE4B 3TT1H 4EI5B 4CRPA 3E38A 4GRMA 1BFOB 5B22A 5F6HI 3FU7A 4FXTA 3B7SA 3ME0B 4S1QH 3OF6A 5DRXB 3UABA 1D7FA 4Y5VA 2YA2A 3CK0L 1J05B 2VLAA 3PDGA 1XSKA 2NY1D 1U8HA 5I66B 5FX3A 1J87A 1NJ9B 5CCHE 5C0EB 4IKKA 4ERSL 2BDNH 2WYIA 5EDSA 4PN6A 4I9WD 3JCKC 5I17A 4HS8H 4Q89A 4LLYA 4UILH 5T1LB 4HULB 3AS2A 4PD4J 1C12A 1X7TA 4XN5A 2J5WA 3F7PC 2WAQA 4Q56A 2YRBA 4A7QA 1T04B 3Q9NC 3GI8H 2VWEC 2DM3A 5EV7A 5ERWA 4YHKH 1LNUB 3UYRH 1EFXA 3VI3E 1AZCA 1SXSA 4WW1B 5EZJA 4LUNU 1EGJA 2MCPH 4DKDC 3ZDYE 1DEDA 1JF6A 4G7YH 3TX4A 1U9KA 5JSSE 1CXHA 1EEYB 3EOAB 1JWSB 4GLRI 3SO5A 4DAGL 3ARFA 4UM9D 4UOW1 1M7DB 3T2QA 4LDLB 4OCRL 4O4YL 5GSRA 2CXGA 4NBYB 2XZAL 2PPEA 4PREA 1WICA 4ZMNA 1ASOA 4UQZA 4MS6A 1F4XL 4YE0A 1XTMA 5A2LH 1YNKH 4R6UA 1KULA 3LXCA 4Y16D 5LCVA 2VUYA 3D9NA 2ZOWA 2UY1A 2CNZA 1U2YA 3NJXA 4Z7OB 3FH5A 2Z35B 4I2ZA 3VGAB 5CJQL 4AV0A 3MCKB 3ARBA 3A4DA 4AEHL 1CD0A 3II3A 4GQZA 2FWUA 2JVUA 4HUWB 1OCRE 2R2EA 3M07A 2DQMA 3VCLA 1M57B 5D1XA 4QJ4B 3NJGA 1R0KA 5D0OD 8CGTA 2YPVH 2VJXA 3ZYZA 3CBRA 2EIMB 2OAAA 3OAYH 4FI8A 4ONGL 1KUMA 1IBYA 1SBSH 5CEYB 3K91A 1N0XL 4HK0A 4TLNA 4KT6B 3B9AA 1Z2KA 4JQVC 1YYCA 4Z7IA 3ASGA 4X4XB 3LIZA 3P3RA 4YSPA 2OKMA 2R29L 3BKCL 5SWSB 1AANA 2C9PA 3QUML 3L6FB 1JG9A 1LD7A 1H6EA 4WJKB 3RIFK 3ECQA 3OC5A 1RUMH 4M48L 3B9VA 1KPUB 4FCAA 1HZHH 4NRXB 1OK8A 1VFMA 3RGVC 1WBXB 4KTEL 1NC4D 2WGNB 3OZLA 4XB8A 3UMTA 1FLRH 1T83A 2OBGA 4Q9RL 3W0WE 4N8CH 1BEYL 1BPOA 1UXLA 4JG0L 2PR4L 2X0VA 3Q2VA 4OKVB 1BIIB 3I9GL 4WWKB 4QHNB 2Y2WA 1FVCB 1HN1A 4J8DA 1X5ZA 5KYXA 1XF5A 4FEMA 2Q10A 2C3VA 1AO7A 1PZDA 1WCBB 3ISRA 5F9OH 4W9IC 4PTTA 4YL9A 1JPSH 3MNDA 5FGCE 4G24A 3ZE0E 3QNXA 1A17A 5C0GB 2ZG3A 4M7CA 1IL1A 2H6FA 1ONQB 4PMFA 3KPSE 5GRJH 4RSYA 3I75A 5E8DL 3M1CA 2P9PG 2Y25A 3BAIA 3IMBA 2YK1L 3TEUA 4EIZC 1PEWA 5J3HC 4FE9A 4BHUI 2PF6A 2W1NA 3VWJA 3KPNB 5KOMC 3RRQA 1MF2L 3V4LA 1U95A 4MA8L 5ISZE 1W6WA 4JPVL 4TNLA 4KUCF 4P3DB 4Q0XH 1TVHA 3MXVH 2EXTA 5KVEH 1U3JA 4K23L 4A1GA 2YRLA 3QG6B 3Q8AA 2ZCKH 4XC1L 3SKMB 3NYKA 4ETYA 3EO0A 1WIUA 3FO1B 3G6DL 2FT7A 3VI3B 3U6RB 5HYSB 3Q1EA 5E6ZA 2UX7A 3F6QA 1JNNL 1UWGL 4PB9H 4IJ3C 5F1NB 5GQBA 3HW2A 3DPBB 4RQQB 3ZDYB 1JV2A 4A6YA 1FYTE 3JV6B 4DO5A 1DO6A 3NAAL 3ULEG 1PLCA 4L5FL 2A6DA 5KSAA 1N68A 2R69A 4NRYB 5IVZA 4K5MA 1XGPA 1AAJA 1BOGB 3T8MA 1N10A 3O6FD 3FH8A 1SJHA 3OMNB 1S7TB 4PP2A 1MCRA 3KS0J 1NANH 2XWXA 3MA9L 3KLHC 2VTFA 5EIVA 3RFZA 2I7SA 4QRPA 3LN5B 2BINA 3RY4A 4BSVB 1TN8A 3AU1B 3RWJB 3PUJA 3QPKA 3ULYA 4FJZA 2KPNA 2WY3B 1KTKE 3F65A 3CFJA 2QR0B 4K71B 2WQXA 4B96A 4K94C 2F5BL 5DK2B 4UV4L 1KBWA 2VDKL 4I13B 1GGYA 3K6IA 4EE2A 2J2ZB 1OCRB 4KYOB 4DN4H 3FT4A 1MUJB 2O26U 3M1OA 2FNWA 1INDL 1CE1L 3HBQA 2D7QA 4ILIA 6FABH 3CDYA 1INEL 2Y3AA 5LWYL 4ZMYA 5J90A 4XHJC 5HVGB 3UT7A 4HRLA 4GFXA 4R4BA 1F2QA 4EHMA 2O7GA 4JNDA 1XGTA 5DLML 3UZEC 1VADA 4UM9A 4U7EB 4WV1A 1JYVA 3CE1A 3ARYA 1QYGL 2FJHA 4OZGE 2YPVA 3NCWA 4C4UA 1GC1C 5ECJE 4KKCD 5K59F 1UOWA 1VSCA 1LWHA 1OGAE 3HE6D 4F8NA 2PYFA 4RBPH 3CH8A 3P3SA 2WQ8A 4UTAL 2J88H 2EQXA 3W9FA 4TQPA 1I3GL 1EO7A 1ZAGA 1PAQA 1SYVA 1TU2B 1AHWB 1UZ6F 1NGZB 5AAPA 2UVEA 4DKEL 3P7SE 3W0WB 4ZFQA 1EPUA 3D2UB 1L3FE 2EABA 4PY7A 2O61A 2BZ7A 1CE6A 3BIKB 1MCKA 1GXWA 2YD6A 4JZOA 3ZNGA 1FJWA 2R1XB 4DP6X 4XCNB 2V33A 3ZU7B 3L9YA 3QXUA 1KSRA 3PJLA 3VDAA 4W68A 1JDAA 5GGUB 2VXVH 1LE9A 5EYLA 3EJCA 4YX2L 5ITBH 4UU9B 3E1ZA 2UUDH 2PM6A 1PZSA 3VI4A 1QFHA 2CA4A 5FGCB 1ECZA 3ZE0B 1N54A 2WZ0A 4ISVA 3LY7A 3DVNB 1CFNA 2Z93A 5DYOB 5IB4A 3G9AB 3DMMB 1Q0XH 3KPSB 3PJSB 3CFKA 2UWEF 3JYBA 4FEIA 4NQCE 3T3PE 4AE1A 3ESMA 4DHLA 1XFPA 3N44B 5IW3A 4LLUB 4L4TE 4BZ2H 3AREA 4KZ0A 4HD9A 5HBBA 1RZJC 2AKRB 3BG0B 1CLYH 3C08H 5ISZB 1AFVH 4JFQB 1B88A 5KVGE 5KG9B 1HESA 5C8JA 1OTUC 2DQHL 5DJ2A 3HG4A 1HTYA 4DUVA 5HQ8A 4OV5A 5KJRL 2X89D 4XT1C 4XPGL 4OU3A 3TJHC 43C9B 1QLEL 4HAKA 3UXGA 1KLUA 3GSVB 4MTWE 5TDPB 2DIWA 5E9AA 3HVNA 4OZ4B 4X8GA 3DHJA 4GKZA 1A7PH 2L7EA 5I76A 1FYTB 3QJUB 1G9MC 2G5BA 1DDTA 4P5TB 1CDIA 5JXAH 1CLCA 1U30A 3WLWC 3KMDA 2CHXA 3D18B 3QK0A 4LF3B 1G9EA 4P2CG 3VW3L 3CVBA 1IEBB 2VN5A 3MUGA 2AXFA 3SSBA 2BY3A 1K8DA 3P11L 5G4OA 2ED7A 3QUYA 4P2OA 5AKTA 3TJPA 4AGMA 2WLIA 2H1XA 3ZHKA 1IQRA 5FO8B 2DLIA 3Q44A 5IQMA 4Y4KD 2B16A 1A9BA 3B37A 3PZ1A 4RWYL 4PGZA 3DO1A 1AXTH 3PWVA 5I1HL 1UWXH 2D2OA 4UB0L 4N9GA 3SGJA 2ZSVA 1DBJH 2ID5A 1FO0B 2OV8A 1OT1A 2X44D 3K2MC 1KGCD 1TJCA 5I1CL 1P9MC 4CBPA 5JLZB 4Y5XA 1HSAA 3FQXA 3EBAA 2XPGB 3ELAT 3QCVH 5DEZA 4K5OA 2APVA 2DW5A 4N3CA 4I77L 4PGDB 4E9XA 1PZBA 3HE7D 4I8DA 3IHYA 3FUDA 3P1VA 4KRPB 3MI6A 3FB7A 5DZ9A 5C1DA 5MEOA 3WHE0 3B3BA 4AW7A 4X4YB 4AL8C 4S0TD 4DPAX 4A2DA 3GJFK 1CZ8H 3O8XD 3G6JA 5D4QA 4OZGB 5FINA 3RC8A 1G7LA 4XCYA 1AR1C 4U6VL 3DIDA 2IAMB 4HYTB 3MSPA 2MEJB 4M93B 5C0JA 2DQJH 3WEMA 1UVQB 1FI8C 1OGAB 4ZO8A 4JB9H 5TPWL 5EF2A 4RDQF 4E9YA 1HIMH 1KV3A 4TNWK 4M5YH 4KXKB 2ARJA 3ZHLA 3RB7A 3QDJD 1AD0B 2NTFB 2C34A 3ASFA 3UZVA 5J08A 3LQAC 2ZUYA 5D1ZI 5DUPL 2R4RH 3PWNB 4JO4H 5ENRD 1J8HE 1JXKA 2H9GB 3ESUF 1YEJH 1BGXH 2V5SA 2IGFH 1YHPA 4JFEA 1U93B 4F3FB 4F9LA 4GXVL 5DTFB 5ELIA 3S98A 5BW8C 4LNUD 1J5DA 2NSQA 3GMQA 1EAPB 5HVHB 1E9PA 1NFAA 4TLUA 2HFGH 3OB0K 3T2HE 1UM5H 5BQ7A 3ECUA 4DVRL 4F53A 2XQBH 4BFIA 2WQSA 2KZ1B 4L29A 3VNYA 2QT6A 3TGOA 1LMKA 4XMUA 1FYHB 3K2IA 3MRFA 1ACYL 2B5IC 12E8H 3J5QB 3V0WH 1ND0B 3O3UN 3WS3A 4H2AA 4NQCB 5HHPA 1I8KB 3HXCA 3T3PB 3L7FB 3K1KC 4HWBH 3RVWD 1TVBB 4NO2A 3RX7A 3OSVA 4KOCA 2PLTA 4E0RB 2SEBA 1RD6A 1P7QB 4PRNA 3NAWA 2VLKD 3TH2T 2BS8A 4MDJA 5FK9A 2VJ8A 3L3GA 1SJEA 2YQBA 1IYGA 1CFQB 3BH8B 1NLDH 1K3ZA 2AQQA 3D0VB 4R5VA 5FYJL 3PEUB 1XF3A 2QBWA 1DHKA 1F18A 3CFEB 1MEXL 4BZ2A 3FORA 1K4DB 3GS0A 3HG3A 3OZ9L 1Z0MA 1EDQA 1VEMA 2XKNA 2A9MH 2ZWZA 4LPVA 3VRIA 4FDWA 4IIZA 1F45A 4N5PE 3W5NA 4AGNA 2J09A 4UWHA 2IDCA 2ZD0A 1VRSA 2VM3A 3HA0A 3V4VB 3V6BR 4U1JB 2W9DH 3FTGB 3AMKA 3O4LD 4GEIA 3T0YA 4KV5F 4LSTH 4JM2A 1T66C 3U9UA 5J13C 2R0LL 4APQA 5SX5K 4GBXB 3GBNL 4LSSL 1QFOA 3MV9A 4F8OA 4JHWL 5F1KC 1ES0B 4XMKL 2HPTA 4CZ2D 2KDYA 2XA3A 1YECL 1DQML 4LL9A 2NNAA 5C6PB 5KN5B 5CJOH 3FOLA 4MGXA 1HQ4A 5ABDE 2YBRA 3QIBD 3D39D 4RG9A 1JVSA 2QSCL 1GW6A 3CGHA 4LNBA 2VTBB 2DMCA 2JKIS 1IC7L 2X40A 4DLOA 3C5JA 4ZUUB 2Z0UA 5FPIA 2A0LC 3T65A 3ZX1A 4ELMA 2YKLH 2F54D 3DRTB 3S7FA 4MAYB 4UDTA 3L1GA 5C09E 3TYFA 3OGOE 3MLSH 1JN6B 4LUPA 5EYPF 1IGCH 3DSWA 2ZXDA 3QC5X 3IJSB 1TZGH 3W82A 2NY3B 5F2FA 1U8QA 1A7RL 1O6VA 1BQHB 4PIBA 3C6LC 1YC7A 3ZE1F 2ZXEB 1CGXA 2OW6A 1BVOA 2CJUL 4K8RC 3CC5A 4Z7WF 3WN5B 1N94A 3UBXA 1EVTC 2Z92B 4MMZA 4R7NA 5FA4B 4WO0A 4Q8BA 2I60L 4DQAA 4AICA 1DSWA 4D0DB 4IHOA 1JPTL 2G2RA 1ELWA 1P4UA 1TFPA 3WKYA 4A3VA 3SYCA 1GPOH 5G04C 4HUUB 1YAZA 1A6TA 2NRDA 3CZNA 1K5NA 3NTCL 1AGDA 2DMGA 4PFEA 5EHFA 3F3HA 1J8HB 2VGYA 3SCMC 1W80A 2VDLL 3RFRA 4UM8A 4LVEA 1UJ3B 5LLIC 3WNJA 2PWGA 2APFA 2ZX7A 1T2XA 1BD2E 4PUBH 1RP8A 1S6NA 2YSTA 1USZA 3EFOB 1X6LA 3DX3A 3HRPA 2BH0A 3D0LB 3UYOD 1O9VA 1WC7A 2V37A 4KK9C 4YE4H 3REWA 4JC8A 1CFMA 5JHBA 1HE7A 1PTZA 2V9QA 3KWWA 4O00A 1JMXA 4H0GA 1WZMA 3HRAA 3NG5A 3BZ4A 2AERT 1T03L 1R5WA 4M4RB 2P58C 1E5YA 3PE3A 1HHIA 4PB0L 2CA3A 2ZXBA 1A4CA 2W59A 1L6ZA 1RUQH 4NQVB 2F5AH 2IWKA 2R0ZL 4CU6A 5FUOH 4YSDA 4MFHA 3LH2H 4BRJA 1ASPA 3AWEA 4LSRL 3ZT7A 4QT5B 2AV1B 3DURB 3HI5H 3MQIA 3ASDA 5EEVA 3W1ZA 4QRRA 1BZOA 4Y5YC 5HQDA 1CBVL 2HO1A 1V3MA 4NENA 2I5YH 2X1WL 2XWTA 4FP8H 3WFDL 4YSCA 2K78A 1KLXA 2Y1VA 3OLGA 4HWBA 1N6QL 1TVDA 4H1LG 3LEXB 5D7LE 2FO4B 2MPAL 3TZVD 3KH3A 2PXYA 2Y6TE 5A3IC 2XG4A 2HT2D 4N0CD 4GTPA 1FIGH 2JB6B 2OCJA 1HX0A 4A2HA 5JPNB 1TLKA 1XZ0B 4OR1A 2VXQH 1G9NC 1ZU2A 2QHLA 4LARH 3I5PA 5IT2H 1ZLEA 1DQIA 2C9QA 1AVAA 4G6AD 4HJUA 4YUEL 1D7CA 2FBJL 2J8UE 3IFNL 3QJVB 3KBFA 4KNTA 4NWUH 1FC1A 1U8OB 4IOIB 5JW4N 1P0SE 2H3NA 1TETH 5BXOA 3OKKA 2ITDB 4GKOA 4LCYB 5KNGA 3RKVA 1J7VR 2X4PA 3MKKA 5F9WC 3NMEA 2WCGA 2Y7OA 3QIUD 4TVPL 5ACZB 4Z7VE 4LAJH 3L9TA 5JMWA 3LDBB 4RRPG 2FQEA 3IM1A 4L8DA 5E8OB 1I7ZA 3QHZH 4G72B 5DQDH 3J27A 5D7IA 3VWKC 4NKMB 4GKLA 5C09B 1LNDE 5DD3L 3U4EB 3LNGA 3L13A 2XLLA 3UT8A 2GUOB 3WYRA 5CEZE 4KO6A 2JIXA 4I1OB 2YAPA 4KQ3L 2WHZA 3TBWB 5IM7A 2P80D 3OKNA 3DSUA 4JM2F 3VGFA 3RVXC 4C47A 2QHRH 4WKZA 4Z3HA 3D2TA 3HG0A 4GG8A 3U1SH 3R7QA 3J07A 4EUPH 4YXHH 4OD2B 1MLBA 3CDGB 2YUZA 4MJ5A 1KYOK 5F3HA 5HTSA 1D5BB 2AK4D 2WLLB 2J6WA 4I3RH 4RMBA 1LD9A 4XGZB 5HP5A 3MRJA 4P2RE 3TWSA 3KWVA 4TULH 2ED8A 3PE9A 3RWFA 1DANU 3OJVC 3ZE2F 1IM9A 2UYLB 4Y16C 3A21A 5K9OB 4MA7H 3ERXA 5D93B 3UAJA 5IOKA 4AXHA 3U4KA 2IH3B 3D5OF 2QFRA 5EPMB 3IB4A 4OZIA 4U1GC 1NA0A 4KX7A 1BD2B 2Y5TB 4X6EB 2WXMA 2GCYA 4C54A 2DQFB 4GQQA 1EBPA 1DEEA 2WBJD 1IQWH 4ZN6A 2HT4C 4KY1L 3IJYA 3V7AG 4AQOA 3ECBB 5HHOD 4EOWL 3MAWA 4W9ZA 5E5MB 3T2OA 5B38B 3X13B 5JHDA 1ZLDA 5F8RC 3FQUB 5E51A 1KCVH 1ZA3B 2ADJB 2DWEA 1Z3GL 4NC1E 2WINB 4LP8A 1X5AA 4JPIB 2VC2L 3GJEA 2ICWI 1N5YL 2VH5L 4NLAA 1NOAA 1DUZB 4U6YA 2FBOJ 3HHMA 3RIAF 3NOCD 2W0LA 5GRWA 1OF2B 3C60B 2E4TA 3SQOH 4LIQE 3VQMA 2HP4A 5KAQF 4GS7C 2J8OA 2QTEA 2PCFB 2G5RA 4J12A 5INDB 4NHCL 4QO1A 4D9WA 2JD2A 2H1PL 4FG0A 1MW0A 1BZ9B 5D7LB 4YSUA 2ENJA 5FOBB 1Z9SB 1Z5HA 3BPLC 2V3FA 5EOQH 3BIBX 3SKNA 5L2KE 1XB6A 4ZD3L 1JXGA 2H6PA 1F86A 4L9LB 1KGUA 1FNAA 2XVBA 5LO7A 1GJUA 3INUH 1TTAA 1ADQH 2X2YA 3M7OA 1UM6H 4N26A 5TLIA 2DQTH 4HCIA 2VZ1A 2ZWNA 2J8UB 3BJ91 3VGHA 2GROB 4OI5E 1GJWA 4UMSA 1WHPA 4HIXL 2Y7QB 3C3OA 4AIZB 1U3HC 4OM1L 4JPWL 4F2MA 1UD4A 4A68A 1H8OA 4JKPH 3VXOA 5ID0A 3O48A 1J12A 5MHSE 1CDCA 3GF8A 3GSOA 3JTSA 4PBVC 4G9FE 1WAAE 4M5ZL 4NQED 1ORSB 1ORQB 4EDXB 1X4ZA 4E9LA 3F2PA 1PZAA 2EADA 2MAOA 4YDKH 5L4MA 4JJHA 4NS0A 2QKSA 2XZTG 2KI6A 4Z7VB 1UCBH 3HAEH 4YIQA 5EOCL 2ZUQB 3CIAA 4J3TA 4JDEB 3SPGA 3W56A 4EBAG 4P06A 1NDGB 1KCRH 5DWPA 1MAJA 1FZOA 3DO4A 4G70B 3LYAA 3I3DA 3L45A 2OZ4H 2F15A 3SO3B 3V0VB 4PJXA 1OAKL 4V3IA 3VVMA 1EXUB 1HHKB 1XF4B 3R8QA 1AACA 3QDHA 3JYSA 2ALWA 2CO4A 3BVNB 5I1EL 1S3KL 1G5AA 3MSNA 1DUYA 3GZPA 2WVTA 1A3LH 2CJSA 1T2QH 3NCFB 1WZAA 3TBTB 5EH1A 3KCPB 1MPAL 4G8IA 4AMKL 1J0YA 1XGUB 3IMVA 5ENWB 4ZFFA 4GZ5A 5JPMA 3OJDB 3MRQA 5CU9A 2J9QA 2OPCA 3E0GA 4ZNEA 1E4XL 1N3NA 2H32H 4H20H 4Q58C 3UT4A 1ROWA 3HNVL 4P2RB 4PV8B 1MDAA 3RUGA 1OP9A 4UAHA 4Z9KB 3MV7E 2C9AA 2XQYG 1UYWL 4KZDH 2W9EH 2WKOF 3FQ1A 4EUPA 3C5XA 5KZCD 5FECB 3JZYA 4MD0B 1SN0A 2FEJA 4OF7A 1A25A 4TLIA 2CO7A 5E0QA 2G4ZA 4L9PA 4HKZA 3F12B 1JZ6A 5KCMA 2QPFA 2A6IA 3V79C 4XAWL 3DRAA 4Q96A 1FUNA 3CBKB 3G08A 1SHSA 3KPPB 4NCC2 5F7EL 3HFMH 3LXUX 5AWNH 4GKSA 2FLRT 2NYJA 1JYWA 1LO5A 5MEQA 3C5RA 5E2TH 4CVZB 2N4IA 3F7KA 4LGPB 4AXWB 2VQ2A 3MRIB 5DMGD 4CA4A 1KIQA 3B2VH 1D2OA 4U0QB 3VFUB 4MHHI 4R7LA 4CVWA 5E8NA 2HG5A 5HYJE 2X2IA 3TCXA 5LGJA 1W16A 4PJGA 3L5XL 2EDBA 4G1EB 1XH3A 2HLEB 4O2CA 4NHUA 5IOPB 1T7VA 5G04J 2AK4A 2VLJE 1WFOA 2XENA 1M71B 3C09B 3GXMA 3OB8A 3M8OL 4OZIF 3TWVA 2HKHH 5E9NA 5ITFB 2ZOTA 1N95A 1AZZC 3A06A 4OCNC 4CGWA 4J3VA 3ZUVB 2BWQA 2XWCA 5E4EB 4ZPVA 1DVPA 1DBKH 2NY7H 4JDTH 3CBJB 4GPKA 15C8L 2M2DA 2VAJA 1OY3D 3GZKA 4UDUA 4BELD 2L7QA 4WLCA 1KT2B 2DDQL 2EIZB 4FFZH 2IG2H 4CC4A 3AROA 2GRQB 2IDFA 1BZ7B 5FZQA 1GGIL 1A6VL 5L2KB 1R5IA 5DLHA 3NJVA 1FL5B 1E30A 1U41A 4BE5A 1S7WA 3FO9B 1S64A 5IMMB 1QBBA 2KZKA 5F7FA 3CFCH 3ZBMA 4IEFB 3GS4A 2ZX6A 3CQQA 3DBKA 4MDIB 1MZYA 4JFFA 1UWEL 2NY6D 5HHOA 3WY1A 1CICC 2J73A 4WFHE 2P9NG 2UY6B 3X1FA 4XVOA 3NJMA 1JGEA 3W11D 1FFQA 5HYSG 3O0RH 4DETA 1FCCA 3BPNC 5KSBF 1N67A 2A73B 4GYYA 1ADQA 4G9FB 4JQIL 4PJ9A 2JH2A 4WDIB 1TZAA 2CLRA 1CFVH 1INQA 2C3XA 3D85A 3KYNB 3EH3B 3GUFA 3MRGA 4S1DC 1FT1A 3UO1H 2CR3A 1J5CA 1BX2B 2COQA 2WYTA 2XNAA 1P5UB 1D6VH 4H8WL 2AI0H 2DD8L 1TQCB 2JK5A 1U58A 1QLRA 4S0SD 1BZ8A 1QBQA 4Y9BA 2VL5B 3RVVD 4LDEB 4D91A 5FCSH 1BF5A 2YIHA 3APNA 3T3ME 1YNLL 3RJOA 2CCWA 4W9RA 2I7OA 5LUMA 3QPXL 2PTVA 2HTKD 4F7AA 3NRQA 5C7ZA 3ORJA 3SYAA 4DGIL 3T73A 2ZP9A 3ZZLA 3ULVE 5F7KC 4M3JA 1JZ8A 3FCQA 4BK4A 2GJZB 1PX3A 1SVZA 2YPLA 2LOEA 3BU8A 3ZK0A 4X9YA 1RUAH 3SBWC 3O6ML 1JFHA 1CDJA 3DVIA 3X1BA 5J1TC 3D3VD 3T74A 4N2IA 4PJ8D 2XGSA 2W95A 4GW4A 4L0PB 3MV7B 4DIXA 4JHAL 4NQEA 4WI7A 4NQXB 2IFGA 1HILB 2CRIA 4Y4KC 3OZKA 4M29A 1X44A 4GRLC 3TV3L 1DL7H 3WQRA 4GSQA 2H32A 5JC1A 5H7PA 2NYYD 1EEZA 2D3VA 2X6CA 2CKNA 4K9EC 4JO3H 2I9TB 3D06A 3N1GC 4OD3H 3VXTA 3QHTC 3BZEB 1SMOA 3IDIA 5EBWB 5LP0A 1U0QA 3WJMB 2NXYC 1EHLL 5K93A 2DIEA 4JDVA 1G7MB 3AG2B 5HYJB 4PJ6A 5D4JA 2H4EA 3ROLA 2BY2A 1CXKA 3A4AA 4UT7L 5J7CC 4W9DC 1LO2L 4MJ6B 5D0QD 2FH8A 4K94H 3RGBA 4JVWA 3FP3A 3TN0A 3VU2A 2VLJB 3LPWA 4FU3A 1R3KB 5IHUL 4C59B 1PY4A 2G75B 3FN9A 4WI2A 2FO7A 2XTLA 5I16B 1CR9L 5IJBC 2RA1A 5DS1A 5E1IA 2AGJH 4ABVA 2X4TA 3EDKA 4NN5C 1G5GA 2ALAA 3TBYB 4P23C 5CCGE 3H3PL 4G83A 4KU1A 2ETWA 3SDDD 3QEGL 1UA3A 4RCVA 1X5GA 1H3PL 3C98A 1J9RA 3QJOA 4HOQA 5IQOA 1GC1H 2DI7A 4FABL 4LHQB 1MAML 2EEFA 4MLIA 4XCFH 5KYUB 2AITA 1ETJA 1YY8A 4O2FA 2GRLA 4ZBJA 1GGBL 4JQVA 3SHFA 1K8IB 1IC5L 4L7TA 4OAVB 4CW1B 5K1NA 2FWLB 1I9IH 2GEQA 4ABNA 3FULA 2YD5A 3WLBA 5J6HB 4F2EA 4ZS6C 4ZS7L 5KTEL 5HGAA 3AABA 2D2CC 4H88H 4JFDE 5BV7B 1XCTB 1YMME 3T4AC 4WZ9A 3T2LA 3RGVA 1D9KD 4WSKA 4UQ2A 3T08A 2C7UB 4RFNC 2GJ6A 4TSAH 3WIHH 3CZKA 1OL0A 1TEZA 2YAFA 3NOIA 4KJQD 3MRHA 1A6AB 3WBDA 2QSTA 2L0DA