3DBKA

Pseudomonas aeruginosa elastase with phosphoramidon
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Elastase of Pseudomonas aeruginosa Complexed with Phosphoramidon
rcsb
molecule tags Hydrolase
molecule keywords Elastase
total genus 112
structure length 298
sequence length 298
ec nomenclature ec 3.4.24.26: Pseudolysin.
pdb deposition date 2008-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3dbkA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3dbkA01
4K5LA 4XMUA 5LIFE 1FJVA 3B37A 3ZI6A 4B52A 1TLXA 5JXNE 3FLFA 3QH1A 3FTZA 3EIMA 4ZW8A 6TLIA 3FTVA 1LNEE 3DO1A 3EBHA 3FU5A 3T8GA 3T8FA 4PU2A 1HYTA 4XO3A 2ZXGA 1HS6A 4XN7A 1GXWA 4K89A 3KEDA 4D9WA 5FSSA 4XN8A 2G4ZA 3QGOA 3FGDA 3FCQA 5DPFE 1FJQA 1FJWA 1Y3GE 3B34A 4XNDA 5DPEE 4RSYA 4XMTA 4PVBA 4QMEA 5A3YA 3FV4A 1FJTA 1GW6A 3FXSA 3MSNA 4K5PA 4MZNE 4J3BA 4Q4EA 4D91A 1TLPE 4PW4A 3T87A 1PE5A 3T2JE 3TMNE 3F28A 1KJOA 5JSSE 1U4GA 4XO4A 5FSPA 3FUHA 1KTOA 2VQXA 3FHEA 4RVBA 4MTWE 3T8DA 4XN5A 3T2IE 2XPYA 4ZW6A 3P7VE 4N4EE 3N21A 5FXNA 2TLIA 4GERA 3FORA 4QIRA 4XMVA 5FSJA 3P7WE 4ZX5A 5AENA 4TLIA 2WI0A 4ZX3A 4TLNA 3FULA 5FWQA 5L41E 1LNAE 4N66E 1ZDPE 5TLIA 3CHRA 4H57A 3B3BA 3PUUA 3FU6A 5JT9E 3B7TA 3B2XA 1KR6A 1TLIA 1TMNE 3FH8A 3CHPA 3FVPA 4XN1A 1BQBA 1PE7A 3FB0A 5DLLA 3EBIA 5DYFA 4QPEA 1LNDE 5TMNE 1PE8A 1LNFE 3NN7A 3Q44A 3T8VA 1QF1A 4M65A 7TLNA 3B7UX 3FXPA 4XNAA 1FJOA 3FUMA 3P7RE 5JVIE 2WHZA 3DO0A 5HQDA 3FUIA 4L2LA 4K5MA 5L3UE 3T74A 2DQ6A 4R5XA 3FTXA 4R7LA 4MKTA 4K90A 4XN4A 1QF0A 1L3FE 3FUKA 3P7SE 3FH7A 3FBOA 4XMZA 4ZQTA 3NQXA 1QF2A 1KROA 3NQZB 3U9WA 5JS3E 4QUOA 8TLNE 4XO5A 4ZW5A 2HPTA 3F2PA 3NQYB 3FTYA 3CHSA 3P7PE 3MSFA 2A7GE 3QJXA 3FTUA 1KKKA 4K5NA 4XN9A 4Q4IA 3B7SA 3MSAA 1EZMA 1THLA 2DQMA 3P7TE 3T73A 7TLIA 2VJ8A 3B2PA 4K5OA 5LWDE 1KJPA 4ZX4A 3CIAA 4QHPA 1Z9GE 3FU3A 4N5PE 4R5VA 1SQMA 1KEIA 2XQ0A 3FUFA 4OI5E 3FH5A 3TLIA 4DPRA 4TNLA 3P7QE 2HPOA 5L8PE 3FUJA 6TMNE 4X2UA 1LNBE 4XMWA 3FTWA 3MS3A 3T8CA 4MS6A 1KL6A 3T2HE 1KS7A 3FUDA 5TLNA 5K7TA 3DO2A 3FUEA 4ZW7A 3QH5A 3EBGA 2TMNE 3B7RL 3DNZA 2GTQA 3FUNA 4ZW3A 2XPZA 3SSBA 3CHOA 3FU0A 3T8HA 5DLHA 3DBKA 5BPPA 4XN2A 1NPCA 1OS0A 3P7UE 3FTSA 1H19A 4XNBA 2R59A 4GAAA 4TMNE 1LNCE 4ZX6A 3Q43A 8TLIA 1ESPA 1FJ3A 4MXJE 1FJUA 2TLXA 3LS7A 1TRLA 4OW3A 4MWPE 3CHQA 4R5TA 4XMXA
chains in the Genus database with same CATH superfamily
4K5LA 4XMUA 5LIFE 1FJVA 3B37A 3ZI6A 4B52A 4E36A 1TLXA 4Z7IA 5JXNE 3FLFA 3QH1A 3FTZA 3EIMA 5CU5A 4ZW8A 6TLIA 3FTVA 1LNEE 3DO1A 3EBHA 3FU5A 3T8GA 3T8FA 4PU2A 1HYTA 4KX7A 5J6SA 4XO3A 2ZXGA 1HS6A 4XN7A 1GXWA 4K89A 3KEDA 4D9WA 5FSSA 4XN8A 4AR1A 2G4ZA 3QGOA 3FGDA 3FCQA 5DPFE 1FJQA 1FJWA 1Y3GE 3B34A 4FYRA 5DPEE 4XNDA 4RSYA 4XMTA 4PVBA 4QMEA 5A3YA 3FV4A 1FJTA 1GW6A 3FXSA 3MSNA 4K5PA 4MZNE 4J3BA 4Q4EA 4D91A 1TLPE 4KXCA 4PW4A 4JBSA 1PE5A 4NAQA 3T2JE 3F28A 1KJOA 3T87A 1U4GA 4XO4A 3TMNE 5FSPA 3FUHA 1KTOA 5JSSE 4IHQA 4AR9A 4KXAA 2VQXA 3FHEA 4RVBA 4MTWE 3T8DA 4FYTA 4XN5A 3SE6A 3T2IE 2XPYA 4ZW6A 4FKEA 3P7VE 4N4EE 3N21A 5FXNA 2TLIA 4GERA 3FORA 4OU3A 4QIRA 4XMVA 4NZ8A 4FGMA 5FSJA 3P7WE 4ZX5A 5AENA 4TLIA 4FCAA 4FKHA 3Q7JA 2WI0A 4ZX3A 4TLNA 3FULA 5FWQA 4KXBA 5L41E 1LNAE 4N66E 1ZDPE 5TLIA 3CHRA 4H57A 3B3BA 3PUUA 3MDJA 3FU6A 5JT9E 4KXDA 3B7TA 3B2XA 1KR6A 1TLIA 1TMNE 3FH8A 3CHPA 3FVPA 4XN1A 1BQBA 1PE7A 3FB0A 5DLLA 4PJ6A 3EBIA 5DYFA 4QPEA 1LNDE 5TMNE 1PE8A 5AB2A 1LNFE 3NN7A 3Q44A 3T8VA 1QF1A 4F5CA 4M65A 4AR8A 4FKKA 7TLNA 3B7UX 3FXPA 4XNAA 1FJOA 3FUMA 3P7RE 5JVIE 2WHZA 3DO0A 5HQDA 3FUIA 1Z5HA 4L2LA 4K5MA 5L3UE 3T74A 1LMLA 2DQ6A 4R5XA 3FTXA 4KX8A 4R7LA 4MKTA 4K90A 4XN4A 1QF0A 1L3FE 3FUKA 3P7SE 3FH7A 3FBOA 4XMZA 4ZQTA 3NQXA 1QF2A 1KROA 3NQZB 3U9WA 5JS3E 4QUOA 8TLNE 4XO5A 4ZW5A 2HPTA 3F2PA 3NQYB 3FTYA 4XN9A 3CHSA 3P7PE 3MSFA 2A7GE 3QJXA 3FTUA 1KKKA 4II7A 4K5NA 4Q4IA 3B7SA 3MSAA 1EZMA 1THLA 2DQMA 3P7TE 3T73A 4ARFA 7TLIA 3B2PA 2VJ8A 4K5OA 5LWDE 5LDSA 1KJPA 4ZX4A 3CIAA 4QHPA 1Z9GE 3FU3A 4N5PE 4R5VA 1SQMA 1KEIA 2XQ0A 3FUFA 4OI5E 3FH5A 3TLIA 4HOMA 5LHDA 4DPRA 4TNLA 3P7QE 5K1VA 2HPOA 5L8PE 3FUJA 5AB0A 6TMNE 3QNFA 1LNBE 4X2UA 4XMWA 3FTWA 3MS3A 3T8CA 4MS6A 1KL6A 3T2HE 1KS7A 3FUDA 5EV7A 5TLNA 3DO2A 3FUEA 5K7TA 4ZW7A 3QH5A 4WZ9A 3EBGA 2TMNE 3B7RL 3DNZA 2GTQA 3FUNA 4ZW3A 2XPZA 3SSBA 3CHOA 3FU0A 3T8HA 5DLHA 4FYSA 3DBKA 5BPPA 5C97A 4XN2A 1NPCA 1OS0A 4P8QA 5LG6A 3P7UE 3FTSA 4FYQA 1H19A 4XNBA 2R59A 4GAAA 4TMNE 1LNCE 4KX9A 4ZX6A 2YD0A 3Q43A 1Z1WA 1ESPA 8TLIA 1FJ3A 4MXJE 1FJUA 2TLXA 3LS7A 1TRLA 4OW3A 4MWPE 3CHQA 4R5TA 4XMXA
chains in the Genus database with same CATH topology
4K5LA 4XMUA 5LIFE 1FJVA 3B37A 3ZI6A 4B52A 1TLXA 5JXNE 3FLFA 3QH1A 3FTZA 3EIMA 4ZW8A 6TLIA 3FTVA 1LNEE 3DO1A 3EBHA 3FU5A 3T8GA 3T8FA 4PU2A 1HYTA 4XO3A 2ZXGA 1HS6A 4XN7A 1GXWA 4K89A 3KEDA 4D9WA 5FSSA 4XN8A 2G4ZA 3QGOA 3FGDA 3FCQA 5DPFE 1FJQA 1FJWA 1Y3GE 3B34A 4XNDA 5DPEE 4RSYA 4XMTA 4PVBA 4QMEA 5A3YA 3FV4A 1FJTA 1GW6A 3FXSA 3MSNA 4K5PA 4MZNE 4J3BA 4Q4EA 4D91A 1TLPE 4PW4A 3T87A 1PE5A 3T2JE 3TMNE 3F28A 1KJOA 5JSSE 1U4GA 4XO4A 5FSPA 3FUHA 1KTOA 2VQXA 3FHEA 4RVBA 4MTWE 3T8DA 4XN5A 3T2IE 2XPYA 4ZW6A 3P7VE 4N4EE 3N21A 5FXNA 2TLIA 4GERA 3FORA 4QIRA 4XMVA 5FSJA 3P7WE 4ZX5A 5AENA 4TLIA 2WI0A 4ZX3A 4TLNA 3FULA 5FWQA 5L41E 1LNAE 4N66E 1ZDPE 5TLIA 3CHRA 4H57A 3B3BA 3PUUA 3FU6A 5JT9E 3B7TA 3B2XA 1KR6A 1TLIA 1TMNE 3FH8A 3CHPA 3FVPA 4XN1A 1BQBA 1PE7A 3FB0A 5DLLA 3EBIA 5DYFA 4QPEA 1LNDE 5TMNE 1PE8A 1LNFE 3NN7A 3Q44A 3T8VA 1QF1A 4M65A 7TLNA 3B7UX 3FXPA 4XNAA 1FJOA 3FUMA 3P7RE 5JVIE 2WHZA 3DO0A 5HQDA 3FUIA 4L2LA 4K5MA 5L3UE 3T74A 1LMLA 2DQ6A 4R5XA 3FTXA 4R7LA 4MKTA 4K90A 4XN4A 1QF0A 1L3FE 3FUKA 3P7SE 3FH7A 3FBOA 4XMZA 4ZQTA 3NQXA 1QF2A 1KROA 3NQZB 3U9WA 5JS3E 4QUOA 8TLNE 4XO5A 4ZW5A 2HPTA 3F2PA 3NQYB 3FTYA 3CHSA 3P7PE 3MSFA 2A7GE 3QJXA 3FTUA 1KKKA 4K5NA 4XN9A 4Q4IA 3B7SA 3MSAA 1EZMA 1THLA 2DQMA 3P7TE 3T73A 7TLIA 2VJ8A 3B2PA 4K5OA 5LWDE 1KJPA 4ZX4A 3CIAA 4QHPA 1Z9GE 3FU3A 4N5PE 4R5VA 1SQMA 1KEIA 2XQ0A 3FUFA 4OI5E 3FH5A 3TLIA 4DPRA 4TNLA 3P7QE 2HPOA 5L8PE 3FUJA 6TMNE 4X2UA 1LNBE 4XMWA 3FTWA 3MS3A 3T8CA 4MS6A 1KL6A 3T2HE 1KS7A 3FUDA 5TLNA 5K7TA 3DO2A 3FUEA 4ZW7A 3QH5A 3EBGA 2TMNE 3B7RL 3DNZA 2GTQA 3FUNA 4ZW3A 2XPZA 3SSBA 3CHOA 3FU0A 3T8HA 5DLHA 3DBKA 5BPPA 4XN2A 1NPCA 1OS0A 3P7UE 3FTSA 1H19A 4XNBA 2R59A 4GAAA 4TMNE 1LNCE 4ZX6A 3Q43A 8TLIA 1ESPA 1FJ3A 4MXJE 1FJUA 2TLXA 3LS7A 1TRLA 4OW3A 4MWPE 3CHQA 4R5TA 4XMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5L A;  4XMU A;  5LIF E;  1FJV A;  3B37 A;  3ZI6 A;  4B52 A;  1TLX A;  5JXN E;  3FLF A;  3QH1 A;  3FTZ A;  3EIM A;  4ZW8 A;  6TLI A;  3FTV A;  1LNE E;  3DO1 A;  3EBH A;  3FU5 A;  3T8G A;  3T8F A;  4PU2 A;  1HYT A;  4XO3 A;  2ZXG A;  1HS6 A;  4XN7 A;  1GXW A;  4K89 A;  3KED A;  4D9W A;  5FSS A;  4XN8 A;  2G4Z A;  3QGO A;  3FGD A;  3FCQ A;  5DPF E;  1FJQ A;  1FJW A;  1Y3G E;  3B34 A;  4XND A;  5DPE E;  4RSY A;  4XMT A;  4PVB A;  4QME A;  5A3Y A;  3FV4 A;  1FJT A;  1GW6 A;  3FXS A;  3MSN A;  4K5P A;  4MZN E;  4J3B A;  4Q4E A;  4D91 A;  1TLP E;  4PW4 A;  3T87 A;  1PE5 A;  3T2J E;  3TMN E;  3F28 A;  1KJO A;  5JSS E;  1U4G A;  4XO4 A;  5FSP A;  3FUH A;  1KTO A;  2VQX A;  3FHE A;  4RVB A;  4MTW E;  3T8D A;  4XN5 A;  3T2I E;  2XPY A;  4ZW6 A;  3P7V E;  4N4E E;  3N21 A;  5FXN A;  2TLI A;  4GER A;  3FOR A;  4QIR A;  4XMV A;  5FSJ A;  3P7W E;  4ZX5 A;  5AEN A;  4TLI A;  2WI0 A;  4ZX3 A;  4TLN A;  3FUL A;  5FWQ A;  5L41 E;  1LNA E;  4N66 E;  1ZDP E;  5TLI A;  3CHR A;  4H57 A;  3B3B A;  3PUU A;  3FU6 A;  5JT9 E;  3B7T A;  3B2X A;  1KR6 A;  1TLI A;  1TMN E;  3FH8 A;  3CHP A;  3FVP A;  4XN1 A;  1BQB A;  1PE7 A;  3FB0 A;  5DLL A;  3EBI A;  5DYF A;  4QPE A;  1LND E;  5TMN E;  1PE8 A;  1LNF E;  3NN7 A;  3Q44 A;  3T8V A;  1QF1 A;  4M65 A;  7TLN A;  3B7U X;  3FXP A;  4XNA A;  1FJO A;  3FUM A;  3P7R E;  5JVI E;  2WHZ A;  3DO0 A;  5HQD A;  3FUI A;  4L2L A;  4K5M A;  5L3U E;  3T74 A;  2DQ6 A;  4R5X A;  3FTX A;  4R7L A;  4MKT A;  4K90 A;  4XN4 A;  1QF0 A;  1L3F E;  3FUK A;  3P7S E;  3FH7 A;  3FBO A;  4XMZ A;  4ZQT A;  3NQX A;  1QF2 A;  1KRO A;  3NQZ B;  3U9W A;  5JS3 E;  4QUO A;  8TLN E;  4XO5 A;  4ZW5 A;  2HPT A;  3F2P A;  3NQY B;  3FTY A;  3CHS A;  3P7P E;  3MSF A;  2A7G E;  3QJX A;  3FTU A;  1KKK A;  4K5N A;  4XN9 A;  4Q4I A;  3B7S A;  3MSA A;  1EZM A;  1THL A;  2DQM A;  3P7T E;  3T73 A;  7TLI A;  2VJ8 A;  3B2P A;  4K5O A;  5LWD E;  1KJP A;  4ZX4 A;  3CIA A;  4QHP A;  1Z9G E;  3FU3 A;  4N5P E;  4R5V A;  1SQM A;  1KEI A;  2XQ0 A;  3FUF A;  4OI5 E;  3FH5 A;  3TLI A;  4DPR A;  4TNL A;  3P7Q E;  2HPO A;  5L8P E;  3FUJ A;  6TMN E;  4X2U A;  1LNB E;  4XMW A;  3FTW A;  3MS3 A;  3T8C A;  4MS6 A;  1KL6 A;  3T2H E;  1KS7 A;  3FUD A;  5TLN A;  5K7T A;  3DO2 A;  3FUE A;  4ZW7 A;  3QH5 A;  3EBG A;  2TMN E;  3B7R L;  3DNZ A;  2GTQ A;  3FUN A;  4ZW3 A;  2XPZ A;  3SSB A;  3CHO A;  3FU0 A;  3T8H A;  5DLH A;  3DBK A;  5BPP A;  4XN2 A;  1NPC A;  1OS0 A;  3P7U E;  3FTS A;  1H19 A;  4XNB A;  2R59 A;  4GAA A;  4TMN E;  1LNC E;  4ZX6 A;  3Q43 A;  8TLI A;  1ESP A;  1FJ3 A;  4MXJ E;  1FJU A;  2TLX A;  3LS7 A;  1TRL A;  4OW3 A;  4MWP E;  3CHQ A;  4R5T A;  4XMX A; 
#chains in the Genus database with same CATH topology
 4K5L A;  4XMU A;  5LIF E;  1FJV A;  3B37 A;  3ZI6 A;  4B52 A;  4E36 A;  1TLX A;  4Z7I A;  5JXN E;  3FLF A;  3QH1 A;  3FTZ A;  3EIM A;  5CU5 A;  4ZW8 A;  6TLI A;  3FTV A;  1LNE E;  3DO1 A;  3EBH A;  3FU5 A;  3T8G A;  3T8F A;  4PU2 A;  1HYT A;  4KX7 A;  5J6S A;  4XO3 A;  2ZXG A;  1HS6 A;  4XN7 A;  1GXW A;  4K89 A;  3KED A;  4D9W A;  5FSS A;  4XN8 A;  4AR1 A;  2G4Z A;  3QGO A;  3FGD A;  3FCQ A;  5DPF E;  1FJQ A;  1FJW A;  1Y3G E;  3B34 A;  4FYR A;  5DPE E;  4XND A;  4RSY A;  4XMT A;  4PVB A;  4QME A;  5A3Y A;  3FV4 A;  1FJT A;  1GW6 A;  3FXS A;  3MSN A;  4K5P A;  4MZN E;  4J3B A;  4Q4E A;  4D91 A;  1TLP E;  4KXC A;  4PW4 A;  4JBS A;  1PE5 A;  4NAQ A;  3T2J E;  3F28 A;  1KJO A;  3T87 A;  1U4G A;  4XO4 A;  3TMN E;  5FSP A;  3FUH A;  1KTO A;  5JSS E;  4IHQ A;  4AR9 A;  4KXA A;  2VQX A;  3FHE A;  4RVB A;  4MTW E;  3T8D A;  4FYT A;  4XN5 A;  3SE6 A;  3T2I E;  2XPY A;  4ZW6 A;  4FKE A;  3P7V E;  4N4E E;  3N21 A;  5FXN A;  2TLI A;  4GER A;  3FOR A;  4OU3 A;  4QIR A;  4XMV A;  4NZ8 A;  4FGM A;  5FSJ A;  3P7W E;  4ZX5 A;  5AEN A;  4TLI A;  4FCA A;  4FKH A;  3Q7J A;  2WI0 A;  4ZX3 A;  4TLN A;  3FUL A;  5FWQ A;  4KXB A;  5L41 E;  1LNA E;  4N66 E;  1ZDP E;  5TLI A;  3CHR A;  4H57 A;  3B3B A;  3PUU A;  3MDJ A;  3FU6 A;  5JT9 E;  4KXD A;  3B7T A;  3B2X A;  1KR6 A;  1TLI A;  1TMN E;  3FH8 A;  3CHP A;  3FVP A;  4XN1 A;  1BQB A;  1PE7 A;  3FB0 A;  5DLL A;  4PJ6 A;  3EBI A;  5DYF A;  4QPE A;  1LND E;  5TMN E;  1PE8 A;  5AB2 A;  1LNF E;  3NN7 A;  3Q44 A;  3T8V A;  1QF1 A;  4F5C A;  4M65 A;  4AR8 A;  4FKK A;  7TLN A;  3B7U X;  3FXP A;  4XNA A;  1FJO A;  3FUM A;  3P7R E;  5JVI E;  2WHZ A;  3DO0 A;  5HQD A;  3FUI A;  1Z5H A;  4L2L A;  4K5M A;  5L3U E;  3T74 A;  1LML A;  2DQ6 A;  4R5X A;  3FTX A;  4KX8 A;  4R7L A;  4MKT A;  4K90 A;  4XN4 A;  1QF0 A;  1L3F E;  3FUK A;  3P7S E;  3FH7 A;  3FBO A;  4XMZ A;  4ZQT A;  3NQX A;  1QF2 A;  1KRO A;  3NQZ B;  3U9W A;  5JS3 E;  4QUO A;  8TLN E;  4XO5 A;  4ZW5 A;  2HPT A;  3F2P A;  3NQY B;  3FTY A;  4XN9 A;  3CHS A;  3P7P E;  3MSF A;  2A7G E;  3QJX A;  3FTU A;  1KKK A;  4II7 A;  4K5N A;  4Q4I A;  3B7S A;  3MSA A;  1EZM A;  1THL A;  2DQM A;  3P7T E;  3T73 A;  4ARF A;  7TLI A;  3B2P A;  2VJ8 A;  4K5O A;  5LWD E;  5LDS A;  1KJP A;  4ZX4 A;  3CIA A;  4QHP A;  1Z9G E;  3FU3 A;  4N5P E;  4R5V A;  1SQM A;  1KEI A;  2XQ0 A;  3FUF A;  4OI5 E;  3FH5 A;  3TLI A;  4HOM A;  5LHD A;  4DPR A;  4TNL A;  3P7Q E;  5K1V A;  2HPO A;  5L8P E;  3FUJ A;  5AB0 A;  6TMN E;  3QNF A;  1LNB E;  4X2U A;  4XMW A;  3FTW A;  3MS3 A;  3T8C A;  4MS6 A;  1KL6 A;  3T2H E;  1KS7 A;  3FUD A;  5EV7 A;  5TLN A;  3DO2 A;  3FUE A;  5K7T A;  4ZW7 A;  3QH5 A;  4WZ9 A;  3EBG A;  2TMN E;  3B7R L;  3DNZ A;  2GTQ A;  3FUN A;  4ZW3 A;  2XPZ A;  3SSB A;  3CHO A;  3FU0 A;  3T8H A;  5DLH A;  4FYS A;  3DBK A;  5BPP A;  5C97 A;  4XN2 A;  1NPC A;  1OS0 A;  4P8Q A;  5LG6 A;  3P7U E;  3FTS A;  4FYQ A;  1H19 A;  4XNB A;  2R59 A;  4GAA A;  4TMN E;  1LNC E;  4KX9 A;  4ZX6 A;  2YD0 A;  3Q43 A;  1Z1W A;  1ESP A;  8TLI A;  1FJ3 A;  4MXJ E;  1FJU A;  2TLX A;  3LS7 A;  1TRL A;  4OW3 A;  4MWP E;  3CHQ A;  4R5T A;  4XMX A; 
#chains in the Genus database with same CATH homology
 4K5L A;  4XMU A;  5LIF E;  1FJV A;  3B37 A;  3ZI6 A;  4B52 A;  1TLX A;  5JXN E;  3FLF A;  3QH1 A;  3FTZ A;  3EIM A;  4ZW8 A;  6TLI A;  3FTV A;  1LNE E;  3DO1 A;  3EBH A;  3FU5 A;  3T8G A;  3T8F A;  4PU2 A;  1HYT A;  4XO3 A;  2ZXG A;  1HS6 A;  4XN7 A;  1GXW A;  4K89 A;  3KED A;  4D9W A;  5FSS A;  4XN8 A;  2G4Z A;  3QGO A;  3FGD A;  3FCQ A;  5DPF E;  1FJQ A;  1FJW A;  1Y3G E;  3B34 A;  4XND A;  5DPE E;  4RSY A;  4XMT A;  4PVB A;  4QME A;  5A3Y A;  3FV4 A;  1FJT A;  1GW6 A;  3FXS A;  3MSN A;  4K5P A;  4MZN E;  4J3B A;  4Q4E A;  4D91 A;  1TLP E;  4PW4 A;  3T87 A;  1PE5 A;  3T2J E;  3TMN E;  3F28 A;  1KJO A;  5JSS E;  1U4G A;  4XO4 A;  5FSP A;  3FUH A;  1KTO A;  2VQX A;  3FHE A;  4RVB A;  4MTW E;  3T8D A;  4XN5 A;  3T2I E;  2XPY A;  4ZW6 A;  3P7V E;  4N4E E;  3N21 A;  5FXN A;  2TLI A;  4GER A;  3FOR A;  4QIR A;  4XMV A;  5FSJ A;  3P7W E;  4ZX5 A;  5AEN A;  4TLI A;  2WI0 A;  4ZX3 A;  4TLN A;  3FUL A;  5FWQ A;  5L41 E;  1LNA E;  4N66 E;  1ZDP E;  5TLI A;  3CHR A;  4H57 A;  3B3B A;  3PUU A;  3FU6 A;  5JT9 E;  3B7T A;  3B2X A;  1KR6 A;  1TLI A;  1TMN E;  3FH8 A;  3CHP A;  3FVP A;  4XN1 A;  1BQB A;  1PE7 A;  3FB0 A;  5DLL A;  3EBI A;  5DYF A;  4QPE A;  1LND E;  5TMN E;  1PE8 A;  1LNF E;  3NN7 A;  3Q44 A;  3T8V A;  1QF1 A;  4M65 A;  7TLN A;  3B7U X;  3FXP A;  4XNA A;  1FJO A;  3FUM A;  3P7R E;  5JVI E;  2WHZ A;  3DO0 A;  5HQD A;  3FUI A;  4L2L A;  4K5M A;  5L3U E;  3T74 A;  1LML A;  2DQ6 A;  4R5X A;  3FTX A;  4R7L A;  4MKT A;  4K90 A;  4XN4 A;  1QF0 A;  1L3F E;  3FUK A;  3P7S E;  3FH7 A;  3FBO A;  4XMZ A;  4ZQT A;  3NQX A;  1QF2 A;  1KRO A;  3NQZ B;  3U9W A;  5JS3 E;  4QUO A;  8TLN E;  4XO5 A;  4ZW5 A;  2HPT A;  3F2P A;  3NQY B;  3FTY A;  3CHS A;  3P7P E;  3MSF A;  2A7G E;  3QJX A;  3FTU A;  1KKK A;  4K5N A;  4XN9 A;  4Q4I A;  3B7S A;  3MSA A;  1EZM A;  1THL A;  2DQM A;  3P7T E;  3T73 A;  7TLI A;  2VJ8 A;  3B2P A;  4K5O A;  5LWD E;  1KJP A;  4ZX4 A;  3CIA A;  4QHP A;  1Z9G E;  3FU3 A;  4N5P E;  4R5V A;  1SQM A;  1KEI A;  2XQ0 A;  3FUF A;  4OI5 E;  3FH5 A;  3TLI A;  4DPR A;  4TNL A;  3P7Q E;  2HPO A;  5L8P E;  3FUJ A;  6TMN E;  4X2U A;  1LNB E;  4XMW A;  3FTW A;  3MS3 A;  3T8C A;  4MS6 A;  1KL6 A;  3T2H E;  1KS7 A;  3FUD A;  5TLN A;  5K7T A;  3DO2 A;  3FUE A;  4ZW7 A;  3QH5 A;  3EBG A;  2TMN E;  3B7R L;  3DNZ A;  2GTQ A;  3FUN A;  4ZW3 A;  2XPZ A;  3SSB A;  3CHO A;  3FU0 A;  3T8H A;  5DLH A;  3DBK A;  5BPP A;  4XN2 A;  1NPC A;  1OS0 A;  3P7U E;  3FTS A;  1H19 A;  4XNB A;  2R59 A;  4GAA A;  4TMN E;  1LNC E;  4ZX6 A;  3Q43 A;  8TLI A;  1ESP A;  1FJ3 A;  4MXJ E;  1FJU A;  2TLX A;  3LS7 A;  1TRL A;  4OW3 A;  4MWP E;  3CHQ A;  4R5T A;  4XMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...