4K89A

Crystal structure of pseudomonas aeruginosa strain k solvent tolerant elastase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
298
structure length
298
Chain Sequence
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNGSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Organic solvent tolerant elastase
publication title Crystal structure analysia of solvent tolerant elastase strain K
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 116
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2013-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 4k89A02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 4k89A01
4TLNA 3T8GA 4ZQTA 2HPTA 3U9WA 3TMNE 4Q4EA 4MKTA 3B7UX 4D91A 1QF1A 1FJWA 4QIRA 5L3UE 3FUMA 4H57A 3P7RE 1ZDPE 1LNCE 3T8CA 3T8HA 4TMNE 5L8PE 1KROA 4MXJE 3CHRA 4PU2A 3CIAA 4D9WA 1QF0A 1H19A 3QH1A 1Z9GE 3DBKA 5FXNA 3T2JE 5TLNA 4MWPE 5BPPA 3EBGA 2DQ6A 3FH7A 3B2XA 3FORA 1EZMA 1FJQA 1TMNE 3CHQA 3T8DA 3NQYB 1KR6A 3LS7A 1THLA 4K5LA 2DQMA 1PE8A 4R5VA 3CHPA 1FJTA 4K89A 1LNEE 3N21A 3MSNA 4XO3A 3FB0A 1PE5A 5JXNE 3CHOA 1GW6A 1FJ3A 1FJVA 3P7VE 3FUIA 4N4EE 1KEIA 2HPOA 6TLIA 3FHEA 3FUHA 3T73A 3QGOA 1FJOA 4QUOA 3TLIA 2VJ8A 4PVBA 3FGDA 3SSBA 4ZX4A 3DO0A 3B7SA 1OS0A 3P7UE 1U4GA 1TLPE 3EIMA 4XNBA 5DPEE 5LIFE 4ZW3A 3NQXA 2TLIA 5AENA 5DYFA 7TLIA 5TLIA 4XO4A 1TLIA 3B37A 2WHZA 1KJPA 4X2UA 1LNFE 4ZW8A 4N66E 3MS3A 3FLFA 5LWDE 4R5TA 3T87A 5FSJA 2VQXA 3FU3A 5DPFE 2XPZA 6TMNE 3FUEA 3FTSA 3FUKA 3FU5A 2WI0A 3FU0A 3P7TE 4K5OA 1Y3GE 3DNZA 1ESPA 4R5XA 3FBOA 5DLLA 4ZX6A 5A3YA 3FTWA 4GAAA 1KTOA 5FWQA 3P7PE 4XMWA 4RVBA 1LNAE 3FXSA 4K5MA 3MSFA 4OW3A 1NPCA 3T8FA 4K5NA 4QPEA 5JT9E 3F2PA 3FTYA 3T2HE 2GTQA 3Q43A 4XNAA 1BQBA 3FTUA 4QMEA 2TLXA 3FTXA 4XMTA 4XMZA 3T8VA 3FUFA 1KJOA 3ZI6A 4R7LA 3P7WE 3P7SE 5FSPA 1QF2A 3FTZA 2R59A 3KEDA 4XN1A 2TMNE 3NQZB 5L41E 3CHSA 4GERA 3Q44A 4XN7A 3FCQA 4N5PE 3FTVA 3B2PA 1KS7A 3QJXA 3FUDA 3FV4A 4Q4IA 3T74A 3DO1A 5TMNE 5JSSE 1TLXA 4DPRA 3B34A 4XNDA 4ZW5A 1TRLA 3EBHA 3FUNA 4PW4A 5DLHA 1L3FE 4K5PA 4TNLA 3FXPA 3F28A 2XQ0A 4XN5A 1LNBE 1HS6A 1LNDE 3FVPA 8TLIA 4OI5E 4XN4A 1KKKA 4XMXA 4MZNE 3MSAA 4XN2A 2XPYA 4TLIA 4ZW7A 3EBIA 3PUUA 4QHPA 5HQDA 5JS3E 3FU6A 4XMVA 4ZX3A 1SQMA 3B3BA 3B7RL 1FJUA 2A7GE 4MTWE 1PE7A 4M65A 4XN9A 4B52A 3QH5A 1HYTA 4L2LA 2G4ZA 4ZW6A 5K7TA 3DO2A 3P7QE 3FH8A 1KL6A 4MS6A 2ZXGA 4RSYA 5FSSA 3T2IE 4XO5A 3B7TA 5JVIE 1GXWA 4XMUA 4XN8A 7TLNA 4J3BA 8TLNE 3FH5A 3NN7A 3FUJA 3FULA 4ZX5A 4K90A
chains in the Genus database with same CATH superfamily
4ZQTA 3T8GA 3B7UX 1FJWA 4QIRA 1ZDPE 3T8HA 4TMNE 3CHRA 3QH1A 3T2JE 5BPPA 3B2XA 1FJQA 4R5VA 5EV7A 1PE5A 1GW6A 1FJVA 3P7VE 3FUHA 1LMLA 4QUOA 3SSBA 1TLPE 3EIMA 5DPEE 4ZW3A 2TLIA 4FYRA 5DYFA 7TLIA 4ZW8A 3FLFA 5LWDE 3FUKA 3P7TE 4K5OA 1Y3GE 4ZX6A 5DLLA 3FTWA 1KTOA 4FYSA 3P7PE 1LNAE 4K5MA 4OW3A 1NPCA 4KXDA 3FTYA 4XNAA 4XMTA 3MDJA 3FUFA 1KJOA 3NQZB 3CHSA 3Q44A 3FCQA 4NAQA 1KS7A 3FV4A 4XNDA 4ZW5A 3FUNA 5DLHA 4PW4A 4K5PA 3FXPA 4XN5A 4AR8A 4XN4A 4XMXA 4ARFA 4MZNE 2XPYA 4QHPA 4XMVA 3B3BA 1FJUA 4PJ6A 5K7TA 3DO2A 5FSSA 1GXWA 4J3BA 3NN7A 3FUJA 5C97A 2HPTA 4D91A 1QF1A 3FUMA 1LNCE 5L8PE 4MXJE 4D9WA 4PU2A 3CIAA 1H19A 5TLNA 4MWPE 3EBGA 3FORA 1EZMA 4WZ9A 3CHQA 3T8DA 4K5LA 1LNEE 3MSNA 4XO3A 3FB0A 3FUIA 2HPOA 3T73A 3QGOA 3TLIA 2VJ8A 3DO0A 1OS0A 3P7UE 1U4GA 5TLIA 4X2UA 4OU3A 3T87A 5FSJA 5DPFE 6TMNE 3FUEA 3FTSA 3FU5A 1ESPA 4XMWA 3FXSA 4KXAA 4K5NA 5K1VA 2GTQA 1BQBA 3FTZA 3KEDA 2TMNE 4FKHA 5L41E 4XN7A 4N5PE 5JSSE 3DO1A 1TLXA 4DPRA 4KX9A 2XQ0A 1HS6A 1LNDE 3FVPA 4FKEA 4TLIA 4FKKA 3EBIA 4P8QA 5HQDA 3FU6A 4ZX3A 4XN9A 1PE7A 1HYTA 4L2LA 4ZW6A 5AENA 3P7QE 4RSYA 1KL6A 2ZXGA 5JVIE 3FULA 4ZX5A 4II7A 4FCAA 5L3UE 1KROA 1Z9GE 3DBKA 5FXNA 2DQ6A 2DQMA 1PE8A 5JXNE 3CHOA 4F5CA 5AB2A 3FHEA 4PVBA 3FGDA 4HOMA 4ZX4A 3B7SA 4AR9A 5LIFE 3NQXA 4XO4A 3B37A 2WHZA 1KJPA 1LNFE 3MS3A 2VQXA 2XPZA 2WI0A 3FU0A 4Z7IA 4RVBA 4QPEA 3F2PA 3Q43A 3FTUA 4QMEA 3FTXA 4XMZA 4R7LA 5FSPA 1QF2A 5LDSA 2R59A 4GERA 4FYTA 3QJXA 3FUDA 4Q4IA 3B34A 4FYQA 3QNFA 4ZW7A 5JS3E 4XN2A 1SQMA 3B7RL 4M65A 3QH5A 4E36A 2G4ZA 1Z5HA 3T2IE 4XO5A 3B7TA 4IHQA 4XN8A 7TLNA 3FH5A 4K90A 4TLNA 3TMNE 5LG6A 4Q4EA 4MKTA 4H57A 3P7RE 3T8CA 1QF0A 3FH7A 1TMNE 3NQYB 1KR6A 3LS7A 1THLA 4JBSA 3CHPA 1FJTA 4K89A 3N21A 4NZ8A 1FJ3A 4N4EE 1KEIA 6TLIA 5J6SA 3SE6A 1FJOA 4KX7A 4XNBA 1TLIA 2YD0A 4N66E 4R5TA 4KXCA 3FU3A 3DNZA 4R5XA 3FBOA 5A3YA 4GAAA 5FWQA 3T8FA 5JT9E 3MSFA 3T2HE 2TLXA 3T8VA 3ZI6A 5CU5A 3P7WE 3P7SE 4FGMA 4XN1A 3FTVA 1Z1WA 3B2PA 3T74A 5TMNE 5AB0A 4AR1A 1TRLA 3EBHA 4TNLA 3F28A 1LNBE 8TLIA 4KXBA 4OI5E 3U9WA 1KKKA 3MSAA 3PUUA 2A7GE 4MTWE 4B52A 3Q7JA 5LHDA 4MS6A 4KX8A 3FH8A 4XMUA 8TLNE 1L3FE
chains in the Genus database with same CATH topology
4TLNA 3T8GA 4ZQTA 2HPTA 3U9WA 3TMNE 4Q4EA 4MKTA 3B7UX 4D91A 1QF1A 1FJWA 4QIRA 5L3UE 3FUMA 4H57A 3P7RE 1ZDPE 1LNCE 3T8CA 3T8HA 4TMNE 5L8PE 1KROA 4MXJE 3CHRA 4PU2A 3CIAA 4D9WA 1QF0A 1H19A 3QH1A 1Z9GE 3DBKA 5FXNA 3T2JE 5TLNA 4MWPE 5BPPA 3EBGA 2DQ6A 3FH7A 3B2XA 3FORA 1EZMA 1FJQA 1TMNE 3CHQA 3T8DA 3NQYB 1KR6A 3LS7A 1THLA 4K5LA 2DQMA 1PE8A 4R5VA 3CHPA 1FJTA 4K89A 1LNEE 3N21A 3MSNA 4XO3A 3FB0A 1PE5A 5JXNE 3CHOA 1GW6A 1FJ3A 1FJVA 3P7VE 3FUIA 4N4EE 1KEIA 2HPOA 6TLIA 3FHEA 3FUHA 3T73A 1LMLA 3QGOA 1FJOA 4QUOA 3TLIA 2VJ8A 4PVBA 3FGDA 3SSBA 4ZX4A 3DO0A 3B7SA 1OS0A 3P7UE 1U4GA 1TLPE 3EIMA 4XNBA 5DPEE 5LIFE 4ZW3A 3NQXA 2TLIA 5AENA 5DYFA 7TLIA 5TLIA 4XO4A 1TLIA 3B37A 2WHZA 1KJPA 4X2UA 1LNFE 4ZW8A 4N66E 3MS3A 3FLFA 5LWDE 4R5TA 3T87A 5FSJA 2VQXA 3FU3A 5DPFE 2XPZA 6TMNE 3FUEA 3FTSA 3FUKA 3FU5A 2WI0A 3FU0A 3P7TE 4K5OA 1Y3GE 3DNZA 1ESPA 4R5XA 3FBOA 5DLLA 4ZX6A 5A3YA 3FTWA 4GAAA 1KTOA 5FWQA 3P7PE 4XMWA 4RVBA 1LNAE 3FXSA 4K5MA 3MSFA 4OW3A 1NPCA 3T8FA 4K5NA 4QPEA 5JT9E 3F2PA 3FTYA 3T2HE 2GTQA 3Q43A 4XNAA 1BQBA 3FTUA 4QMEA 2TLXA 3FTXA 4XMTA 4XMZA 3T8VA 3FUFA 1KJOA 3ZI6A 4R7LA 3P7WE 3P7SE 5FSPA 1QF2A 3FTZA 2R59A 3KEDA 4XN1A 2TMNE 3NQZB 5L41E 3CHSA 4GERA 3Q44A 4XN7A 3FCQA 4N5PE 3FTVA 3B2PA 1KS7A 3QJXA 3FUDA 3FV4A 4Q4IA 3T74A 3DO1A 5TMNE 5JSSE 1TLXA 4DPRA 3B34A 4XNDA 4ZW5A 1TRLA 3EBHA 3FUNA 4PW4A 5DLHA 1L3FE 4K5PA 4TNLA 3FXPA 3F28A 2XQ0A 4XN5A 1LNBE 1HS6A 1LNDE 3FVPA 8TLIA 4OI5E 4XN4A 1KKKA 4XMXA 4MZNE 3MSAA 4XN2A 2XPYA 4TLIA 4ZW7A 3EBIA 3PUUA 4QHPA 5HQDA 5JS3E 3FU6A 4XMVA 4ZX3A 1SQMA 3B3BA 3B7RL 1FJUA 2A7GE 4MTWE 1PE7A 4M65A 4XN9A 4B52A 3QH5A 1HYTA 4L2LA 2G4ZA 4ZW6A 5K7TA 3DO2A 3P7QE 3FH8A 1KL6A 4MS6A 2ZXGA 4RSYA 5FSSA 3T2IE 4XO5A 3B7TA 5JVIE 1GXWA 4XMUA 4XN8A 7TLNA 4J3BA 8TLNE 3FH5A 3NN7A 3FUJA 3FULA 4ZX5A 4K90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TLN A;  3T8G A;  4ZQT A;  2HPT A;  3U9W A;  3TMN E;  4Q4E A;  4MKT A;  3B7U X;  4D91 A;  1QF1 A;  1FJW A;  4QIR A;  5L3U E;  3FUM A;  4H57 A;  3P7R E;  1ZDP E;  1LNC E;  3T8C A;  3T8H A;  4TMN E;  5L8P E;  1KRO A;  4MXJ E;  3CHR A;  4PU2 A;  3CIA A;  4D9W A;  1QF0 A;  1H19 A;  3QH1 A;  1Z9G E;  3DBK A;  5FXN A;  3T2J E;  5TLN A;  4MWP E;  5BPP A;  3EBG A;  2DQ6 A;  3FH7 A;  3B2X A;  3FOR A;  1EZM A;  1FJQ A;  1TMN E;  3CHQ A;  3T8D A;  3NQY B;  1KR6 A;  3LS7 A;  1THL A;  4K5L A;  2DQM A;  1PE8 A;  4R5V A;  3CHP A;  1FJT A;  4K89 A;  1LNE E;  3N21 A;  3MSN A;  4XO3 A;  3FB0 A;  1PE5 A;  5JXN E;  3CHO A;  1GW6 A;  1FJ3 A;  1FJV A;  3P7V E;  3FUI A;  4N4E E;  1KEI A;  2HPO A;  6TLI A;  3FHE A;  3FUH A;  3T73 A;  3QGO A;  1FJO A;  4QUO A;  3TLI A;  2VJ8 A;  4PVB A;  3FGD A;  3SSB A;  4ZX4 A;  3DO0 A;  3B7S A;  1OS0 A;  3P7U E;  1U4G A;  1TLP E;  3EIM A;  4XNB A;  5DPE E;  5LIF E;  4ZW3 A;  3NQX A;  2TLI A;  5AEN A;  5DYF A;  7TLI A;  5TLI A;  4XO4 A;  1TLI A;  3B37 A;  2WHZ A;  1KJP A;  4X2U A;  1LNF E;  4ZW8 A;  4N66 E;  3MS3 A;  3FLF A;  5LWD E;  4R5T A;  3T87 A;  5FSJ A;  2VQX A;  3FU3 A;  5DPF E;  2XPZ A;  6TMN E;  3FUE A;  3FTS A;  3FUK A;  3FU5 A;  2WI0 A;  3FU0 A;  3P7T E;  4K5O A;  1Y3G E;  3DNZ A;  1ESP A;  4R5X A;  3FBO A;  5DLL A;  4ZX6 A;  5A3Y A;  3FTW A;  4GAA A;  1KTO A;  5FWQ A;  3P7P E;  4XMW A;  4RVB A;  1LNA E;  3FXS A;  4K5M A;  3MSF A;  4OW3 A;  1NPC A;  3T8F A;  4K5N A;  4QPE A;  5JT9 E;  3F2P A;  3FTY A;  3T2H E;  2GTQ A;  3Q43 A;  4XNA A;  1BQB A;  3FTU A;  4QME A;  2TLX A;  3FTX A;  4XMT A;  4XMZ A;  3T8V A;  3FUF A;  1KJO A;  3ZI6 A;  4R7L A;  3P7W E;  3P7S E;  5FSP A;  1QF2 A;  3FTZ A;  2R59 A;  3KED A;  4XN1 A;  2TMN E;  3NQZ B;  5L41 E;  3CHS A;  4GER A;  3Q44 A;  4XN7 A;  3FCQ A;  4N5P E;  3FTV A;  3B2P A;  1KS7 A;  3QJX A;  3FUD A;  3FV4 A;  4Q4I A;  3T74 A;  3DO1 A;  5TMN E;  5JSS E;  1TLX A;  4DPR A;  3B34 A;  4XND A;  4ZW5 A;  1TRL A;  3EBH A;  3FUN A;  4PW4 A;  5DLH A;  1L3F E;  4K5P A;  4TNL A;  3FXP A;  3F28 A;  2XQ0 A;  4XN5 A;  1LNB E;  1HS6 A;  1LND E;  3FVP A;  8TLI A;  4OI5 E;  4XN4 A;  1KKK A;  4XMX A;  4MZN E;  3MSA A;  4XN2 A;  2XPY A;  4TLI A;  4ZW7 A;  3EBI A;  3PUU A;  4QHP A;  5HQD A;  5JS3 E;  3FU6 A;  4XMV A;  4ZX3 A;  1SQM A;  3B3B A;  3B7R L;  1FJU A;  2A7G E;  4MTW E;  1PE7 A;  4M65 A;  4XN9 A;  4B52 A;  3QH5 A;  1HYT A;  4L2L A;  2G4Z A;  4ZW6 A;  5K7T A;  3DO2 A;  3P7Q E;  3FH8 A;  1KL6 A;  4MS6 A;  2ZXG A;  4RSY A;  5FSS A;  3T2I E;  4XO5 A;  3B7T A;  5JVI E;  1GXW A;  4XMU A;  4XN8 A;  7TLN A;  4J3B A;  8TLN E;  3FH5 A;  3NN7 A;  3FUJ A;  3FUL A;  4ZX5 A;  4K90 A; 
#chains in the Genus database with same CATH topology
 4ZQT A;  3T8G A;  3B7U X;  1FJW A;  4QIR A;  1ZDP E;  3T8H A;  4TMN E;  3CHR A;  3QH1 A;  3T2J E;  5BPP A;  3B2X A;  1FJQ A;  4R5V A;  5EV7 A;  1PE5 A;  1GW6 A;  1FJV A;  3P7V E;  3FUH A;  1LML A;  4QUO A;  3SSB A;  1TLP E;  3EIM A;  5DPE E;  4ZW3 A;  2TLI A;  4FYR A;  5DYF A;  7TLI A;  4ZW8 A;  3FLF A;  5LWD E;  3FUK A;  3P7T E;  4K5O A;  1Y3G E;  4ZX6 A;  5DLL A;  3FTW A;  1KTO A;  4FYS A;  3P7P E;  1LNA E;  4K5M A;  4OW3 A;  1NPC A;  4KXD A;  3FTY A;  4XNA A;  4XMT A;  3MDJ A;  3FUF A;  1KJO A;  3NQZ B;  3CHS A;  3Q44 A;  3FCQ A;  4NAQ A;  1KS7 A;  3FV4 A;  4XND A;  4ZW5 A;  3FUN A;  5DLH A;  4PW4 A;  4K5P A;  3FXP A;  4XN5 A;  4AR8 A;  4XN4 A;  4XMX A;  4ARF A;  4MZN E;  2XPY A;  4QHP A;  4XMV A;  3B3B A;  1FJU A;  4PJ6 A;  5K7T A;  3DO2 A;  5FSS A;  1GXW A;  4J3B A;  3NN7 A;  3FUJ A;  5C97 A;  2HPT A;  4D91 A;  1QF1 A;  3FUM A;  1LNC E;  5L8P E;  4MXJ E;  4D9W A;  4PU2 A;  3CIA A;  1H19 A;  5TLN A;  4MWP E;  3EBG A;  3FOR A;  1EZM A;  4WZ9 A;  3CHQ A;  3T8D A;  4K5L A;  1LNE E;  3MSN A;  4XO3 A;  3FB0 A;  3FUI A;  2HPO A;  3T73 A;  3QGO A;  3TLI A;  2VJ8 A;  3DO0 A;  1OS0 A;  3P7U E;  1U4G A;  5TLI A;  4X2U A;  4OU3 A;  3T87 A;  5FSJ A;  5DPF E;  6TMN E;  3FUE A;  3FTS A;  3FU5 A;  1ESP A;  4XMW A;  3FXS A;  4KXA A;  4K5N A;  5K1V A;  2GTQ A;  1BQB A;  3FTZ A;  3KED A;  2TMN E;  4FKH A;  5L41 E;  4XN7 A;  4N5P E;  5JSS E;  3DO1 A;  1TLX A;  4DPR A;  4KX9 A;  2XQ0 A;  1HS6 A;  1LND E;  3FVP A;  4FKE A;  4TLI A;  4FKK A;  3EBI A;  4P8Q A;  5HQD A;  3FU6 A;  4ZX3 A;  4XN9 A;  1PE7 A;  1HYT A;  4L2L A;  4ZW6 A;  5AEN A;  3P7Q E;  4RSY A;  1KL6 A;  2ZXG A;  5JVI E;  3FUL A;  4ZX5 A;  4II7 A;  4FCA A;  5L3U E;  1KRO A;  1Z9G E;  3DBK A;  5FXN A;  2DQ6 A;  2DQM A;  1PE8 A;  5JXN E;  3CHO A;  4F5C A;  5AB2 A;  3FHE A;  4PVB A;  3FGD A;  4HOM A;  4ZX4 A;  3B7S A;  4AR9 A;  5LIF E;  3NQX A;  4XO4 A;  3B37 A;  2WHZ A;  1KJP A;  1LNF E;  3MS3 A;  2VQX A;  2XPZ A;  2WI0 A;  3FU0 A;  4Z7I A;  4RVB A;  4QPE A;  3F2P A;  3Q43 A;  3FTU A;  4QME A;  3FTX A;  4XMZ A;  4R7L A;  5FSP A;  1QF2 A;  5LDS A;  2R59 A;  4GER A;  4FYT A;  3QJX A;  3FUD A;  4Q4I A;  3B34 A;  4FYQ A;  3QNF A;  4ZW7 A;  5JS3 E;  4XN2 A;  1SQM A;  3B7R L;  4M65 A;  3QH5 A;  4E36 A;  2G4Z A;  1Z5H A;  3T2I E;  4XO5 A;  3B7T A;  4IHQ A;  4XN8 A;  7TLN A;  3FH5 A;  4K90 A;  4TLN A;  3TMN E;  5LG6 A;  4Q4E A;  4MKT A;  4H57 A;  3P7R E;  3T8C A;  1QF0 A;  3FH7 A;  1TMN E;  3NQY B;  1KR6 A;  3LS7 A;  1THL A;  4JBS A;  3CHP A;  1FJT A;  4K89 A;  3N21 A;  4NZ8 A;  1FJ3 A;  4N4E E;  1KEI A;  6TLI A;  5J6S A;  3SE6 A;  1FJO A;  4KX7 A;  4XNB A;  1TLI A;  2YD0 A;  4N66 E;  4R5T A;  4KXC A;  3FU3 A;  3DNZ A;  4R5X A;  3FBO A;  5A3Y A;  4GAA A;  5FWQ A;  3T8F A;  5JT9 E;  3MSF A;  3T2H E;  2TLX A;  3T8V A;  3ZI6 A;  5CU5 A;  3P7W E;  3P7S E;  4FGM A;  4XN1 A;  3FTV A;  1Z1W A;  3B2P A;  3T74 A;  5TMN E;  5AB0 A;  4AR1 A;  1TRL A;  3EBH A;  4TNL A;  3F28 A;  1LNB E;  8TLI A;  4KXB A;  4OI5 E;  3U9W A;  1KKK A;  3MSA A;  3PUU A;  2A7G E;  4MTW E;  4B52 A;  3Q7J A;  5LHD A;  4MS6 A;  4KX8 A;  3FH8 A;  4XMU A;  8TLN E;  1L3F E; 
#chains in the Genus database with same CATH homology
 4TLN A;  3T8G A;  4ZQT A;  2HPT A;  3U9W A;  3TMN E;  4Q4E A;  4MKT A;  3B7U X;  4D91 A;  1QF1 A;  1FJW A;  4QIR A;  5L3U E;  3FUM A;  4H57 A;  3P7R E;  1ZDP E;  1LNC E;  3T8C A;  3T8H A;  4TMN E;  5L8P E;  1KRO A;  4MXJ E;  3CHR A;  4PU2 A;  3CIA A;  4D9W A;  1QF0 A;  1H19 A;  3QH1 A;  1Z9G E;  3DBK A;  5FXN A;  3T2J E;  5TLN A;  4MWP E;  5BPP A;  3EBG A;  2DQ6 A;  3FH7 A;  3B2X A;  3FOR A;  1EZM A;  1FJQ A;  1TMN E;  3CHQ A;  3T8D A;  3NQY B;  1KR6 A;  3LS7 A;  1THL A;  4K5L A;  2DQM A;  1PE8 A;  4R5V A;  3CHP A;  1FJT A;  4K89 A;  1LNE E;  3N21 A;  3MSN A;  4XO3 A;  3FB0 A;  1PE5 A;  5JXN E;  3CHO A;  1GW6 A;  1FJ3 A;  1FJV A;  3P7V E;  3FUI A;  4N4E E;  1KEI A;  2HPO A;  6TLI A;  3FHE A;  3FUH A;  3T73 A;  1LML A;  3QGO A;  1FJO A;  4QUO A;  3TLI A;  2VJ8 A;  4PVB A;  3FGD A;  3SSB A;  4ZX4 A;  3DO0 A;  3B7S A;  1OS0 A;  3P7U E;  1U4G A;  1TLP E;  3EIM A;  4XNB A;  5DPE E;  5LIF E;  4ZW3 A;  3NQX A;  2TLI A;  5AEN A;  5DYF A;  7TLI A;  5TLI A;  4XO4 A;  1TLI A;  3B37 A;  2WHZ A;  1KJP A;  4X2U A;  1LNF E;  4ZW8 A;  4N66 E;  3MS3 A;  3FLF A;  5LWD E;  4R5T A;  3T87 A;  5FSJ A;  2VQX A;  3FU3 A;  5DPF E;  2XPZ A;  6TMN E;  3FUE A;  3FTS A;  3FUK A;  3FU5 A;  2WI0 A;  3FU0 A;  3P7T E;  4K5O A;  1Y3G E;  3DNZ A;  1ESP A;  4R5X A;  3FBO A;  5DLL A;  4ZX6 A;  5A3Y A;  3FTW A;  4GAA A;  1KTO A;  5FWQ A;  3P7P E;  4XMW A;  4RVB A;  1LNA E;  3FXS A;  4K5M A;  3MSF A;  4OW3 A;  1NPC A;  3T8F A;  4K5N A;  4QPE A;  5JT9 E;  3F2P A;  3FTY A;  3T2H E;  2GTQ A;  3Q43 A;  4XNA A;  1BQB A;  3FTU A;  4QME A;  2TLX A;  3FTX A;  4XMT A;  4XMZ A;  3T8V A;  3FUF A;  1KJO A;  3ZI6 A;  4R7L A;  3P7W E;  3P7S E;  5FSP A;  1QF2 A;  3FTZ A;  2R59 A;  3KED A;  4XN1 A;  2TMN E;  3NQZ B;  5L41 E;  3CHS A;  4GER A;  3Q44 A;  4XN7 A;  3FCQ A;  4N5P E;  3FTV A;  3B2P A;  1KS7 A;  3QJX A;  3FUD A;  3FV4 A;  4Q4I A;  3T74 A;  3DO1 A;  5TMN E;  5JSS E;  1TLX A;  4DPR A;  3B34 A;  4XND A;  4ZW5 A;  1TRL A;  3EBH A;  3FUN A;  4PW4 A;  5DLH A;  1L3F E;  4K5P A;  4TNL A;  3FXP A;  3F28 A;  2XQ0 A;  4XN5 A;  1LNB E;  1HS6 A;  1LND E;  3FVP A;  8TLI A;  4OI5 E;  4XN4 A;  1KKK A;  4XMX A;  4MZN E;  3MSA A;  4XN2 A;  2XPY A;  4TLI A;  4ZW7 A;  3EBI A;  3PUU A;  4QHP A;  5HQD A;  5JS3 E;  3FU6 A;  4XMV A;  4ZX3 A;  1SQM A;  3B3B A;  3B7R L;  1FJU A;  2A7G E;  4MTW E;  1PE7 A;  4M65 A;  4XN9 A;  4B52 A;  3QH5 A;  1HYT A;  4L2L A;  2G4Z A;  4ZW6 A;  5K7T A;  3DO2 A;  3P7Q E;  3FH8 A;  1KL6 A;  4MS6 A;  2ZXG A;  4RSY A;  5FSS A;  3T2I E;  4XO5 A;  3B7T A;  5JVI E;  1GXW A;  4XMU A;  4XN8 A;  7TLN A;  4J3B A;  8TLN E;  3FH5 A;  3NN7 A;  3FUJ A;  3FUL A;  4ZX5 A;  4K90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...