2XPYA

Structure of native leukotriene a4 hydrolase from saccharomyces cerevisiae
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
632
structure length
628
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEGKNKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUKOTRIENE A-4 HYDROLASE
publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 216
structure length 628
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpyA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpyA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpyA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpyA01
3CHRA 4GERA 3QGOA 3FTYA 4M65A 1LNEE 4ZW7A 4XN9A 4DPRA 4XO5A 8TLIA 3FV4A 3T2HE 3FUHA 1TMNE 2R59A 1LNDE 1Z5HA 4XO3A 4XN5A 3Q7JA 3FXPA 1LNAE 3FTXA 4KXDA 4R5TA 3T73A 3EIMA 4E36A 1GW6A 4QPEA 2XQ0A 4XMVA 4F5CA 3MS3A 4RVBA 5FSPA 3MDJA 2TLXA 4J3BA 4XNAA 1LNCE 4OI5E 5CU5A 1Y3GE 3B7SA 4WZ9A 4QMEA 5L3UE 5K1VA 4FYSA 3FULA 3Q43A 2ZXGA 4QUOA 1KROA 3QH1A 8TLNE 4D91A 1FJWA 3KEDA 1FJVA 3FH7A 1KJOA 3FTVA 4ZW8A 3CHOA 1BQBA 5DPEE 3P7WE 4ZW6A 1Z1WA 1QF2A 4TLNA 4ZX6A 5AB2A 7TLIA 1H19A 5JS3E 1U4GA 4PVBA 3B7UX 4XN4A 2TLIA 3P7QE 3B7RL 5K7TA 3N21A 4K5NA 3FUIA 3CIAA 5LG6A 3NQXA 3FU6A 3B34A 3T8FA 3EBGA 4ZW5A 1SQMA 5FSSA 1KEIA 5BPPA 3B2PA 5FSJA 1Z9GE 3FUKA 4FYRA 3T8HA 1PE7A 2HPOA 3FGDA 4PW4A 1LNBE 2VJ8A 3FH8A 4KX8A 2A7GE 4MWPE 3FU5A 1HS6A 2XPZA 4TMNE 4D9WA 4XN2A 5LIFE 4KXBA 5DLLA 3P7PE 5A3YA 1HYTA 3B3BA 4XNBA 1ESPA 3FU3A 5LDSA 3DO1A 5JSSE 1KKKA 3P7VE 4JBSA 5DLHA 4XN7A 5HQDA 4FKKA 6TMNE 5L8PE 5JT9E 3LS7A 3TLIA 5JXNE 4TLIA 3NN7A 3B2XA 4XN1A 4ZX3A 4OW3A 4MS6A 3FUFA 1FJ3A 3DBKA 2YD0A 1TRLA 2HPTA 4HOMA 1THLA 2WHZA 1KJPA 2WI0A 3TMNE 1GXWA 1PE8A 1QF0A 3CHSA 4L2LA 3FORA 3DNZA 4XNDA 4XMXA 4B52A 4RSYA 3Q44A 5LWDE 3DO2A 1KS7A 1ZDPE 4ZQTA 3T87A 3FLFA 2VQXA 3P7UE 4Q4EA 3FUNA 4R5VA 4NAQA 3PUUA 3FBOA 1OS0A 2DQMA 1TLIA 4P8QA 4N4EE 4XMWA 1TLPE 3MSFA 3P7RE 4K5LA 4K5OA 4QIRA 4XO4A 5FXNA 5L41E 4FYQA 4MKTA 3F28A 2DQ6A 3QNFA 3F2PA 3EBHA 1EZMA 5AENA 3CHQA 4MZNE 4Z7IA 4NZ8A 1L3FE 4R5XA 1FJTA 3T8GA 4KXAA 3ZI6A 3QH5A 3T8DA 4XMZA 4TNLA 1FJUA 3NQZB 1KL6A 4MTWE 5JVIE 4H57A 3MSAA 5AB0A 3SE6A 3QJXA 5TLIA 1LNFE 4FKHA 3U9WA 3P7SE 4PU2A 2XPYA 2G4ZA 3T8VA 4QHPA 4X2UA 3CHPA 4KX7A 4FKEA 4OU3A 3P7TE 5TLNA 5C97A 3FUJA 3T8CA 7TLNA 1FJOA 6TLIA 3EBIA 3NQYB 4K90A 3FUEA 4ZX4A 4FYTA 1PE5A 4N5PE 2TMNE 3FTZA 4XN8A 3B37A 3FH5A 3FU0A 5FWQA 4K89A 3B7TA 4XMTA 3FXSA 3T2IE 3FHEA 3T2JE 3SSBA 5TMNE 3T74A 2GTQA 3FTWA 4R7LA 4KXCA 4ZX5A 4N66E 4KX9A 4Q4IA 1NPCA 3FB0A 4PJ6A 3MSNA 3FCQA 4XMUA 4ZW3A 5J6SA 1KR6A 4K5PA 1TLXA 5DPFE 3DO0A 1FJQA 3FTUA 3FUDA 3FUMA 1QF1A 3FTSA 4MXJE 4K5MA 4GAAA 5DYFA 3FVPA 1KTOA 5LHDA
chains in the Genus database with same CATH superfamily
1GW0A 4OB5H 1EO7A 1QLEL 3HXFA 4JRYE 3FTYA 3VD5A 3TBSA 1MREL 4YS4A 1A2YB 2AJZA 3L95B 1EZSA 1KLXA 3FRUA 4N86A 1T3FB 5CEXA 5J57B 3QUML 4Z0XB 3MJ9H 8TLIA 3FQXB 3Q48A 3LXAA 3Q47B 5GS2D 3NPSC 1J5HA 5DUBB 2Y3AA 1D5IH 2IAAC 1FPTL 5AAOA 2KBGA 2YK1H 3BIKB 1DFBL 1CC3A 5B1AB 1A6WL 5IHWA 2D0GA 2E47A 2E9WA 5DJZB 4OLWH 3DUSA 2LR4A 3Q7JA 3FWVA 3N40F 4CDMA 4PS7A 1JGEB 1N4RA 1UJ3B 1GY2A 4HLJA 4WUKH 4YLQT 4KXDA 1QNZL 2JV6A 4Y4KD 1UWGH 4Z7WF 5HI5C 5D71H 3H7BA 4WUUB 1Z7JA 4I43A 3MROA 4X6CB 5B39G 4QTIL 7CGTA 1E9OA 4XZ4A 3P30L 4PJIA 1M2VB 4WO4A 3CLFL 2ICEC 4GKLA 4IMKA 3MRBB 1SM3H 4E9WA 1W0WA 3Q6GH 2UUDH 4FN0A 1AKJB 4G8EA 3FQNA 43CAA 3WENA 3CPLB 3ZPDA 4POZD 5IB4B 4L1SA 3C87A 1G87A 1HZLA 3HPLB 4JREC 2QHLA 1T0PB 4XNAA 2A74B 1XEDA 5C0CB 4IMLB 2K7PA 3E30A 5CZKA 4AT6B 4LSPL 1RULH 4Q69A 2X6CA 2F53B 1FL6A 2EDLA 3KYMB 3PNRB 3H2WA 3NIGE 3QCTH 2WWMC 2X70A 1SVZA 2QY7A 3MVSA 4RMWA 5BV7H 5HYSA 2P80A 4XPTH 2AK4D 4I4WB 3D9AL 4PJEE 5BOPA 1NM9A 4OD2B 1UC6A 3C9NA 2BSRA 1RK1A 2EGHA 4OLYH 4H2CA 1FNGA 3L3DB 4WWID 4D10C 4K2UL 5DIZA 5SWSB 4QYOA 4ACLA 3KWTA 2AJSH 2QKIA 4J6RL 1RLBA 4OOEA 2D8KA 1FIGL 4PLKC 1U3CA 5MI0C 3WAJA 4DPBX 4NT6B 1IFGA 3ME0B 3VA2C 3K9IA 1CFVH 1CDGA 1QQDB 2CJUL 3P1UA 3CSBA 1OV8A 3P7WE 1Q9KB 1WA2X 4HV8A 4IOFC 5EUOE 3ZTJH 2AQRA 4B27A 1YYHA 1QF2A 1E27A 3HUJA 2IDCA 1A1NA 3TM6A 4DTGH 4XC1L 5DJ0B 5AYWD 4N39A 1REIA 2VQTA 4EI5B 4JNXA 3V9CA 4ZG1A 5HPOA 4Y9FA 1F4WL 3HUJE 3PF2A 4TSAL 3FUIA 4N8VG 4O00A 1FLRL 2PYEE 2OMNA 4JAMB 3GO1H 1NAMB 3QUHA 5HGAB 5IKCB 3IIEA 1NICA 2FE0A 2WP3T 4WO0A 5I1LA 4PJIF 5DR5H 4IS6A 3VFNA 5KSAA 4OZFG 1E6JL 4X5WA 5DFTA 4ZAKA 2VKXA 3MCLH 3HNTL 2GY5A 4LCUB 3LNDA 4GXUN 1NMAH 2X2IA 4DP5X 4YFLF 3B2PA 4UT6H 2ZKHH 3MJ9A 1A4KA 1NEZB 2GSIA 5E6YA 5TFSL 5JOPD 1LEGB 5HYIA 2UWEE 1JG9A 3S5LB 3CLEL 1OSPH 2IH8A 3ZE1F 4CU6A 1PY0A 1XCXA 5L4IA 2I9TB 3FB6B 3FGDA 5E95B 2OCCB 1JPEA 3ARFC 5J56B 3TURA 1P84K 1YEKH 4O58H 2XJLA 2R02A 5M95B 1S3RA 3GB7A 2GJ6A 4U1KA 4LG6A 5F1IA 4KI5D 2YPVH 3PDDA 3T4AC 4HIHA 1TEGA 3ZYMA 1HINH 4M7CA 3MV01 4D9WA 1IGMH 5ENQD 5F7BA 4Z7NE 1YEIL 4LDOB 5IVXA 5ABDE 5CZXD 3VA6A 4M4RB 5C08A 4KI1A 2PNNA 3S3PA 1DE4A 4MFHA 2PW2A 1AMXA 3B3BA 3PP3H 4XNBA 3ULVH 2R56L 5D1XD 1H6UA 5IVXE 1MJJB 1IFRA 1IC1A 4PTUA 4CYMD 1WHPA 4C4UA 5EC2A 1K4DA 3WS6A 4P3CH 1JHKH 4MNQD 2JXMB 5IQ9B 5F88A 3NA9H 4OIFA 1N4PA 2EIDA 1OWOA 3UM1A 3S48A 2VE6B 1HL8A 4WJ5B 1IBBA 5KNHD 1K2DB 3F84A 1FZMB 3X11A 3D48R 3T09A 1FZJA 2CO4A 4YDKH 4ZMWA 2A9NH 4NQCA 3MUY1 4JZJB 3A6OA 1IQWH 1EUUA 2AEPL 3DURA 3S97C 1RIUH 1NBQA 4JPQA 3BVVA 4AUJA 4U0SA 4I5BB 4S2SA 1CD9B 2ROYA 5HDBE 6TMNE 3OTNA 1FYTA 3HB3C 4NQCE 4FABH 2WXMA 1CI3M 3RX8A 2X05A 1KJMB 4IRSD 4NO0A 2HLEB 4ZS6C 1LP9E 1NI1A 1MG2C 3E9UA 2YGQA 4YL9A 3R4DA 2G60H 1CFBA 4Q6IA 3O3DA 1IHGA 4X80H 3OKNA 2JLPA 2X7LB 1PAQA 3AM8A 4HS3B 3VG9C 1KG0B 5G5DA 4PG9B 1PTZA 3MBED 4DGIL 4EN3D 2OYMA 2ZPKH 3UTQB 3D7PA 5FECA 4HW6A 1VZGA 1FO0B 2GUOA 3BLKA 3A6CL 1O7VA 4P07A 5F0PB 3KH3A 3Q7AA 1UYWH 5KSBE 4HORA 2XYCA 4OLUH 3R7QA 1FORH 3SJVB 3U7YH 4PSPA 1M53A 3C08H 4UQ9A 5T5FH 2DCPA 5E6IA 1TTFA 4G9DA 3K6OA 2DYSE 1RERA 2NY0C 5L2JB 4UMSA 3LY9A 1TQBC 1SHWA 1LO3L 5GSRA 3B3IA 4CC0A 4FFYH 3WGVB 1LQSR 3F7YB 4P59L 1PLGH 2QL1A 2C4FU 4W81A 5D96B 2D7PA 3T1FB 2H6FA 1K1BA 4FTVD 4LSQL 4NZUL 2HRGA 4MNGA 1J10A 3FN0L 1GR7A 2G0LA 2DQJH 1OM9A 4LSUH 3QNZB 3P9LA 3NIDF 5AWNL 1NA8A 2Z4QA 1GYVA 2EYTB 3P3SA 4QHNB 2K70A 1AD9B 3DSTA 5FQ6A 3HJEA 1P4IH 5GGVY 3FO1A 3S37X 2VDRL 4MNGE 1JUFA 3LEVL 2EXYC 3NCXA 1WAAE 2VLRA 4QCIA 3FLFA 1LNUA 3FBKA 5AQ0A 5F97E 5F6IB 1DQQA 3SCMC 1L7IH 3LQZA 2FBJH 4UT6A 3M1BB 3X1GA 4QD2E 3K8KA 3WD5L 1CIUA 2R7EA 3Q13A 4Z7VE 5H94A 4MAUH 4P46A 3SIKA 1IT9H 1JRHH 3C6LC 4PV1C 3V6ZB 3HC2A 5GXBB 3SPCA 3DVNA 1DCQA 3HG3A 2WTOA 4OAWB 1DBAH 4KMOA 4F91B 5TDPA 3LZOA 3KYAA 2YPVA 5GRJH 2R5SA 4Y1AD 4AMKL 1C8QA 4FDWA 4XMWA 1X7QA 2P4AB 2V5YA 2G75B 3CFDB 4H8UA 3A06A 1UW4B 3UKUG 4A2DA 2I26N 4WU7A 3U2JA 1WSST 4XCYA 3KWWB 1AQDA 2UY6A 4N2OA 4YC2B 3CKBA 4BT8A 3TJHD 1J5OH 3JZYA 2X6HA 2EICA 4K23H 4KO5A 1A7QH 1ZBPA 4PJ5A 2OV8A 3N6YA 3VFRB 1UD8A 4J3OG 4XXDB 1XGRA 3HZYB 2CFZA 5DVLA 1MZYA 3OLDA 5K9QI 1NC4B 3SQBB 3V6OA 2XZAL 2F61A 5MENA 4ZI8A 3TWYA 1YN7A 5LVEA 3V4PA 4IBQA 4DPCX 5AENA 3OJVC 5DMKA 4CC1A 5I0VA 4C9BB 1I4FB 4HIJB 4MDIA 3GSUA 5D5MA 4LNBA 1XV8A 5AVUB 2KDGA 4LCIH 4Z3FA 1ZSDA 2ZP8A 2AK1H 4FQJL 3TVMC 1N0LB 4PR5A 3ZI0A 2PXYB 1KCUL 4MVBD 5C0AD 1S7UA 1N5YH 2A73A 5LP0A 4JQXC 3T8DA 2H0EA 2UY7A 4AX3A 2HJLB 1P5UC 3QJVB 1EEYB 2WXFA 3PEUB 1Z5LB 3MA7A 1UXLA 4WCYH 5J11B 1H8SA 3VVMA 1G43A 3QDGB 3QIBD 4BWWA 2G3ZA 4E9XA 4UNVA 3NACH 2X40A 2GUYA 2W60B 4PH4B 1BVNT 1UH3A 4J1UB 5DLMH 4UM8B 4OBSA 2X4UA 4Y5XB 2BZDA 2GK0A 2J4BA 1TN6A 3L08A 3HBQA 1ZHLA 1QBMH 2BP3A 5GZND 4J7WA 1YEJL 4PU2A 1GSMA 2WXLA 2HYZA 2QPDB 4GZCA 3JWOH 5T5FA 3SPVB 1N3NB 1NANI 1ZHNA 3PZ2A 1U92B 3QJHA 3TNNB 3O6KH 5ID1B 4FQPA 5KBAA 1AGBB 4YN3A 1F8TH 2DV6A 1KTLB 1HXYB 4NC2B 3PHOA 3U4TA 4DRXE 3DARA 4FFYA 3P4OA 2GVYA 1KT0A 4KTEL 3FY4A 3CSYA 4JDZB 3ZKQD 4TNVK 2OR9L 5C0GB 3P7TE 2G3XA 1MI5D 1VFUA 2MAOA 4AGPA 3PQYD 1YNTA 3SZ7A 1B4LA 4BJLA 5K9OB 1T03L 4UINL 1PE5A 5E5UB 4ZUSA 1JYXA 2W0KA 3V30A 1G6RL 4LLVA 3GLAA 4EE2A 3FNKA 3WYRA 3FTZA 1S7WB 4N0RA 3V0WL 2BFVH 3TCXA 4DLQA 2X6MA 4NUJB 3UAAA 1WUZA 5IMMB 2ZUQB 5JORA 2BVEA 1G9MH 3ULVF 5LCWJ 2F7OA 4J4PA 1H6KA 2QVFB 2WQUA 4LCVA 3D4YA 4NUPA 5CKAA 1NEPA 5D1QE 2AJUH 5EZOH 1MWAH 4NO3A 4BSZB 1E2VA 3HEIB 2AAVA 1INDL 1RHFA 4G6FD 4M3KB 3APCA 3D85A 2ENYA 4HAKA 4JW3A 4K7FA 4AYEC 2IWFA 3KL3A 4Q0XH 4CGVA 3MI6A 5E1IA 4U0RC 3FU7A 1IGIL 5D5MF 5HDWA 4QJ5B 1TJCA 4OUOA 5I75B 2E56A 3ASOB 4YXKL 1LD7A 2VJXA 2XPIA 1TENA 2VYIA 4GKZB 4JFVA 5CCLA 3HRPA 4PJXB 1G7PA 1LK2B 2GG1A 1U8KA 3Q3GA 1AE6H 2H6GA 1QSEB 2E7DA 1CFTB 4TUJB 3MN8A 4GRLC 3REWB 1U8IB 3OZ9L 1J8RA 3FOLB 3K72A 1YECL 1U8JA 1R5IB 5L7XL 1S9YA 5CFHA 2P2CP 1OAKL 3PNLB 4AJ0A 4CSTA 1DSFL 4PRIA 4FG6C 1BD2B 2IDQA 3IGFA 1NDMA 4QRQA 1KGCD 2FJSA 3ZKMC 1ZEAH 3IV0A 1GGCH 2WN2A 5ERWB 1OSZA 1TEYA 1TTRA 4YHKH 4KQ0A 1MY7A 1TKWA 3D6GA 1FJQA 3T2NL 2AMGA 3SO3B 1CWVA 1EXUB 3QULB 2Y2TA 3CFQA 4ZD3H 1V54E 4Z7UE 4TN9A 2R9HD 3FQYA 1SMOA 3BZ4B 5EYLA 2BERA 5ID0A 3OZKA 1OE3A 1JPGB 2MPAL 2WC7A 4L5FE 3MV8B 4YR6B 4XRCB 2NYKA 1T0OA 4GIOA 4IRJB 3QW9A 3V31A 4YPGB 3WXVL 3KS2A 4WUUD 4U8YD 3ILPB 1W8NA 4LPYA 3KNBA 4WW1A 1E8WA 3JWDH 2X6JA 2R0WL 4K8RH 2A6KA 5B1BE 1N8ZB 2CUHA 3K0WA 4PWKA 5F72S 5AKSA 3FV4A 1YNTF 5DZNA 1BAWA 1Q0XH 1JYNA 3MGTB 2ZX5A 4HXAL 2ETBA 3IEGA 2VR7A 1DVFC 4KK8D 3UIOC 4H7XA 3QQDB 3IJYB 5I26A 1Z5HA 1AQ8A 2WLHA 2FQDA 4F53A 3UZEC 4RA3A 2QPUA 5ISZA 5I8KL 4NRXB 1A8ZA 4F92B 5JOFB 1MDTA 5ANHA 5C0CD 2BP0B 4XGZA 1Q0QA 1EXGA 3ZRSA 1Q0YL 5EBLA 1PZBA 1J11A 4OFDA 4TSCH 3SDDC 4NWTL 2F53D 1JWUB 2DBLL 3KXFA 2YA2A 5E2UL 1QO3B 3F12A 1HCZA 3BG0B 1A3ZA 1OCOE 1VEPA 3W11D 3C60C 1PY4A 4JM0A 1EV2E 5FF6A 2XGOA 1MHHB 4DX1A 5KZCB 2IPKA 3QJZA 1WC7B 4OQTL 1A21A 2QC9A 1XGUB 4GMJA 2GFBA 4FL4B 4PWEA 4R7DB 2VDOL 3BU8A 2M8XA 5LGHL 1J48A 1KTRL 4M5SA 4R6UA 1XGZA 3RJOA 2J6EL 2VXVL 5E2TL 1JK9B 3SKMA 5FDWA 1BVOA 5EOQH 3EJNA 2WKOA 3KJ6H 2P5WA 4NRZB 5SWSD 3ANLA 3MGOA 3TZVC 2YWZA 4P0DA 1NCIA 3MPCA 4K3DH 5L2KD 1MRCH 3QZBA 5GGRB 1RJZB 1BAFH 1MWAA 3EYUL 4IOSD 4N24A 5E1AB 1BLNA 5I74B 5E6RB 1UVQA 2ZAIA 1CTMA 1JXDA 3QO1A 4HH8A 5CEZH 4UTBH 5L0QC 4Z8FL 3EOTL 2CM5A 3O4ZA 4RMQA 4AH2A 4P2QB 3BKYL 4ZUUA 4I2XA 2J8HA 1RCYA 2YQGA 4FXLA 1VENA 4WV1A 4P2OD 4X6BB 4Y9BA 4RFNB 2VXTL 4L37A 3ERXA 1P6AB 4KV5E 1XH2A 3BPLB 1WFNA 4OCRH 4GAJH 2N01B 3KYKH 1N4QA 2HFFA 3F8UB 4G6JL 3TP4A 4DQOH 1KTJA 3ZXSA 2OZNA 3CHOA 4HJJL 4Z0BL 5I6MA 3WXWH 4GXVL 2FO1A 5HNFA 5ITFA 5EN2A 3V0IA 1K1AA 4U4IA 4L29B 3EYQD 2Q0ZX 4N0YL 4Y4FC 3FQRB 2FO1E 4WI6A 4UANA 5JS3E 4XN4A 4UQ3A 1IGYA 2KPNA 4M1CD 1XR8B 3UIPC 5EU3A 4ODVL 5LQBL 3MLWH 5KUMA 1B6UA 1GIGH 2N4IA 1ETA1 1MCBA 1VLXA 3WJLC 5L6YH 3L22A 1P7KA 1KB9K 4ZUVA 1IX2A 4DP0X 4NP4H 4NC0B 1ZE3H 3SZKC 2ITCB 2PPFA 3EJYD 3VE0A 4ZFGL 4WI3A 3EJUA 3HG1D 1YPZB 3AJIA 1T1SA 4K5BA 2OMXB 4UWLA 1KIRA 1MFBH 1SXSA 5JXAH 5E03A 4HOQA 2XZZA 3V4UL 4Y67A 3LQMA 1HILA 3DWLG 4K71B 4P23B 3HC3H 4D3CL 3X14A 1SQ2N 4MAYA 4KJQD 4K0OA 2VGYA 4ECNA 4UOZA 2R2HA 1I85C 4KRPC 5IHBA 3RAJL 3EXJA 1YEEH 2WANA 4QF1B 1MCOH 1NC2D 1U8PA 2VXSH 5ENTD 3KYOA 4KI5E 3L9YA 3VACA 2XWXA 2WKOF 5I5JA 1FE8L 3MACH 4MZ2A 5C7XL 1ORQB 3NZ8A 4AP2A 4KJYA 4XAWL 1ZV5A 1P53A 4OF7A 1HC1A 2B0SL 4XN2A 1CLVA 3AWGA 1FRGH 3SYPA 4P5TD 1T0NA 5A3YA 1YQVH 1S9VB 3D3VB 1MIEH 1PKQB 1LEIA 5D1XE 1MCEA 3GXUB 1ZS2A 2NDFA 2NQDA 3BSGA 3S35L 2BWQA 2H32B 5D2NA 2AV7B 1VFBA 2I24N 5AW7B 4PP2B 5JMOC 4YBQC 4BWTA 2WXIA 3PHQB 3LVRE 5FOBA 4HKBB 2R0LL 2JJSA 3DIDA 3TNMA 3SGDH 2OJZL 4PJHB 1ZVHA 4LFHD 3RUGB 3L7EA 4JB8P 4L1TA 1HU8A 1OARL 3SOBH 2YPKA 4ZO9A 3CG8A 1MCDA 4LCWA 2F2HA 4FNQA 5ESQA 4XN7A 5DU7A 3AG2E 3ARZA 2VUOA 3QISA 3WFDH 1WFOA 2EIZA 3BO8A 3MLZL 4OM0H 3GPEA 3UH8A 1TQWA 2RQEA 4UTBA 3LQAC 3O0RH 4G6MH 1EPFA 3LS7A 5EO9A 4D0CB 5C0IA 5I0XA 3QQ9C 2WO2B 5GGTH 4AJYV 4QXVA 3IU4H 3TBWB 2VC2H 4NKDA 4BH7A 5CEAA 4M5ZL 3WMQA 1NLBL 3CFMA 5DJDB 4UCFA 3CFJA 3SPHA 3PNTB 1KFAL 1U3JA 1TTUA 1WP6A 4OW3A 1XZ0A 2Y07L 3FSVA 3RZCC 4EI6A 5B3SE 3HMWL 3CX2A 2XN9E 4ZUWA 1AZZC 3MZGB 3T5XA 2AEQH 5B38A 4IIQC 1PEWA 3TG5A 1G1KA 3RWCB 3NCFB 3UKRG 1QBLH 1TJXA 5MEQB 1CGWA 2L4OA 3RAUA 1U8HA 4DUIA 3VRJA 1J0JA 2IALB 1XF4A 1CQYA 2V5SA 2VDQH 4RGMB 3RWGA 5BQDA 4BZ2L 3QA3B 3ARUA 4XCFH 5E56A 4WUYA 4J12A 1WAO1 2Q7FA 4QKXB 4OF0A 4M3OA 3DX9A 3ZTNL 1IAIH 2ODIA 3WU1A 3IDNB 3BEWA 3X12A 3CXDL 3OXFA 3HR6A 3CZLA 3O8XB 5HHVH 1ETZB 1OT2A 3C5JA 3CFCL 2WUCH 4FLHA 5EZLB 5SX4I 2AXVA 1TDQA 3EO9L 4BQ8A 4YIQA 3V4PL 3DBXA 1GOFA 4U3HA 4U6VL 2XWEA 2EIME 2G5BA 5A2JH 3S2AA 1YY9C 2M26A 5JIHA 3SN6N 3H3BC 5IFHH 1UJJA 4UNIA 1IU1A 4NQVB 4A1RA 3K4DA 4K7PY 3JSZA 1J1XH 3PABA 4FNUA 4G9FB 3X1BA 3AMLA 1KYAA 3K80A 3UC2A 1JNNL 1LE9A 4PJBB 3RWIB 3UJIL 5LN8A 5A2FA 2I07A 1CR9L 3L3GB 5C07B 4JO1L 1XF5A 3TT1H 5B8CC 2R51A 4QY8B 3RNQA 4ICXA 1JK8B 4GAYA 4JFSA 4WTZG 3W9GA 4LLQA 4QRRE 2J4WH 1NC4D 4Y1AE 2XG5B 3C5ZB 4LRIC 3BWUC 3GUTB 1ZANL 3HRZB 3X1FA 4WWKA 4GIAA 4LF3A 1TLPE 3DRQB 4JFYA 3VRIA 4N2IA 2WXOA 2ADJA 2ZKXA 5HGDA 3JV0A 1JZIA 2YA0A 3S4SA 2F5BH 3PJLA 1T6WA 2ZCKL 3CBJB 3Q9PA 3F5WB 4FI8A 1EX0A 4WI0A 1JNLH 4YHPB 1TZGL 4CADA 2PXYD 4FQHA 4XOEA 1JHLL 4PV8A 4Z5RA 5ACZA 4U1JA 4HNAD 2E4FA 4FQ2H 3H9YA 1D3CA 3JVGA 4MRCA 5CBEA 5CERB 1ONQA 2FYVA 1VHPA 2OXHA 2Q7AA 4YO0A 4K9EL 1M1SA 4KFMA 3NQPA 3BP4A 2BNRA 3IE4A 2DQFB 1H8NA 4G8FA 4U6XA 5FCUH 2IVFC 5IJKA 3BVNB 4BKSC 3GIZH 3LRSB 3OKYA 5SWQB 3ZT6A 1P7QB 2XUWA 2W92A 1IEBB 1IIKA 3QH5A 1HXKA 2R69H 3EYSH 2JQMA 1U8MB 2NC9A 4HKJA 1U58A 4HUCA 1IBGH 2BVQA 5GGTA 1U2HA 3CDZA 3KJ4B 5EN5D 4IU2A 5EA0L 1ACCA 2ZP9A 3SDAA 4U1HA 2JVUA 1OB0A 2C1PA 4FC3E 1MAMH 2R4SL 3FRPA 1MUJB 4JFZL 3RIFK 3SKOA 1B4RA 1T1YA 2VDKB 5SWZA 2F9BT 1T5WB 1RAMA 1B0RA 3O4OB 4XWGL 1NFIB 3FN9A 1E30A 2DQCL 4B9IA 2WZAA 2B59B 35C8H 4KXZH 1E0OB 1IC7L 1N59B 1A0QH 4APOA 1HIMH 2MHAA 5ICZB 4M5TA 2WMPA 4E5XG 4FCHA 2HFTA 2WIMA 3CXHK 5AUMB 4S1DC 4WO4C 4MXVE 5DF0A 2J09A 4IMKC 1XBRA 5EH1A 1A6AB 4I9WD 4JDVB 1GPOH 1SEBA 4W1TA 3M6DA 2K3HA 5F7YC 2CIKB 5KVFH 1MI5E 2YRZA 3LRLA 1RSFA 4HDIB 3T8CA 3SGHA 3SYQA 4FRWA 5KBMA 2IG2H 2OMTA 4OVVA 2V9TA 4W9DC 1CL7L 3U4BH 3BRGC 1X6NA 3IFPB 4TLTA 5IW6B 4JY6B 7PCYA 4R3SB 1QWNA 4XVTH 5I15L 4DP9X 4HJ0D 4FERA 1J9CT 4LZKA 1AXTH 4MASA 1UWEH 3U9PL 5ILTH 3HA0A 1Q9OA 2HMID 2R2BB 3LEXA 1G7HB 1EUTA 1FC1A 5DEGB 5FKPA 3BVUA 2AP2A 5I17B 3MUGB 1E6OL 2ZX8A 3B2MA 2EYSB 1F3DJ 3WFBL 2R4RH 3U1PA 8FABA 4IYPA 4R26L 4JPVL 3KEZA 3NBNB 4PBDA 4MJ5A 2KMWA 4HFWB 3LN5A 4N90D 4N66E 2A6IB 3BZEB 5T8IA 12E8H 2ZOUA 4B53A 1NKRA 1P1ZA 4OUUA 4ZQKB 1AYOA 3CFIC 3LZFL 3D4ZA 2P8LA 4XI0A 1VADB 5EOCJ 5BCAA 3KSLA 3QXUA 3VUAA 4GTTA 1JVOA 3BFWA 3HW7A 2OR8A 5C09B 3PFUA 3OB0H 4IDLA 1XL6A 5HDRA 1B3JA 1L7TH 4FZEH 1JL8A 1K3ZD 2D7TL 1HDMA 4K5PA 4ZAKD 5FLVA 2FH8A 3IU3A 3MV8D 2GEQA 3INOA 5AW4B 2NY4D 4IRJD 5JPNA 2R8SL 1CZ8H 1PC2A 4TXQA 4NSKB 2OCJA 2YXFA 3QDAA 2NY1C 4HBCH 1HN1A 3G6AB 1WD8A 2Z92B 5DTFA 4M7ZC 4JHBA 1YEHH 1P4UA 3MRQB 1IRAY 2J44A 3GMMB 3ZDYF 1HSAA 2IU1A 2R83A 4I0PB 4XBEL 5FQ7A 4G5ZL 3AY4A 3HFML 5B1AE 1RJYA 4MXQC 1MN4A 4QKTA 2GCYA 4DKEH 4DSYA 2F74B 2V7NB 2GJ6D 5KSAC 2AW2A 2R69A 3CHRA 1KYDA 5T33H 3RY5A 3VB9A 3ZYOA 1QFUL 4HFUL 2EUZA 4FULA 1SHXA 1IM9B 1KTDB 4Z76A 2YSSA 4PSRA 2I25N 4PS3A 2AGJL 2ERJB 4GPVA 1JNHB 4JQVC 3LKNA 4WUUE 5DDHA 3T0DA 4X6CE 5J1AA 2DH3A 1MFAH 3D9NA 3CFBA 4GO6B 2XA8H 4U33A 5C08D 1CU4L 4IBWA 2BSTB 2RKKA 3RVVD 1D5XA 4JVPA 3AG1E 1C08B 4WGWB 1IBZA 5EIBE 4TPRL 5ADOH 1BA9A 2FQGA 1K8KG 1KYOK 2RD0A 4M8RA 4KVPA 4L3FA 3GMPA 4EAEA 1RUKL 3CK0H 1AZCA 1ZS8A 2A9DA 3SGEH 1FNFA 1J87A 3HG5A 3KCWA 3PE3A 5C0CE 3EHBB 3FOMA 4MD0B 5I73B 4IN3B 1KYUA 5F2FA 3GYZA 1SBSH 1YEDB 1DQIA 1JPST 2QQLH 5HPMA 2F53E 5IV2A 4PJGA 1MPAL 5CIPH 3VQMA 1PZ2A 1S7XB 3T0VA 2P45B 1I8MB 2V9UA 4NDMB 2C7UB 2VNCA 3VGHA 1MHQA 3B6SA 1YYMH 3KBFA 4DLOA 1KLUB 1N0XH 1FI8C 1SJMA 2EIBA 2W65B 5IM7A 4NO0D 2ZWSA 1X5HA 3EYFB 1ZKAA 1PMYA 1IC5L 5K33A 1PEZA 3KPPB 3ECUA 1DJXA 3ZT5A 4EDXA 5KVDE 3BPOC 2P9SG 1RFDL 1MQKL 5DD5H 1SJEB 1YG9A 1CFSA 4K3JH 2P9NG 2XQBL 3UMVA 3A67L 2GJPA 2VDML 3EIFA 5SWSE 4V2BA 1Q1PA 3MMEB 4LOUD 1XH0A 5EU5B 5DRWB 3QC5X 2JQZA 2AXZA 1H0AA 5E76A 3GXPA 5DRNA 2OXGA 4PRNB 5IP4A 4AM0B 4RAUA 1LD9A 1CICB 1HE7A 1O6TA 1R3IL 2UZIH 4Q6IC 4ZFFB 2O61A 3LSOB 3WBDA 3PLYA 4N3CA 4CCAA 3F6QA 4FQIL 3D39A 3MRKA 4OCWH 4NHCL 4XP4L 8TLNE 2OTWB 3W9EA 2V2TA 1J5IA 1Z5YD 2CMRH 3RB5A 2BH0A 5FUCC 3EJZD 3OHXA 1NMBH 1K6QL 2LNIA 2DMKA 4K0RA 3D87B 3G04A 3MLVL 2X28A 4BK4A 5JW3H 3EUVA 3N42F 5E6IC 4ZW8A 2AKRA 4XP9L 2WLLB 1D5ZB 2H8PB 2W9EH 1JWSA 3GKZA 4DVRL 4NN5C 5J6HB 3QEGL 3HR5B 4PH8A 4M61A 3RWDB 2RJIA 2XT1B 5KJNA 1V7NH 5TK4A 2H3XC 2J12B 2VQ2A 1W0VA 4BE6A 1U0QA 4OQ1A 5C0JA 7TLIA 1H19A 3N85L 4XAKD 4PVBA 2CXGA 3DX4A 3DX8A 4Q94A 1KZPA 4DI4A 2NNRA 2EXWD 1X5FA 3CVQA 4Z95L 1OF2B 2KC0A 3O11A 4XMKH 3UTTB 3VXSA 2OCCE 2YFOA 3QSKB 3T9WA 5BS0D 4YPJA 4X6DA 1C7TA 1W6LA 2GYSA 3DECA 3IPEA 5A3ID 2QR0A 4Z7OF 3VGEA 4PJGF 1AJ7H 4MYPA 5HHOB 1KLFA 4M43H 1TTAA 1MG3C 3RX7A 4DQAA 4RDBA 4AOFA 3HBZA 5GRWA 4P46C 5I19H 4XP5H 2OTPA 3W56A 2K9FB 2W9LA 1EAQA 3QXDA 4PJ5D 4CBPA 4LMQI 4ADJA 4LEXH 3ULVD 3BHBA 1ECYA 1MCWM 3D3VD 2LAHA 3LX9A 4L3CA 1J8HA 5KBKA 4IBVA 2DKMA 4H20H 4NQEB 4WJ5A 1NUDA 4FQLH 1Q0EA 1NGWA 3FH8A 2C26A 4XI9A 4UAHA 1AFVL 2H2PC 1DQML 4KRNA 4AZ8B 5DULA 3IDYB 1T2XA 2APSA 1X4XA 2X44D 3S37L 3OF6D 1ACYH 2A9CA 2BINA 4Z9KB 1TNNA 1MJ0A 2XCCA 1RD6A 4GW4B 2GQHA 5CIPA 3WY3A 1QHPA 4YHMH 4OV5B 2B2XH 3IAPA 3HLKA 3IGAB 1HYTA 4QXUL 4GP8B 2WQRA 3V6OC 4U1GB 4XPBL 5JW4R 5GGUA 2DYPA 2YD1A 3BJLA 3QDMA 1JGVH 2WXQA 1FV1B 5JSSE 4MBRA 3OAZK 3S9DB 1IMHC 3C75A 1QLFA 3EJSA 1W3BA 4YWGL 4EPZA 5FYLL 5LAPA 4J39A 1PIFA 4YDIL 4IRZL 1GYWA 3ARDB 4ACPA 5BW8C 2PCYA 3GKWL 2HM8A 3C8KB 5DLHA 3FT3A 3VGGA 1KC5H 3SE9L 4P5MA 4FXKB 2EVHA 5ENPD 2MYOA 4DZBA 1FGNL 4Q2ZB 1N5AB 4GTMA 3SJVE 3ULEG 2P47B 2VRKA 3QIUA 5C0EB 5CLYA 1RZ8B 5CZRA 4KKBC 5TE7L 3EOAB 3RX9A 3SBQA 3I6KB 2V17H 3V6FA 1N67A 4G3YH 5E08L 3NGBB 2IH1A 2MOWA 4W6WB 1NSNL 1QKZH 3LKSA 4X6DF 1MRFL 5JIMA 5DA4A 2RFXA 2OX5A 5L4JA 3ZR6A 2FJGA 4JO8A 4J3XA 2EIKB 2HH0H 1SXNA 2VDPB 3Q5TA 4PVLA 3JTSA 2LAGB 3NFPB 2C82A 1PZAA 3BP5B 1OGTA 4HETA 3IGLA 3C2SA 1KBGH 4J23A 4PY7B 2VDQB 4V1DA 2L6JA 2WI0A 5DO8A 1INEL 1IC4L 1A3QA 3GRBA 3ZSSA 3SGJC 1KEGH 1TO4A 1S3KH 4GW5B 2GABA 3D85D 3BKJL 3WUWG 1E4XL 4L2LA 2VOTA 3A6BL 3KPLB 5CD5D 1ZGLP 2GC7C 2GBVA 4XNDA 4HJSA 3BZDA 3UDWA 4RSYA 5D1QC 2JIXA 3MJ7B 5JXEC 1UG3A 1T1ZA 3D08A 2BTDA 1ILUA 3SHSA 1CXEA 1CLOH 2WTRB 4TQEH 1NIFA 3T87A 4J4PC 1QW8A 1TETH 2ZXDA 3HMXL 4Y16A 1PZUB 3MRPA 5T1LB 2ZKMX 1EBAA 3VQ1C 3JT0A 3E8UH 1CT8B 3VFRA 3P7UE 3LEYH 4FQCL 3MX0A 4HZLB 2OK0L 3FUNA 3W1ZA 3HNVH 2XFGB 1G7LA 4DX6D 4XT1C 1BQUA 2CJSA 2QADB 3H9SA 2YA1A 2YQ3A 4F37K 4EECA 1A3LL 1R33A 2R23B 5ABAA 4YVNA 3I3BA 3MXWH 2DQUH 4HLZH 3FSOA 3G9AB 4ENED 3RIAF 2WNWA 4ZOCA 3NQKA 1VGEL 3RI5F 2HTKC 1OAUL 3FAXA 5DQJA 3G5VB 3RGHA 5FDYA 3I2CL 3PWVA 4BKTC 3P40A 5DEFB 2XXGA 1OAYL 4KMLB 3GSNL 1A9EA 4JPWH 3VB8A 4RRPG 3LV3A 1VRSA 1Z5LA 3M17A 5IHUH 3WEBA 1GC1H 4QHKJ 3QE5A 1UZ6E 3FYEB 1A02N 3ULAB 1WT5C 3ALPA 3T6WA 1EMTL 4XODA 3QNFA 4WI5A 3GSVB 3V5HB 2XXFA 1A1OA 1PJ9A 1QFPA 4G2AA 2G5UA 4H0IA 5D7JA 1DLHA 4U63A 3QDGE 5D6CA 4K3HA 3REVA 3I3NA 4APFA 3MNWA 1SG7A 3K8MA 3HFFA 4Z7IA 4LLUA 3RWHB 3TLRA 4BUQA 2IDUA 2VO8A 1AIFB 3E6HB 3EFFA 2WBJB 5IWLA 5AVZB 3V2OA 2FJFA 4LNUD 4NFDA 5ISZD 5EIIG 3RGVA 4RAVB 1BJ8A 2PPAA 1RU9H 4A37A 2AITA 1YJDL 2CO2A 5AW3B 2E7LA 1DEDA 4Y2LA 5DJYB 5JYMA 2VXQH 2ESVA 2V2WA 3QUXA 3S96A 4YBHA 1ZTXH 2ODHA 3MO1A 5A2LH 4U1LB 5AB0A 5BZDA 5EN3A 3U7AA 3AFLA 1AQMA 5TLIA 4BSVB 4YVQC 4ANUA 4YDZA 1NIEA 3F7VB 4JL1A 5D7EA 2O93L 5DSCA 4GLRI 4XNQB 3JTTA 3PNWB 1EAOA 1FH5H 5DJXB 3FO2A 3LS5H 4M1GH 2W07A 2ZWKA 3U0WH 3TL5A 4HRMB 4BGLA 4MCZB 32C2A 4Y2DC 1GTNA 4M62H 1R75A 3D9JA 1JVSA 3WO3B 1B89A 2X6IA 1GTFA 2DRUA 3VXPA 1T1RA 2JKWA 4I9WE 2VUYA 5CHNA 4LLYA 3QUYC 5EO0A 1G5GA 3SDCA 2FT8A 5JIIA 4B6ZA 4YQXH 1IE5A 4B9JA 3UUXA 4BERA 1ASQA 1E5BA 2RGSA 5G04C 3K2IA 5HGHB 1A9VA 4DGWC 3MTRA 4RMVA 1UXSB 4C56B 1HU3A 3L82A 5C71A 3SZ6A 6TLIA 4DNLA 2BSBA 4UOJA 1KJVA 4DN4H 1D7CA 4J6IA 3B56A 2A9BA 3ASOE 1FCHA 4FC8A 2XHEA 2ICCA 3GD1C 3MOBL 1G9MC 3UIYA 2EH8H 2ARJQ 3QXAB 4PGEB 4EZMA 4PJXE 5IESL 1DEEA 1LE5A 1BG1A 2VMJA 3NOCD 1AP7A 3MYJA 2XWCA 2AXGA 3H42H 3UO1L 1QSEE 4NBZB 2MQ3A 4LGRB 5D4JA 2VZOA 4N0CC 2DIEA 5KYYA 1CI5A 3RY6A 2GI0A 1FNEA 2KHAA 1UM5H 1KPVA 1F4HA 4IBZA 4J2QA 1TQSA 5C09D 5ENNA 1KELL 5CILL 1CE1L 4DW2L 1FPPA 4AYFB 1BD2E 2IQ9H 1KGJA 3MNDA 1CYGA 4WV1C 2ALWA 4O02B 5GGQH 2N1KA 1H2UA 3TYFB 3VW3H 2Y4TA 5F89A 2GEEA 3FB0A 3EBAA 4X4YB 4F1ZA 1A17A 4JY4A 3VMOA 1R0AH 3PJSB 4X5XB 2HKHL 4KVNH 2HN7B 3TFBA 4D0BA 2LOEA 2J1ZA 4ZPVA 3NJHA 4U1MB 4PUBL 4YSUA 2EEAA 2IBZY 5HHXH 5JW4N 8PAZA 5K9KA 1NCWH 2LW3A 1WG3A 4ODTH 1X9RA 2F8IA 3KDMB 4UAOB 4WNDA 1NCUA 4J8FA 4F8TA 4J2XA 1IM3A 2IAMB 3EFOA 1F90H 4M8QB 4BA0A 3EYOA 4APQB 5KVDL 3X13A 4HJGB 3VTMA 5FUZL 2KDYA 4HCRL 3EFDH 3CVCA 2DWDB 3K6IA 3GWJA 4NRXA 3X3FH 4UWGA 1NCAL 5GRXG 4GAAA 2XZCL 4UI9C 4YH6A 1E3XA 5KW9H 5D9SB 5F9WB 3MSPA 1TEFA 5I76B 2YZ8A 2YD3A 1E28B 3JWNH 4N8UA 3QJOA 5EG6C 3ATAA 3DV4A 3KLAB 4GSRA 5HI4C 3JWDC 5KBNC 2FSEB 4K8RC 1EA9C 2VXQA 2DMCA 3EHBD 3VGAB 5GJSL 3HAEG 3ZE0F 5I8OL 4WGVB 1ZXKA 5H37G 2BSEA 4EBQL 5E00B 4YZFE 3O2DH 5D7LA 4MAYC 3T9KA 2CKNA 4PCKA 2ADFH 2V6HA 1TMNE 4GYYA 2WP3O 1T7WA 4EEEA 3NG5A 3CLWA 1Q94B 1NIDA 2EO7A 4ZSOA 4BK5A 2XN0A 1RZPA 1W9XA 4G8KA 4GTRA 1EEZB 4JG1H 4JGUA 3T0WA 2X6UA 1CE6A 1NAML 1NUFA 3I02B 3QPXL 4NQXA 1QD0A 4TM9A 4YK4C 2I1JA 1AHWA 3BQVA 1AI1H 4QPEA 4JRXB 4AEIL 4JK0D 3KVDD 1XQ4A 4C0EA 2LABA 3T77A 1L9QA 2MNUA 2WLIB 1ELWA 2B4CL 4NYLA 3EZJB 3L9RA 1I9RL 4GZ3A 5D2NC 4WDIB 2J71A 4P2QA 3HNSH 5DJCB 5CEZD 3IFLL 3OAUH 1W0YT 4ONHB 4HOXA 4ODUB 1KJ3L 1CICD 1E42A 3MDJA 1I8IB 3CN1A 4MJ4A 4QWWC 2XTJB 5JW5A 4P2QE 1U8CA 1V3MA 4TTDD 3RWJB 3RTQA 5MERB 1EJOH 4OI5E 2AI0L 1BFVL 3QUGA 2AW6A 3QO0A 4ZO8A 3WQQA 4I89A 2CJ3A 2H47C 1VFOA 1Q9WA 3LIZH 2WZ0A 1BBJB 2HJFB 3NQIA 4URTB 1OM3L 5I71B 2NX5A 3FTGA 2WWOA 3MBEC 2X38A 2MPVA 2W0FB 2JTYA 5IBLD 5L3UE 1O5MA 2D73A 3F04A 5IHZA 3AXHA 3FO0H 5T1KA 1H6PA 3QS2A 1C5BH 3U7WH 1BLXB 2FIKA 4HISA 5DVNA 3FPYA 2IANA 1JHTA 3OWRA 4MJIA 3BT2H 3PGCB 3BDBA 2VN6A 3ZTEA 3AS8A 4TVPH 3F00A 4OT1H 1DVPA 4PHXA 4BRVA 5G2NA 4CNIA 1KJOA 4DVBA 1UB5B 3D0LB 2NY2C 4PGBB 4N0FA 2XWRA 2ZZUT 1AAJA 1FFQA 3D69B 3J07A 3UTTD 1L9MA 3D25B 3MXVH 3TASA 5DPEE 3TPKA 5KYUB 2MSPA 3CFUA 5DS8A 3TH2T 4TSBL 1T4KA 1ZXQA 5DFVC 3MRLA 5HHOD 1YPZE 2F19H 4AVJA 4XAKE 5DRZA 3RVTD 4IEFA 4HWEL 3LXCA 4PFEA 4KQ3H 3SB3A 4I18B 1Q90A 1SA4A 4YUEL 2YGNA 3BVXA 2HE0A 1YZZA 3ZHEB 1I8UA 3AU1B 1WWAX 3V0VB 4S11A 2OEVA 3HW2A 5GGVH 2NY5L 5IROA 1ZLWH 4C83B 4QXTB 1FFTB 4C48B 2F1BA 4LKCB 4NQED 5DHVB 4KJPC 4AG4H 4DEPB 2CPUA 2CR6A 1XF3A 1A7BA 1FO0L 1MHPL 5IR1B 4WHYH 5CCMA 5BRPA 5MHSD 4WWKD 3SD5A 1RIHH 5HI3D 3ZZQA 2W8CA 1AIZA 2ORBH 1JGUH 1KEIA 3OJDA 1OP3K 4HEMA 4F1PA 3EXLA 1QACA 3INUH 3ESPA 3PWUB 2OL3B 3T8HA 2B15A 4LOEA 2AV7A 4X9HA 1IGTA 4HAGA 4PMFA 3P73B 4BBWA 4JFOB 2HPOA 1PY1A 1QG3A 1KBVA 4L8CA 4PW4A 3QIWA 4JR9L 5AAWC 5L88L 3HI5L 2WAQA 4AQAB 1WFJA 3P4MB 3I50H 2IPTH 1RVFL 1X5BA 1BZQK 1U6AL 4BSJA 1HS6A 2XLLA 4MMYB 2NY6C 2OAAA 4PJHE 3RUGE 2B16A 4ZNEA 5T1JA 1HQRA 3Q8FA 2CAKA 3L3OC 4MZRA 4UZUA 3HDXA 1FAKT 3BKCL 4HUMB 5ENWB 1CLYL 3CBRA 5JO5B 5G05J 1W8OA 5F3HB 3GRGA 2EE6A 5F7LB 4AKPA 4QHLA 4QRUA 1BJ1J 2DTSA 4PGZA 1JDCA 1HT6A 4KQ4H 1TZHA 2O5XL 5IJBC 2ZXQA 2X53A 4UQ2B 3W37A 5IMKA 1XCQB 5LWYL 2XVKA 3KHOA 4JO4H 1A47A 3NAAH 2PP7A 4OCYH 5DUJA 1T6BX 1KY7A 1ZB1A 5SWZD 3OMZA 3IRPX 4R97C 1PLBA 2R29H 3LIZA 1RPKA 4MB4A 3TBYA 3UYPA 1OPGL 1HTYA 4OF5A 3OMIB 3RWCA 4JFFA 4BZ1L 3OBAA 4U49A 2ARWA 2VDLB 1R3LB 4WW2A 4ZTPL 3CQPA 4HCFA 1S78D 2IALA 3VDBA 2IH9A 4QEGA 4XPAL 4RFOH 3SDAC 1EVTC 4HWBL 3O3AA 1D6EB 3O6FA 1D9KB 2Y5TB 3DSWA 4JFQA 4PCSA 5B1KA 3EDDA 4WNGA 4F8PA 2JB6B 2CO3A 1FVEB 1K72A 2DI7A 3M8OH 3QK0A 1T80A 5DD1L 1IAOA 4Y5VB 1G0DA 2YD2A 4Z18A 4W9IC 2FFLA 1KCRH 1OT1A 1BZEA 3EO0A 3FUFA 1F1AA 4KU1A 1SNRA 3QZWA 3FONA 3RU8L 4KHTH 4BFEA 1YDPB 2PN5A 4LIQE 5DMGD 4TUOB 3MRFA 2EYRA 4OGQC 4XNUL 1WRFA 1D2OA 5E75A 3GI9H 1FDLL 5HGBB 3UTSA 1OT8A 3S8GB 3K71B 4NO5B 1QEXA 1P69B 5T1LD 4G9FE 1FFOB 3IXAB 3VM7A 3QDJD 2BC4A 1GZHC 1XGTA 4ODSL 3Q06A 4PJBE 2P9PG 1I8KB 4JEUA 3UYRH 3UEZA 3CHSA 1AC6A 1XIWA 3AAZA 5C07E 3C5RA 2DEYX 2J1WA 3KS0H 4FG0A 2QADD 4AV4A 2JMRA 4M6OH 3VWJB 4P4KA 2FTAA 4PI0A 3U83A 4N5CA 2GJZA 2UYLA 1AP2B 3GEWB 3APDA 4DI3A 3COOA 3J27A 3KPNA 3L4CA 1N2RA 3T0EB 3FXIC 3RVUD 3LKQA 1P4BH 1A1MA 2DZOA 2FWLB 4S1SH 2CHDA 4LARL 1QSZA 1WZ1L 4NM4L 3AU5A 5KYXA 4PGCA 2XVBA 2C2LA 2CGYA 2PLTA 3VFUB 4AVXA 1TCRA 3G9VA 4I1AA 1NCOA 3FBOA 3QZMA 4PJ9B 2ZXWB 1RZJH 1PY9A 1JDAA 3ZRCC 1H3LA 5FO9B 3LRSA 3PAUA 1RURH 5CJQH 5TPWL 4N4EE 3UMNA 2EDEA 4AEHL 3H3PH 3IMBA 1RJLA 1IEAA 1HWWA 4XXWA 5A2AA 3UACA 1G7QB 4OFVA 2ZCLH 3GXMA 4OJFL 3NOGD 3CVWA 4WW2F 1V27A 3Q5YA 4R83A 4K7PX 1U8MA 3UG5A 2YD9A 1G1CA 2V33A 5FV2A 5FA3B 4HJEA 1UB6B 1RZGB 3NRQA 2WBJD 3HI1B 1UM6L 1SLWA 2WB7A 2GW5A 4LASH 2IDSA 4XP1H 4F7PB 2RCSL 4F7EB 3L9EA 4HJTA 4TLKA 5T4YA 1MUJA 3D30A 1BSIA 2UZYB 3BYTA 3F2PA 3FSZA 3WIHH 1DBJL 3HE7B 4JDEA 3CDCA 4LBEB 3Q6FB 5JDSA 3ESUF 3UBXG 1NBVH 4I9XA 1UJ3C 2AVGA 3LKPA 3AY4C 4F33A 1YEGH 3QQ4B 2R29A 1D6VL 3M45A 4JMNA 2B20A 2XGSA 3DYPA 2YPLA 4M5YL 5DK0B 5EPMA 3V5KA 4F24A 1NFIE 4GZ5A 2FHBA 3QI9B 5GRYA 5I2IB 2WGXA 4U31A 4Q6KA 2MCAA 4A2HA 1WBXA 4YDYA 4YJZL 4RX4D 2X89A 4L4TA 4JDVA 1Y0LB 5EWIH 1J05B 1FGVL 4JKPL 1DLFH 1OB1B 3K3QA 1II4E 2IQAA 5INCB 3SQOH 2DBAA 3RKVA 3GSWB 1SZ9A 5C0NC 3E9TA 2YC1B 2QSTA 3HE6B 1NFKA 4Q9RL 2A74C 1K85A 2V7HB 2KZTB 2XRAL 1O1TA 4B7IA 2C7FA 3F2LA 2APWA 3W39A 4ERSH 4LNRB 2AEOA 3G3LA 1FCCA 2XOTA 3LNHA 3MTXA 2C9SA 4KY1L 4YHOL 3VU1A 3SE8H 1EDQA 2YAOA 2GTZA 4BV1A 1CLCA 4D9LH 3KAEA 2QDVA 3DOHA 4XNXH 5E9DB 1Q72L 3K2UH 1JF6A 3CXBA 3QGVA 2NTFB 4YDLC 1EXHA 3ZKND 5DD0L 3T2PA 1V55B 2J5LB 3M07A 3BOVA 4XCEA 1ZT7B 2KLTA 4ZMXA 3CDYA 2F7RA 1U3HB 4AGMA 3OC5A 4PJFF 5DT1L 1G6VK 4F8LA 3MHZA 1BBDH 3T4YB 3RE0A 3TF7C 1M2OA 5KAQG 3ESKA 1HK6A 5SX5K 2EDWA 1CF8H 2HFGL 3R06B 1J1OL 1OK8A 3GHBL 3NQYB 3LJNA 1YSOA 4PJ8A 2YIHA 2FWUA 3L4XA 3M7OA 4ZFQA 1BMZA 2NYYC 4L4VB 4XPHH 4N5PE 1U3DA 3Q49B 2HKFL 4JGJA 2TMNE 1E7VA 1YCSB 4JHKA 1JPSH 4AIOA 4A2LA 3B37A 3B95A 3U66A 5FWQA 1UOHA 4IOIB 2DB8A 4Y8DC 2ZYSA 5CAYB 2FATH 2WYZA 3WKNA 2A6DA 3BAIA 1T5KA 1ZIAA 4PRBB 3FSAA 4OD3L 4UIMB 4E9TA 1I1FA 3QDNA 2PR4L 4EI5C 5C09E 2Y7NA 3ELQA 2A0LD 3G5XB 1O9WA 5AFAA 3K0YA 2BFGA 1OEZW 2LT9A 4B93B 3GHEL 4RG6A 2J8UA 4LPCA 1AC0A 3DA0A 2CUMA 2H6PA 4MJ2A 2WKGA 4ONOA 2WZFA 1X5JA 1NGYB 5C0FB 1YYLL 3OGCA 4B41A 2VWEE 3CVVA 2J8UE 1BZ8A 2CFUA 4GYBA 3IKOB 3RNKB 4AL8H 3W2DH 1A7OL 2K3TA 2B4CC 3CFEA 1GKEA 2YAMA 2PUSA 2WCSA 3DXAB 4Y2OA 4ZOBA 5EZPA 3VXSD 1I3GL 4BFFA 5AB1A 1HG2A 5LGYA 3WIIL 3MA5A 3QC6X 3L3HA 5IJVB 1EHNA 4RGNE 4XX1E 3ZK0A 3VD7A 4UM9B 1U36A 2FWOB 4K5AB 1H9DA 1IILE 3SNXA 4PIRF 2C9PA 2E59A 3WIHA 4ZO6A 3VFOB 4ANKA 3WO4B 1PZSA 1A4JB 4K3EH 1FNSL 1MJUL 4MMXB 3IETA 5ETUA 4E9RA 1LLAA 2YAEA 5FM5O 5BZWA 2J8SD 1WEJL 1I1AA 1P5VA 1SDDA 5IREA 2C4XA 2DWZA 2A2QT 1GXEA 5JPMB 1OAZL 1KCVH 1ZLVK 4MD0A 3OG4B 5DD6B 1R24B 4GP4B 5K59E 1ITCA 2QYJA 1ZHBA 4P9HH 2F1EA 2JD1A 3S7DA 2VQ1A 4M65A 4ZW7A 3DMMB 2C7UA 3NJKA 4U3SB 3D18A 4NKMB 2EDHA 1QUNA 1S5IL 4X9YA 3VXNB 1D5BA 4LMQE 4JRXD 4CT4A 3DJSA 1DJSA 1SXBA 2AFNA 1TR7A 5ANRA 3TYGL 2DYPD 3QDMD 2GC4C 2EO1A 3VFSA 3ARBB 4IIZA 2OMUB 1NIAA 1L9PA 1N6UA 3MNZB 2XYBA 3DHJA 1LMIA 2DEXX 3OZLA 3MMEA 2XTJD 2WPGA 3V4VB 2F7PA 4FNLL 2PYFA 1JGIA 3BGMB 5J6GA 1U2VG 4ZMLA 2O5YH 4OCNC 5ICYB 1DN0A 3TBBA 4E0RB 3ULYA 2EUXA 3U79A 1L0PA 3DO4A 2G2RA 1P84J 3QEHA 3VXOA 4AVIA 1PQZA 4F5CA 3Q73A 3PL6A 4Q9QL 3N44B 1JWMA 5L9DH 3QIUD 3WOVA 3HS0A 3JBG7 3AJ7A 4AYMC 4BQBA 2W5PA 4GBXA 4OZFH 3AREA 2R0ZH 5D70H 5F6HI 1BX2A 1HI6A 1XAUA 1X5GA 3KW8A 2JJTC 4KVCL 4LVOB 2XRZA 5GSVA 2YEVB 4EBAG 1LWRA 1LWJA 4HIXL 3R1GL 3ISYA 5F1KC 5E0FA 3CEQA 5E2WL 3ARGA 3T08A 3I6SA 1T5XA 4WZ9A 2DZNA 4PTTA 3MRJA 1JCRA 5D96C 3U30B 1JV5B 4LCYB 3MLUL 5FO8A 5KANG 3RC3A 1QSFB 3HZKB 2V4LA 4NENB 3HXEA 3KCPB 1ML0A 2DM7A 2XCMC 3CVDA 3G5YB 3KWVA 3OMNB 3PGDA 4IKNA 1BM3L 4S1RH 2RALA 3TEUA 3WUZA 4A7TA 4YSSA 4KROD 4AW7A 5H2BB 1ASPA 1A6ZA 2DI9A 2YAQA 4WI8A 5D2MC 2ITDB 3WLBB 4FG2A 1RQ5A 2XSKA 3FO9B 4PIBA 3V5DA 5F6IC 3Q0HA 4ZQHA 4TUUA 3HZ3A 3EGXB 2Z31A 3BAJA 3PWJA 5HHMB 3UTTE 1MNNA 3JT2A 1IV8A 4Y4HA 2SEBB 3QORA 1A7NH 2CLRB 5DZAA 1UM4H 4NNYB 5AQAA 3P77B 3Q2WA 4Y16D 4HH9A 3BE1L 2XFXA 3QG6B 5KYWB 5I8EA 3NPZB 3CZFB 3S88L 3RHWF 1UATA 1A9BA 4PP1C 4GG6A 1UACL 4KKLC 3OL2A 5EILA 2ZOOA 1PLAA 2FB4H 3JUEA 3WN6A 1HHHA 4NQEE 1NMCC 1W72H 4N26A 3FU6A 3B34A 4XP6H 3LXBA 4K03A 5H7PA 1INQA 5E8OA 5C2BH 1L9SA 4K7PH 4B9PA 4PWFA 2MHKA 4GT0A 2WCPA 4GW4A 2I6HA 4JNDA 1MQ8A 5AW6B 3L7FA 2KATA 3VWKB 1VDGA 4KK6D 1THCA 3BQUA 4ZFZB 3CU7A 4WJG3 5IOPB 2PETA 4MD5A 3FUKA 4BEIA 1TQTA 1PE7A 1F5WA 4NNXB 5D7IB 2D9QB 3ZUNC 4LCCA 3QNYB 3BH4A 1A65A 4UI2A 3UGXA 2FUTA 3U6RA 4BQ6A 4N20A 1NTDA 4MMZA 4JM2F 4YHIA 1H6OA 1LM8V 1X5YA 3PWLA 3G6JB 3DDFA 2GT9A 4R7NA 1NBZA 1OR7A 2CLVB 3LDBC 2APFA 1N7ML 4TMNE 5GRUH 1KZYA 3GSRB 4LIQL 4WFGD 1HHJA 3W9DB 4NN7C 4G26A 1J9RA 3P7PE 2FLBT 4TQ8A 5J11C 4N8VA 1F97A 1RZ8A 1A5FH 1EVUA 2P48B 1HSBB 2JLLA 3AC0A 4K73A 4LU5L 4N8CL 5D93C 5I30L 1N4XL 3ES6A 3FMGH 1BMGA 5J08A 4JN1L 2Q8AL 4WHCA 5D7JC 5T3ZE 5CMAB 4AIXA 1M7IB 2ESVD 3QUXD 4Y5XC 4AITA 5CSBA 4OZFA 1UTDA 4YXHL 4RISH 3QAZB 2WINA 3MJ8A 1HHIA 1UZ8B 3KM1A 5I16A 2O5ZH 4BX8A 1D9KD 1RKRA 4KMTL 4N9OB 5DJ6A 2X6BA 1EAPA 2AJVL 3NZSA 1H3GA 3O2WL 5IWLC 1JDDA 3HI6L 4NZRL 3TV8A 4X7SL 2A38A 3RGVC 1C16B 4O2FB 1GZPA 3NJFA 2Y4UA 4XBGB 1MX4A 2EIKE 1JP5A 2AJXH 2CKBB 1K4CA 4PB9H 3LPGA 3GBML 2Q3AA 3UZQB 1F2XK 1CQKA 3US0A 4UV7H 4DWHA 5JT9E 1DBML 5C3IA 3C72A 1GGBL 3QRGL 4LSSH 2NY7L 2XZDG 1NDGB 2RBLA 3GNMH 3Q1EA 5CEYA 5JNYB 2D2OA 3BKMH 4KDTA 1CS6A 1LILA 4JFHD 3S7JA 3OTTA 2ILRA 1LMKA 2HG0A 1HJCA 1S7TB 4O51A 4GG6F 3KLKA 4EQ3A 1SHMA 4PVNA 1VACB 2BS71 3K81A 2IO3C 3DX1A 4W9JC 4E42B 4HPOL 4DO6A 4OJYA 4GFTB 4ZX3A 15C8L 1IZKA 4HS8L 5B7MA 1NFDB 4FZ8H 5ESVB 3RB7A 4ELME 1UFGA 5DO2C 4J3OH 2Y7OA 5EBMB 4A7VA 5EEZA 4YX2L 1SYVA 5ITBH 3AXLA 2FZ3A 3MRIB 5E5MB 1ZMYA 4OZHB 3OSKA 4H1LG 3KVPA 3DRTB 3HZMB 3SDCC 1A7PH 5TE6H 3WHXA 3RJVA 3ZGQA 3PV6A 1B9KA 1RMFH 3BP7B 3EJQA 1KT1A 4LVHB 4UNTA 5FFLA 3T0ED 5HHQA 4ZTOH 4LHJB 1VCBC 2Q8BL 1UA3A 4XNYH 4B9ZA 4Z77B 4U7EB 3B5TA 3FCUB 2J1XA 1ZLUH 1WBYA 1BZ9B 1WBZB 5DLML 3L5IA 2JFCA 1I7UA 4CSSA 1W72A 2VYRE 4LE8A 2VDKL 2OJ1A 4PJ9D 5AN8A 1QBML 3V0DA 1L9TA 5HYJA 1JV2B 2QQNL 4DAGH 3DO2A 1U93A 1DC2A 3BEVA 2NY3C 3JWOL 4N2EA 2Y7QA 2CG2A 4N2MA 4BETA 3VFVA 2NR6C 4ZXBA 2DWTA 4GS7B 4ORGB 5H4ZA 3PV7A 1R19A 1DSYA 4D0DB 2LTQB 5KTEH 3LPFA 1AMYA 2H6HA 3RY6C 4NQDB 4NZTH 4JXTA 4XHJC 4OSUH 2E8ZA 5E4EC 4NAQA 4AEEA 4JFXA 1AQKL 1BVLB 3UADA 2F54B 3D0VB 3UJTH 2WQHA 1CBJA 3PP4H 1KIQA 2IWEA 1IM3D 1QFWM 3CVNA 1CFMA 4U1SA 2MOVA 4UT9L 5CGTA 2FYYB 2CNYA 3HE7D 3E6HA 3P4NB 3V10A 2Z8SA 3AMKA 2DLFL 3AWEA 2Z93A 1YEFH 3VFMB 3ZL4H 3H0TB 2LV4A 3SKJL 5JHLH 4H8HA 2YUVA 1QYGH 5JDJA 5CLWA 2XIIA 1IQUA 1A25A 4N1CA 2LUHA 3QNXB 2H9GB 2JABA 3II3A 2Q6WA 3GS7A 4YSRA 4S10A 3F7PC 2HTLD 3KPMB 5C3LD 4WNQA 2RMNA 3FC8A 1XSOA 1OHQA 1TEZA 2J1KA 3B13A 4JKNA 4TNFA 4C4KT 2CO1A 1WTGT 4GRMA 2J88L 2BSED 3F7VA 2WQ8A 1TVHA 5D7LD 2Z91B 3N0AA 5LBSL 4F7CB 2X2UA 3MLXH 4MZNE 3RASA 1G94A 1KTBA 2P5EA 3HE6D 3DVFA 2ADGA 1M1XB 4LLDB 4HQQL 3D9IA 4A2GA 1MFCH 4U07A 1MHCB 1GJWA 3DBSA 1KPRA 2WOBA 3L2NA 3M1CA 4IKKA 1VDYA 3CDFA 1TFPA 4PUCA 1HHKA 2BVTA 3LKUA 4TNLA 1DNPA 2V2XA 5T1DL 3BW9B 4P05A 3CFKA 3KAAA 3L5JA 4NQTA 4YNYB 4OIIL 4Z23A 1IQRA 3E33A 3OVUB 1ZEAL 2C9QA 3FU8A 4FL4C 4PRPA 3LKRA 1YAIA 4N3UA 2E3VA 4IGBB 1G7MB 2L7QA 1OCRE 3B2UD 4BK5C 4FU3A 2BVPB 2KLRA 1LVEA 2QHRL 3MU3A 3IVKA 4C56E 3SE4A 2NNAA 2NQ3A 5I6XB 3ROLA 4A3TA 2ZUXA 3CN3A 5BO0D 3U4EA 4AR8A 3WS3A 4XC3H 4YSPA 2G4EA 4J3UA 3VI3B 4L3EA 3JSSA 2WXHA 3MLSH 1NCTA 2WVTA 3CMOL 4DK5A 2A83B 2CIIA 2X1QA 5B7EA 1RZQA 3MV7A 3H6JA 5DUPH 2E74C 2MKLC 4MA8H 5ANMA 2BUGA 2HVJA 3FFOA 5HHOE 1NEZG 4BFKA 1JMXA 2XETA 4HXBH 1T2JA 1HEZB 4N2AA 1PCXA 4OJCA 3S5LG 3EU9A 4GEJA 3TC9A 5LBVA 5L8KB 3P0VL 1KB5B 2HZHA 1Q0XL 1B3IA 4HWZA 3U36B 3FQ1A 4XMLH 3NJXA 5T1KD 4PWHA 3MRHB 3ZDXF 4JM2B 3RTQC 1EDHA 2IFUA 3N41B 2VSMB 4ATWA 4UB0H 3UZVB 4MJID 5C6TL 3ZU7B 4ZMVA 3GSXA 4OFPA 3GXDA 1Z6TA 1PIGA 2VR8A 3PZDA 4QO1A 2IGTA 4OZ4B 1HAUA 4NPKA 1JSYA 1V3LA 3BG1B 3ISMC 4LAQL 5IB3B 1I3VA 4CRPA 3SBRA 3MRDB 2XKNA 3DXAD 1TVBA 5LCVH 2V5FA 3B9KB 2BP8B 5J12B 3ETBF 2IAMA 3VD1A 4KH2A 4TXPA 3E2HB 3ECVA 1H3PH 4KZDL 4UM9D 1A14H 3L81A 1EFQA 1TU2A 4NN6C 4ZX5A 1DQDL 2BWIA 4IU3B 2IFFL 1RZFL 4OCSL 2XEHA 1BZ7A 1G9NL 3QT2A 2GRNB 3PWNB 4H88H 4PJCB 2R2LA 3DPYA 1UD4A 2YRBA 3KD7A 1U8OB 1R5VB 2VIRB 4NIYE 5JHLA 5IROD 4F3FA 5CWSA 5I6PA 2ICWA 5FFGA 1WA0X 1N64H 4ZW3A 2BSCA 1RZKL 1HKLH 3E3QE 3NAWA 2WVVA 4YHZH 5FO2A 2BXZA 3K6SB 4IBLT 4P23C 2QBWA 1SJHB 4IHOA 3OJMB 5D72L 2VQ4A 1R3HA 4FQXA 3TA3A 4JEHA 1TJHL 4ISVB 4WENB 4J3OF 5BJTB 3VFWB 2GRLA 3SO8A 3W5MA 4TMPA 3WTWA 1H3XA 5BOZG 2CO6A 4ONFH 3WLWC 3FHQA 3JWNC 5ITZF 5LHDA 3HBPA 3ARBD 4XBPA 5JMWA 3KYKL 3KZ8A 1V3JA 1XGQB 1UHVA 3QGOA 4RWYL 2C3VB 2UY1B 2CLZB 1F4YL 3WXWL 3LZNA 2WZPD 3LCYA 5BO1L 1JF5A 5TK2A 1HNGA 2Y2WA 4OGXH 2PWDA 5CP7A 1XGPB 3EUDA 3EJCA 2XENA 4X6EA 4JRXE 4NGHL 4OJAA 5HY9B 4M6ML 3BN9D 3TFKD 1OWNA 1ZLSL 1KB9J 2P7TB 3B1TA 5LB1A 3BVTA 3QIWC 1XXFC 5DJ8A 1TN7A 4JHWL 1IO4C 3DETD 4HIEA 5D7SL 3JV6B 3BP6A 1L9NA 3PHAA 4F2MA 5D2LB 4NACA 4ELKB 5EU4B 5FPIA 1C5CL 2XTJE 1URIA 1E8YA 1XHHA 3FT4A 2CO7A 5FEBA 3FK3A 3V8CA 5BRZA 5DI8A 3AAAC 3SDXB 3FB7B 2GK2A 4QR7A 3WIFA 1KJ2B 1T0MB 1OWWA 2OCFD 4RNRB 2XG4B 5CUSL 4UDTA 2XQ0A 4J8RA 2K45A 5D1ZB 3U0PB 1KIPB 1FVDA 2X4SA 2F68X 3KPSB 1U9KA 2FI7A 4E9QA 1BECA 4IBUA 4ZUTA 1E9PA 1UCTA 4ATGA 3CPUA 4XPGL 2X4TA 5FYLH 4TUKH 1LO5A 2DM3A 3UXGA 2ZG2A 3O6FD 5DZLA 1QSFD 1SEQH 1PX8A 2VZUA 4GG8B 2MCMA 4M48L 4MD4A 3D0LA 4E41B 2PTUA 4EZJA 3RJQB 1N70A 2XIDA 2VGXB 4K15A 7FABL 2ENPA 1F58L 2H3NB 3LKOA 5DC2A 5JBIA 2MIZA 4WW2C 3V0AC 4BHUA 4WFFE 1ZVSB 3RVWD 3ARYA 5LCVA 4ABUA 4RGMC 3PS6A 1MEXL 4PJDA 5KVGE 3OKLA 2FJUB 3IXTB 3GMQB 2BOBB 1Q1JL 3T3MF 3RQ3A 5LG1A 4A39A 2WQ6A 4CDGC 3O8XC 3QH1A 2B08A 3ECBB 1EFXA 4JFDB 4LESA 3CC5A 2XV2A 3RWEA 4KTDL 1LL1A 5FGRA 3S3JA 1XIWD 4ZFOB 1U91A 5HD8D 4GQ9H 5IR1A 4H25B 4JZYA 1PDKB 2AQSA 2D3LA 5HYQA 3CH1B 5I1AA 3OKMA 1MJ7H 5HBBA 5I1DA 3ILQC 4YDMA 4X4XB 1JTTA 3KR3H 1M3JA 1DQTA 4NNPH 5EKQD 3NFSL 5CCGE 1YAZA 2LXLA 2MTAA 4HC1L 5DYOB 4N6RB 4TLNA 4UTAH 3VI4A 3IU4L 5IGXL 2X4RA 3OR7B 1U8LB 3VYNA 2XBZA 3C5ZC 2VR3A 4X8GA 2Z7WA 2HUEA 3UT4A 1CD1A 1ZA3A 4P4KC 4WHTA 5DC0A 3U2IA 4OOFA 1EIBA 1FSKB 2HVKB 4LHUB 2YBRB 5EIDA 5CJOL 5JQ6H 1ADQH 4AIEA 4S1QH 4YHNB 2FO4A 4JCLA 2WIIB 2VXUH 4BTAA 2VDPL 1IBHA 1O0VA 4A63A 3VXMB 1OQXA 3L6FB 3UROR 2H41A 5FSJA 3BDXA 5J3HC 2I27N 4KK5C 3STLB 3BN3B 1XDTT 1OY3D 1KT2B 5D1ZI 4RMBA 3RILA 4KRMB 3T4AA 1DBBH 5E6UB 1FL3B 2Y24A 2PP8A 3BZFB 3DUUB 3MA9H 4R2GD 5FYKH 4MX7A 4B60A 4EJ1C 1IGFH 1LYQA 3F85A 4TLSA 3RTLA 1MCSA 3MLRH 4XXWC 4YBLC 1XXDC 5D8JH 5EF3A 5IFAH 1ACZA 2WZ5A 3IF1B 3M46A 4CKQA 5IFJA 2IGFL 2XPZA 3KMDA 3TV3H 1ZOXA 3BSZL 2X0UA 4WWNA 4PJDF 4I0KA 5D7KE 2Q86A 1AZBA 4FFVD 4QYAA 1I9IH 2PL5A 1S4IA 5K39A 4L9LB 2HT4C 3L5WB 3PEVB 1KXQE 3RG1C 3NCJH 3BC9A 5EUKA 1UA6H 25C8H 4R9HA 5JNLA 1M7XA 2DAVA 4ZS7H 3RRMB 2X87A 4JKMA 4CVUA 2YAFA 1QLRA 4L8BB 3K4ZA 1FF5A 2OZ4H 4D7PA 1MNUL 3O4OC 5E8PB 4JO2L 4A7QA 5ECJE 3O9WB 1O6VA 4JG0L 3N5AA 4FFZL 4HRNA 1ZGLA 2NTSP 2VLKA 5KG9B 3OJ2C 2XC8A 3OQ3B 2PWFA 3CDGA 4O4YH 2LU4A 3DGGA 4DFIA 4X7CC 2XNAB 3D2UA 4YSEA 2VAAA 4IM8A 4ACKA 5HVHB 2VLKE 2M83A 4QOKB 2EVFA 4YSTA 4FKKA 3WKPA 2N3JA 2B1HH 1PVHA 4TL5A 3HC0B 4XE5B 1J5CA 3V52H 5CGBA 3MKRA 1URLA 3BXNB 4I48B 4L1DA 3ROOA 3VI4F 1HZHL 1FFOA 1A6TB 4X5PA 1T04B 1E40A 4OKVA 3T04D 4X7TB 2I7OA 3HRAA 4GU5A 4WNEA 3TWQA 3OKEB 1IQDA 4WAFA 1X5LA 3MV2B 3PWPB 3KPRA 5LNGA 3MV9B 2WSPA 3CTTA 2P1YA 4OGAD 4A6YB 5KSVB 4NUGL 4JFPA 5FCUL 3VWJA 4BRJA 2N59A 4FLBA 4F15B 2ADIB 1KN4L 4MS6A 1RSYA 2QSCH 2NUTB 3OXRB 5DVOA 5BXFB 4MXWL 4EOWH 5BW7A 4PBVC 4R8WL 1OZTG 3AS0A 3SBTB 1DZ0A 5JZ7D 3OAYH 4Q74A 2A4ZA 3VDAA 5BVJB 3E38A 3RKDC 4P3WA 3TO4A 1UWXK 2FGWL 2UZXB 3TX4A 3H9ZA 4UTAA 3T0EE 4FA8A 2AAAA 3EOBA 5F7EL 3J5QB 4CMMA 4ZYKA 6FABL 4X4MA 1MFMA 1QLEH 4WY7L 1QABA 4G7VL 1E43A 2VM3A 4PJ8C 1RZIA 3BPCA 1MREH 1OTTC 3CXHJ 2ATPA 4U6YA 5DMYA 2ZXWE 3HVEA 3QUMH 2KLSA 3E6FA 4MQXC 1E2ZA 4TNGA 3SCMA 5C70A 2MOQA 4Q56A 5E4OA 1ADQA 3DV6A 1R5WA 2CUAA 1FPTH 3G08B 2NXPA 4NKOB 1I7TA 1UZGA 1ZDPE 4ZQTA 1DFBH 3VNYA 4FXGA 1A6WH 4MSWA 5J1TC 1UB6A 4CW1A 2GRPB 1QFWH 1IGCL 3VJ6B 2R1XB 3FT2B 4HEPG 1IKOP 4P2RA 1QNZH 1Z2KA 3U2SB 1S0PA 3KEAA 4ILIA 1A7RL 1UJTA 3EZ8A 4W6XB 3IXEA 3MEKA 1JZDC 4K3GA 4QTIH 3SY0B 5J89A 4NKIL 1AR1C 1DQLL 3P30H 1BDYA 4I0PC 4DZ8B 4G8GA 3SD2A 4MJ6B 3CLFH 2R1WB 5JYLA 3NIFB 4U8HA 1PZ5B 3HCVB 1S8DA 5JIDA 5DK0A 1I8AA 2G9HB 5T3XD 4B0MM 4RGNC 1I1AD 4F57L 1LO4L 4AGNA 2JKLA 3P7RE 5C9JA 4O2CA 3EH1A 2CNZA 1S7VB 4GP5B 2E2EA 1P4LB 1ZPUA 1XAKA 4HOSA 2I2OA 4NZJA 4YHYC 3IFOB 3L2LA 4JQIH 4XMPH 1NAKL 2FK9A 5EV7A 4LSPH 3GSWA 3BGAA 4DETA 2EDXA 3LH8A 1I7ZB 3GGWB 2OZ4A 2R4RL 3QRLA 4YE4L 1U8QA 3IAGC 2UXFA 2A5UA 4G11A 4R7VA 3RFZB 1H2VC 3LRMA 3MLYL 2CBTA 2Z0BA 3VXRA 2WY3B 1L5JA 3D9AH 1RK0A 4O02L 1Y18A 4H26A 1BQSA 2AXFA 3DSNA 3LJ3A 3LEWA 4IULA 1YA5A 4RGOL 4IGBD 4QRPA 1IARB 3T8GA 1QA9A 2XA3A 4CC4C 3MNVA 3TIDA 3TXMA 5FK9A 4HHAB 4K2UH 1QTYT 4WTZA 2FSDA 2H6OA 1P6FA 4W9EC 1JTOA 4J6RH 5E9DE 1ZT7A 3QFJA 3I4GA 3HLAA 4DIXA 3B8YA 1I31A 1DUZA 1FIGH 4R0LB 3EHRA 4LL9A 4NUQA 4Z7QB 1G9NC 1QWHA 4L8SA 1JPFA 2H2SC 1KGWA 3MRCB 1FVHA 1H5BB 2EILB 2CJUH 2LLNA 5FFOA 3PL6D 3TESA 2IH3B 2QT6A 1F13A 2YRPA 1YEHL 4E9SA 5MP6L 2X9WA 1CDUA 3QUKB 4XC1H 3VRLE 2QPFA 2ICEB 1IKNA 1FL5A 1RZKC 2XVLA 2BSSB 1BFOB 2L0DA 3ARED 4U6HB 4A55A 2MWCA 2BIQA 1ELRA 3DOSA 4IOIA 3IDJA 1F4WH 4JM2D 4ZO7A 4N0UB 4L4VE 3GMLB 2KZBA 4TSAH 4XWOC 2QEJA 1FLRH 1MLBB 3WTUA 4TNWF 4Y4KB 5FM8A 2FEDD 4ELMB 1MH5A 2FIRT 4KX7A 1IL1B 2FRGP 5FKAA 1EJFA 1ZV9A 5IQNA 4DF9A 3ZE2F 2VW6A 1E6JH 2DQTL 5TH2A 2EIJB 1TJMA 4HUNB 4QXGL 3HNTH 1MCPL 1T20A 3WL9B 3B9KD 4LO9A 4MBOA 3QUMA 5L4FA 3D05A 5TFSH 3STZA 5H35A 4M6AA 3RNKA 1TZAA 3CLEH 4TVSa 1VGKB 43C9B 4DGVL 3GW4A 2CPCA 1BV8A 5KSUA 3DSFL 3VSVA 5FHBH 3EGSB 2BW4A 3QPKA 2K6YA 1QMUA 1SDYA 2BVYA 2CALA 3ARGC 2YNQA 1MVFA 3UBGA 2COVD 4U1NB 2Z31D 4Y19A 3N1QC 3DXAE 2BJML 3T2JE 1CB4A 1VKXA 5TMNE 3E80A 1H0DA 4LRNL 3VXTB 5FXCH 2OR7A 2CR3A 4E5XA 1TNYA 3EDJA 1YEIH 1YA0A 1S7RB 1JZEA 4EVNB 2BOCB 2DWSA 1QRKA 2ONDA 4XNZC 4QHKI 2AK4B 4G1MA 4OM1L 4MYWB 1EGJL 5J7CC 2R56H 3MFFA 3VXQB 4GSXA 2CGRL 1GRWA 1B88A 4AL8C 2WWKT 3MGBA 1U8NA 5CGYD 2GIMA 4DCQA 5E94B 3QYNA 4AZUA 1J9QA 1HH6B 1UEYA 1I9JL 4N1EA 4RLDA 1K5NB 3LHAA 2UXGA 4G6KL 4N68A 4Y4HC 1KEML 4Y0GA 2KPWA 3L1EA 3DMMA 3QORC 3VXUB 1LO2L 2IWGA 1S7SA 2WV3A 1E4HA 5H8DA 4MHHI 3CZUB 1Z9SA 2VLJA 1AH1A 3OR6B 1MFEL 2D7OA 3TO2A 2UZIL 1M71A 3VRLF 2AEPH 5GGSB 3ALWA 2PTTA 1CG9A 1S9WA 1JERA 2DIAA 5DPFE 3D9HA 4NUMA 1MVUA 4GUCA 4I7ZC 1EPUA 3EG9A 5JQHC 1CXKA 3BPNB 3BDYL 1FNHA 4L2YA 3PGFL 4RG9A 3IDYC 4F6RD 3QYCA 1GS8A 1X5AA 4R4ND 1EDYA 1ZWIA 2G5RA 1Z6JT 5EFIA 4DGIH 3MUZ1 4N1HB 1UN8A 3MRMA 4QHUB 5TGBA 2BCMA 3EGDB 3BQUC 5CFAA 1BFSA 4X7DC 3ARFB 4X5LA 5I8CA 1SYSB 4U1GC 3A6CH 3ATBA 1TG8A 4I3RL 2X6AA 5KVGL 2HT3D 2ZX6A 3P0YL 3I6LD 4CEMA 4F7AA 4LCCC 1CYWA 2C5DC 1SVCP 3IFNL 4GMTL 5FO7B 3L16A 2WVUA 2Y22A 1TZIB 4H40A 2E9IA 4GMRA 3HC4L 4MMZC 4MWFB 4RZCB 1EERB 2P24B 1NL4A 2A3TA 3ARDC 1M56B 1TF4A 2J56A 1LO3H 4MDJB 1BOGB 3NN8A 3QH3B 3RU0A 2EDNA 4P59H 1HQ4A 2ENSA 4FXKC 5FA4B 2VTBA 2P46B 5DHDA 4JVSA 1SUJA 3OXSA 4Z3IA 4NPYB 1P7BA 3C60A 3J7HA 4NZUH 5IVNA 3FN0H 1MX6A 2AJYL 3TN0A 2W95A 3VX0A 4NHUA 3AG3B 4JM4L 3FCGA 2AJ3A 3P2BA 1XWVA 5E99L 5AWNH 3ZGIA 3ULUD 2V9QA 2BRRL 1AZRA 3AUWB 2ISDA 3NGBC 2VDRH 2EE9A 3LEVH 1K8IB 3MS3A 2A9AA 1RHHA 5IB5A 5DGQA 2OL3L 3G5YA 2BPBA 3FKUS 3FCTA 3CV5A 5C0BA 4ELDA 3WD5H 4JJHA 3O3EA 2GAZA 3HB3B 1QSFE 1BOYA 2YGPA 2YMTA 1S63A 3I74A 4WHDA 4NJAL 4ZDHB 1JCSA 2WLKA 5C0BE 2NW2B 4MNQB 3UBHA 5F3BB 5HDQH 3DXMG 1KNOA 4G43A 5B21A 1VEMA 3L48A 3GJFH 3VG9B 1UT9A 4MCMA 3CQCB 1Q9LB 4L8DB 1W15A 3M88A 4F9PA 1KN2H 4JPIA 4YHML 2VO5A 5HHME 5LXVA 4FG4A 4PREB 5E1HB 3OKOA 1OF0A 4G1EB 4LLAA 3SY2A 3CZFA 4KDTC 2DTML 3FU9A 2Q10A 4QNPF 3FB8A 4OFQA 5EX3A 1ZV2A 4LLWB 4IRSB 1T22B 5IVZA 4QRTB 1CMOA 1AD0A 4NB7A 3RVXC 1TMQA 3ESNA 4A2FA 3LHPH 2NY0B 5AEAA 5AB9A 3N9GL 1SPDA 5DZ9A 2XZAH 2EZ0D 4EN3B 2Y36L 4EUPB 4LPXA 5EU6A 1ETJA 5GS0L 3ZDZF 5HYJD 2Y1FA 4LHUD 3AACA 3S3CB 4OH2A 3VWKA 1ROCA 1MCKA 1AGDA 4X9GA 2VDLL 4WKZA 4FQJH 5E6SB 4YEFA 3AUAA 4JEGB 3M7FB 1KCUH 3VXMD 1U4GA 2X4OB 1T89A 4W70A 3OXGA 4GRWH 1X3WA 4FQQB 3X2QB 4DKTA 1ED3B 3I85A 3QP3A 4OFYA 2ED7A 5D7IE 5JLZB 4JN2B 1XVSA 2J1YA 2EE2A 3S35X 3DI3B 4FHJA 5BVPL 5ALCH 4FTVB 3G6JE 4ZXBC 3MKGA 4RH4A 1UURA 1HHGA 3PHSA 4R96B 5DS2A 2UX7A 3MODL 1LF8A 2YR3A 3T3PF 3PPEA 5BPPA 2A9ML 3UAJA 2PTVA 1YEJH 2AWIA 2CQVA 4D94A 1I85A 5F21B 4FADA 2GHZA 4P5KB 2IADB 3H4HA 3H54A 1AY1L 4CMHC 2OQJA 4TULL 2GITB 5MEPB 1NP7A 2JJUA 3K5SA 4I6JA 4QTHB 2VLMD 1C12A 1QW9A 4AQZA 4AR1A 3BISA 3VMNA 2VJ8A 1TYEB 4KOBA 4F80A 4KTEH 3ONKA 4JRWA 3U46B 4H44C 1ODUA 1FZOA 2OR9H 2X10A 4FLSA 2ZD0A 1OD9A