3DBKA

Pseudomonas aeruginosa elastase with phosphoramidon
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Elastase of Pseudomonas aeruginosa Complexed with Phosphoramidon
rcsb
molecule tags Hydrolase
molecule keywords Elastase
total genus 112
structure length 298
sequence length 298
ec nomenclature ec 3.4.24.26: Pseudolysin.
pdb deposition date 2008-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3dbkA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3dbkA01
3FLFA 3CHPA 2ZXGA 4J3BA 1QF0A 3T2JE 3FTUA 3T8FA 5HQDA 3N21A 1QF1A 3CHRA 3FVPA 7TLNA 4MKTA 5DPFE 3FTWA 4TMNE 6TLIA 4OW3A 1PE5A 3T74A 3Q44A 2XPYA 4XO3A 5L41E 3FGDA 3B3BA 3FORA 3MSAA 4R7LA 4ZW6A 4RSYA 4RVBA 3FXPA 1GW6A 4GAAA 5FXNA 1HYTA 3Q43A 2R59A 5BPPA 3F2PA 5FSJA 1KKKA 5FSPA 2VJ8A 4N5PE 4XN2A 4PW4A 1KL6A 3T2HE 3FH7A 3NQZB 3PUUA 4ZX6A 1KTOA 3NQYB 4H57A 3QH1A 1KEIA 4ZX4A 3EBIA 1KJPA 4XNBA 5L3UE 2HPTA 3P7VE 5DLHA 4XO5A 4XMWA 3P7SE 4ZW8A 4ZQTA 1FJVA 4D91A 1SQMA 1EZMA 1LNEE 3FCQA 3FTVA 4K5OA 1BQBA 4XMUA 4XN1A 1FJWA 3FUIA 3EIMA 5JS3E 1TLIA 3FUFA 1KJOA 4TLNA 3NQXA 4MZNE 5L8PE 4XNAA 4QMEA 3MSFA 3TMNE 4XMZA 3FBOA 4X2UA 1Y3GE 1L3FE 3FUJA 3T8VA 4MTWE 3T73A 3FTXA 1QF2A 3QGOA 4XO4A 3FUNA 3B37A 3DO0A 5TMNE 5K7TA 4ZX5A 1LNAE 1KR6A 3FUDA 5FWQA 3B7SA 4K90A 4XMVA 5TLNA 3T8GA 5LWDE 1GXWA 5JSSE 1FJQA 3P7QE 1LNBE 4M65A 4QHPA 8TLIA 4K5NA 3T8DA 1LNCE 5DYFA 3CIAA 3FU5A 4L2LA 3FUHA 4QIRA 4ZW5A 4XN9A 3DBKA 1LNFE 2DQ6A 5FSSA 6TMNE 4QUOA 4ZX3A 1Z9GE 5TLIA 3T8CA 1TMNE 3P7WE 3F28A 3NN7A 4XN7A 3TLIA 1ESPA 3DO1A 1NPCA 4QPEA 3T8HA 1KROA 4DPRA 2TMNE 3DO2A 1PE7A 5JXNE 3FUKA 2TLIA 4K5PA 3DNZA 3U9WA 4ZW3A 1TLPE 1FJOA 2A7GE 2WHZA 3LS7A 3P7RE 3QJXA 4Q4EA 2TLXA 4PU2A 4XN8A 3T87A 2VQXA 1LNDE 3P7TE 1FJUA 2XQ0A 3B7UX 5JVIE 8TLNE 4N66E 3FV4A 2G4ZA 5JT9E 2DQMA 3EBGA 3FB0A 4R5TA 4XNDA 4ZW7A 1ZDPE 4MWPE 3EBHA 3CHQA 3FU0A 4OI5E 3FUMA 5DPEE 1FJTA 1H19A 4D9WA 1TLXA 3FU3A 3FH8A 4GERA 1PE8A 3FTZA 2HPOA 3MSNA 3T2IE 4PVBA 4MXJE 4K5LA 3MS3A 5A3YA 3B2XA 3FU6A 3FUEA 3P7UE 3KEDA 4N4EE 4B52A 5AENA 3B7RL 4MS6A 4R5VA 4XN5A 2GTQA 3CHOA 3SSBA 7TLIA 4K5MA 3ZI6A 1TRLA 3B34A 4XMXA 4R5XA 3P7PE 4XN4A 3FXSA 2XPZA 1KS7A 1U4GA 4TNLA 3FH5A 1OS0A 1HS6A 4XMTA 5DLLA 3QH5A 4K89A 3FULA 3FHEA 4TLIA 4Q4IA 3B2PA 3B7TA 1FJ3A 1THLA 3FTSA 5LIFE 2WI0A 3CHSA 3FTYA
chains in the Genus database with same CATH superfamily
3FLFA 3CHPA 2ZXGA 4J3BA 1QF0A 3T2JE 3FTUA 3T8FA 5AENA 3N21A 1QF1A 3CHRA 3FVPA 4KX7A 7TLNA 5HQDA 5LG6A 4MKTA 5DPFE 3FTWA 4FKHA 4TMNE 6TLIA 4OW3A 1PE5A 4P8QA 3T74A 3Q44A 2XPYA 4XO3A 4ARFA 3FGDA 3B3BA 3FORA 3MSAA 4R7LA 4ZW6A 5L41E 4RSYA 4RVBA 3FXPA 1GW6A 4GAAA 5FXNA 1HYTA 3Q43A 2R59A 2YD0A 5BPPA 3F2PA 5AB2A 5FSJA 1KKKA 5FSPA 2VJ8A 5LHDA 4N5PE 4XN2A 4PW4A 1KL6A 4FYQA 3T2HE 3FH7A 3NQZB 3PUUA 4ZX6A 4Z7IA 1KTOA 3NQYB 4H57A 3QH1A 1KEIA 4ZX4A 3EBIA 1KJPA 4XNBA 5L3UE 5CU5A 2HPTA 4NAQA 3P7VE 5DLHA 4XO5A 4XMWA 3P7SE 4ZW8A 4ZQTA 1FJVA 4FKEA 1SQMA 4D91A 1EZMA 1LNEE 3FCQA 3FTVA 4K5OA 1BQBA 4XMUA 4AR1A 1LMLA 4XN1A 4FYRA 1FJWA 3FUIA 3EIMA 5JS3E 1TLIA 3FUFA 1KJOA 4TLNA 3NQXA 4MZNE 5J6SA 4XNAA 4QMEA 5L8PE 3MSFA 3TMNE 4KXCA 4XMZA 3FBOA 4X2UA 1Y3GE 3MDJA 3FUJA 1L3FE 3T8VA 4II7A 4MTWE 3T73A 3FTXA 1QF2A 3QGOA 4XO4A 3FUNA 3B37A 3DO0A 5TMNE 5K7TA 4ZX5A 1LNAE 1KR6A 3FUDA 5FWQA 3B7SA 4K90A 4XMVA 5TLNA 5K1VA 3T8GA 1GXWA 4E36A 5JSSE 1FJQA 3P7QE 5LWDE 1LNBE 4M65A 1Z1WA 4FCAA 4QHPA 4K5NA 8TLIA 3T8DA 1LNCE 5DYFA 4AR9A 3CIAA 3FU5A 4L2LA 3FUHA 4QIRA 4F5CA 5C97A 4ZW5A 4XN9A 3DBKA 1LNFE 2DQ6A 5FSSA 6TMNE 4QUOA 4ZX3A 5LDSA 1Z9GE 5TLIA 3T8CA 1TMNE 3P7WE 3F28A 3NN7A 4XN7A 3TLIA 1ESPA 3DO1A 3QNFA 1NPCA 4QPEA 4FYTA 1KROA 3T8HA 3SE6A 2TMNE 3DO2A 1PE7A 4DPRA 4HOMA 3FUKA 5AB0A 2TLIA 4K5PA 3DNZA 3U9WA 4ZW3A 5JXNE 4OU3A 1TLPE 1FJOA 2A7GE 2WHZA 3LS7A 3P7RE 3QJXA 4Q4EA 2TLXA 4PU2A 4XN8A 3T87A 5EV7A 2VQXA 1LNDE 3P7TE 1FJUA 2XQ0A 3B7UX 4KXBA 4KX8A 8TLNE 5JVIE 4N66E 3FV4A 2G4ZA 5JT9E 2DQMA 4KXDA 4PJ6A 3EBGA 3FB0A 4IHQA 4R5TA 4XNDA 4ZW7A 1ZDPE 4MWPE 3EBHA 3CHQA 3FU0A 4FKKA 3FUMA 4OI5E 4NZ8A 5DPEE 1FJTA 1H19A 4D9WA 1TLXA 3FU3A 3FH8A 4GERA 1PE8A 3FTZA 2HPOA 3MSNA 4KXAA 3T2IE 4PVBA 4MXJE 4K5LA 3MS3A 5A3YA 3B2XA 3FU6A 1Z5HA 3FUEA 3P7UE 3KEDA 4JBSA 4N4EE 4B52A 3B7RL 4MS6A 4R5VA 4XN5A 2GTQA 3CHOA 3SSBA 7TLIA 4K5MA 3ZI6A 1TRLA 3B34A 4XMXA 4KX9A 4R5XA 4WZ9A 3P7PE 4XN4A 3FXSA 2XPZA 1KS7A 1U4GA 4TNLA 3FH5A 1OS0A 1HS6A 4XMTA 5DLLA 3QH5A 4K89A 3FULA 4FYSA 3FHEA 4TLIA 4Q4IA 3B2PA 4AR8A 4FGMA 3B7TA 1FJ3A 1THLA 3FTSA 5LIFE 2WI0A 3CHSA 3FTYA 3Q7JA
chains in the Genus database with same CATH topology
3FLFA 3CHPA 2ZXGA 4J3BA 1QF0A 3T2JE 3FTUA 3T8FA 5HQDA 3N21A 1QF1A 3CHRA 3FVPA 7TLNA 4MKTA 5DPFE 3FTWA 4TMNE 6TLIA 4OW3A 1PE5A 3T74A 3Q44A 2XPYA 4XO3A 5L41E 3FGDA 3B3BA 3FORA 3MSAA 4R7LA 4ZW6A 4RSYA 4RVBA 3FXPA 1GW6A 4GAAA 5FXNA 1HYTA 3Q43A 2R59A 5BPPA 3F2PA 5FSJA 1KKKA 5FSPA 2VJ8A 4N5PE 4XN2A 4PW4A 1KL6A 3T2HE 3FH7A 3NQZB 3PUUA 4ZX6A 1KTOA 3NQYB 4H57A 3QH1A 1KEIA 4ZX4A 3EBIA 1KJPA 4XNBA 5L3UE 2HPTA 3P7VE 5DLHA 4XO5A 4XMWA 3P7SE 4ZW8A 4ZQTA 1FJVA 4D91A 1SQMA 1EZMA 1LNEE 3FCQA 3FTVA 4K5OA 1BQBA 4XMUA 1LMLA 4XN1A 1FJWA 3FUIA 3EIMA 5JS3E 1TLIA 3FUFA 1KJOA 4TLNA 3NQXA 4MZNE 5L8PE 4XNAA 4QMEA 3MSFA 3TMNE 4XMZA 3FBOA 4X2UA 1Y3GE 1L3FE 3FUJA 3T8VA 4MTWE 3T73A 3FTXA 1QF2A 3QGOA 4XO4A 3FUNA 3B37A 3DO0A 5TMNE 5K7TA 4ZX5A 1LNAE 1KR6A 3FUDA 5FWQA 3B7SA 4K90A 4XMVA 5TLNA 3T8GA 5LWDE 1GXWA 5JSSE 1FJQA 3P7QE 1LNBE 4M65A 4QHPA 8TLIA 4K5NA 3T8DA 1LNCE 5DYFA 3CIAA 3FU5A 4L2LA 3FUHA 4QIRA 4ZW5A 4XN9A 3DBKA 1LNFE 2DQ6A 5FSSA 6TMNE 4QUOA 4ZX3A 1Z9GE 5TLIA 3T8CA 1TMNE 3P7WE 3F28A 3NN7A 4XN7A 3TLIA 1ESPA 3DO1A 1NPCA 4QPEA 3T8HA 1KROA 4DPRA 2TMNE 3DO2A 1PE7A 5JXNE 3FUKA 2TLIA 4K5PA 3DNZA 3U9WA 4ZW3A 1TLPE 1FJOA 2A7GE 2WHZA 3LS7A 3P7RE 3QJXA 4Q4EA 2TLXA 4PU2A 4XN8A 3T87A 2VQXA 1LNDE 3P7TE 1FJUA 2XQ0A 3B7UX 5JVIE 8TLNE 4N66E 3FV4A 2G4ZA 5JT9E 2DQMA 3EBGA 3FB0A 4R5TA 4XNDA 4ZW7A 1ZDPE 4MWPE 3EBHA 3CHQA 3FU0A 4OI5E 3FUMA 5DPEE 1FJTA 1H19A 4D9WA 1TLXA 3FU3A 3FH8A 4GERA 1PE8A 3FTZA 2HPOA 3MSNA 3T2IE 4PVBA 4MXJE 4K5LA 3MS3A 5A3YA 3B2XA 3FU6A 3FUEA 3P7UE 3KEDA 4N4EE 4B52A 5AENA 3B7RL 4MS6A 4R5VA 4XN5A 2GTQA 3CHOA 3SSBA 7TLIA 4K5MA 3ZI6A 1TRLA 3B34A 4XMXA 4R5XA 3P7PE 4XN4A 3FXSA 2XPZA 1KS7A 1U4GA 4TNLA 3FH5A 1OS0A 1HS6A 4XMTA 5DLLA 3QH5A 4K89A 3FULA 3FHEA 4TLIA 4Q4IA 3B2PA 3B7TA 1FJ3A 1THLA 3FTSA 5LIFE 2WI0A 3CHSA 3FTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FLF A;  3CHP A;  2ZXG A;  4J3B A;  1QF0 A;  3T2J E;  3FTU A;  3T8F A;  5HQD A;  3N21 A;  1QF1 A;  3CHR A;  3FVP A;  7TLN A;  4MKT A;  5DPF E;  3FTW A;  4TMN E;  6TLI A;  4OW3 A;  1PE5 A;  3T74 A;  3Q44 A;  2XPY A;  4XO3 A;  5L41 E;  3FGD A;  3B3B A;  3FOR A;  3MSA A;  4R7L A;  4ZW6 A;  4RSY A;  4RVB A;  3FXP A;  1GW6 A;  4GAA A;  5FXN A;  1HYT A;  3Q43 A;  2R59 A;  5BPP A;  3F2P A;  5FSJ A;  1KKK A;  5FSP A;  2VJ8 A;  4N5P E;  4XN2 A;  4PW4 A;  1KL6 A;  3T2H E;  3FH7 A;  3NQZ B;  3PUU A;  4ZX6 A;  1KTO A;  3NQY B;  4H57 A;  3QH1 A;  1KEI A;  4ZX4 A;  3EBI A;  1KJP A;  4XNB A;  5L3U E;  2HPT A;  3P7V E;  5DLH A;  4XO5 A;  4XMW A;  3P7S E;  4ZW8 A;  4ZQT A;  1FJV A;  4D91 A;  1SQM A;  1EZM A;  1LNE E;  3FCQ A;  3FTV A;  4K5O A;  1BQB A;  4XMU A;  4XN1 A;  1FJW A;  3FUI A;  3EIM A;  5JS3 E;  1TLI A;  3FUF A;  1KJO A;  4TLN A;  3NQX A;  4MZN E;  5L8P E;  4XNA A;  4QME A;  3MSF A;  3TMN E;  4XMZ A;  3FBO A;  4X2U A;  1Y3G E;  1L3F E;  3FUJ A;  3T8V A;  4MTW E;  3T73 A;  3FTX A;  1QF2 A;  3QGO A;  4XO4 A;  3FUN A;  3B37 A;  3DO0 A;  5TMN E;  5K7T A;  4ZX5 A;  1LNA E;  1KR6 A;  3FUD A;  5FWQ A;  3B7S A;  4K90 A;  4XMV A;  5TLN A;  3T8G A;  5LWD E;  1GXW A;  5JSS E;  1FJQ A;  3P7Q E;  1LNB E;  4M65 A;  4QHP A;  8TLI A;  4K5N A;  3T8D A;  1LNC E;  5DYF A;  3CIA A;  3FU5 A;  4L2L A;  3FUH A;  4QIR A;  4ZW5 A;  4XN9 A;  3DBK A;  1LNF E;  2DQ6 A;  5FSS A;  6TMN E;  4QUO A;  4ZX3 A;  1Z9G E;  5TLI A;  3T8C A;  1TMN E;  3P7W E;  3F28 A;  3NN7 A;  4XN7 A;  3TLI A;  1ESP A;  3DO1 A;  1NPC A;  4QPE A;  3T8H A;  1KRO A;  4DPR A;  2TMN E;  3DO2 A;  1PE7 A;  5JXN E;  3FUK A;  2TLI A;  4K5P A;  3DNZ A;  3U9W A;  4ZW3 A;  1TLP E;  1FJO A;  2A7G E;  2WHZ A;  3LS7 A;  3P7R E;  3QJX A;  4Q4E A;  2TLX A;  4PU2 A;  4XN8 A;  3T87 A;  2VQX A;  1LND E;  3P7T E;  1FJU A;  2XQ0 A;  3B7U X;  5JVI E;  8TLN E;  4N66 E;  3FV4 A;  2G4Z A;  5JT9 E;  2DQM A;  3EBG A;  3FB0 A;  4R5T A;  4XND A;  4ZW7 A;  1ZDP E;  4MWP E;  3EBH A;  3CHQ A;  3FU0 A;  4OI5 E;  3FUM A;  5DPE E;  1FJT A;  1H19 A;  4D9W A;  1TLX A;  3FU3 A;  3FH8 A;  4GER A;  1PE8 A;  3FTZ A;  2HPO A;  3MSN A;  3T2I E;  4PVB A;  4MXJ E;  4K5L A;  3MS3 A;  5A3Y A;  3B2X A;  3FU6 A;  3FUE A;  3P7U E;  3KED A;  4N4E E;  4B52 A;  5AEN A;  3B7R L;  4MS6 A;  4R5V A;  4XN5 A;  2GTQ A;  3CHO A;  3SSB A;  7TLI A;  4K5M A;  3ZI6 A;  1TRL A;  3B34 A;  4XMX A;  4R5X A;  3P7P E;  4XN4 A;  3FXS A;  2XPZ A;  1KS7 A;  1U4G A;  4TNL A;  3FH5 A;  1OS0 A;  1HS6 A;  4XMT A;  5DLL A;  3QH5 A;  4K89 A;  3FUL A;  3FHE A;  4TLI A;  4Q4I A;  3B2P A;  3B7T A;  1FJ3 A;  1THL A;  3FTS A;  5LIF E;  2WI0 A;  3CHS A;  3FTY A; 
#chains in the Genus database with same CATH topology
 3FLF A;  3CHP A;  2ZXG A;  4J3B A;  1QF0 A;  3T2J E;  3FTU A;  3T8F A;  5AEN A;  3N21 A;  1QF1 A;  3CHR A;  3FVP A;  4KX7 A;  7TLN A;  5HQD A;  5LG6 A;  4MKT A;  5DPF E;  3FTW A;  4FKH A;  4TMN E;  6TLI A;  4OW3 A;  1PE5 A;  4P8Q A;  3T74 A;  3Q44 A;  2XPY A;  4XO3 A;  4ARF A;  3FGD A;  3B3B A;  3FOR A;  3MSA A;  4R7L A;  4ZW6 A;  5L41 E;  4RSY A;  4RVB A;  3FXP A;  1GW6 A;  4GAA A;  5FXN A;  1HYT A;  3Q43 A;  2R59 A;  2YD0 A;  5BPP A;  3F2P A;  5AB2 A;  5FSJ A;  1KKK A;  5FSP A;  2VJ8 A;  5LHD A;  4N5P E;  4XN2 A;  4PW4 A;  1KL6 A;  4FYQ A;  3T2H E;  3FH7 A;  3NQZ B;  3PUU A;  4ZX6 A;  4Z7I A;  1KTO A;  3NQY B;  4H57 A;  3QH1 A;  1KEI A;  4ZX4 A;  3EBI A;  1KJP A;  4XNB A;  5L3U E;  5CU5 A;  2HPT A;  4NAQ A;  3P7V E;  5DLH A;  4XO5 A;  4XMW A;  3P7S E;  4ZW8 A;  4ZQT A;  1FJV A;  4FKE A;  1SQM A;  4D91 A;  1EZM A;  1LNE E;  3FCQ A;  3FTV A;  4K5O A;  1BQB A;  4XMU A;  4AR1 A;  1LML A;  4XN1 A;  4FYR A;  1FJW A;  3FUI A;  3EIM A;  5JS3 E;  1TLI A;  3FUF A;  1KJO A;  4TLN A;  3NQX A;  4MZN E;  5J6S A;  4XNA A;  4QME A;  5L8P E;  3MSF A;  3TMN E;  4KXC A;  4XMZ A;  3FBO A;  4X2U A;  1Y3G E;  3MDJ A;  3FUJ A;  1L3F E;  3T8V A;  4II7 A;  4MTW E;  3T73 A;  3FTX A;  1QF2 A;  3QGO A;  4XO4 A;  3FUN A;  3B37 A;  3DO0 A;  5TMN E;  5K7T A;  4ZX5 A;  1LNA E;  1KR6 A;  3FUD A;  5FWQ A;  3B7S A;  4K90 A;  4XMV A;  5TLN A;  5K1V A;  3T8G A;  1GXW A;  4E36 A;  5JSS E;  1FJQ A;  3P7Q E;  5LWD E;  1LNB E;  4M65 A;  1Z1W A;  4FCA A;  4QHP A;  4K5N A;  8TLI A;  3T8D A;  1LNC E;  5DYF A;  4AR9 A;  3CIA A;  3FU5 A;  4L2L A;  3FUH A;  4QIR A;  4F5C A;  5C97 A;  4ZW5 A;  4XN9 A;  3DBK A;  1LNF E;  2DQ6 A;  5FSS A;  6TMN E;  4QUO A;  4ZX3 A;  5LDS A;  1Z9G E;  5TLI A;  3T8C A;  1TMN E;  3P7W E;  3F28 A;  3NN7 A;  4XN7 A;  3TLI A;  1ESP A;  3DO1 A;  3QNF A;  1NPC A;  4QPE A;  4FYT A;  1KRO A;  3T8H A;  3SE6 A;  2TMN E;  3DO2 A;  1PE7 A;  4DPR A;  4HOM A;  3FUK A;  5AB0 A;  2TLI A;  4K5P A;  3DNZ A;  3U9W A;  4ZW3 A;  5JXN E;  4OU3 A;  1TLP E;  1FJO A;  2A7G E;  2WHZ A;  3LS7 A;  3P7R E;  3QJX A;  4Q4E A;  2TLX A;  4PU2 A;  4XN8 A;  3T87 A;  5EV7 A;  2VQX A;  1LND E;  3P7T E;  1FJU A;  2XQ0 A;  3B7U X;  4KXB A;  4KX8 A;  8TLN E;  5JVI E;  4N66 E;  3FV4 A;  2G4Z A;  5JT9 E;  2DQM A;  4KXD A;  4PJ6 A;  3EBG A;  3FB0 A;  4IHQ A;  4R5T A;  4XND A;  4ZW7 A;  1ZDP E;  4MWP E;  3EBH A;  3CHQ A;  3FU0 A;  4FKK A;  3FUM A;  4OI5 E;  4NZ8 A;  5DPE E;  1FJT A;  1H19 A;  4D9W A;  1TLX A;  3FU3 A;  3FH8 A;  4GER A;  1PE8 A;  3FTZ A;  2HPO A;  3MSN A;  4KXA A;  3T2I E;  4PVB A;  4MXJ E;  4K5L A;  3MS3 A;  5A3Y A;  3B2X A;  3FU6 A;  1Z5H A;  3FUE A;  3P7U E;  3KED A;  4JBS A;  4N4E E;  4B52 A;  3B7R L;  4MS6 A;  4R5V A;  4XN5 A;  2GTQ A;  3CHO A;  3SSB A;  7TLI A;  4K5M A;  3ZI6 A;  1TRL A;  3B34 A;  4XMX A;  4KX9 A;  4R5X A;  4WZ9 A;  3P7P E;  4XN4 A;  3FXS A;  2XPZ A;  1KS7 A;  1U4G A;  4TNL A;  3FH5 A;  1OS0 A;  1HS6 A;  4XMT A;  5DLL A;  3QH5 A;  4K89 A;  3FUL A;  4FYS A;  3FHE A;  4TLI A;  4Q4I A;  3B2P A;  4AR8 A;  4FGM A;  3B7T A;  1FJ3 A;  1THL A;  3FTS A;  5LIF E;  2WI0 A;  3CHS A;  3FTY A;  3Q7J A; 
#chains in the Genus database with same CATH homology
 3FLF A;  3CHP A;  2ZXG A;  4J3B A;  1QF0 A;  3T2J E;  3FTU A;  3T8F A;  5HQD A;  3N21 A;  1QF1 A;  3CHR A;  3FVP A;  7TLN A;  4MKT A;  5DPF E;  3FTW A;  4TMN E;  6TLI A;  4OW3 A;  1PE5 A;  3T74 A;  3Q44 A;  2XPY A;  4XO3 A;  5L41 E;  3FGD A;  3B3B A;  3FOR A;  3MSA A;  4R7L A;  4ZW6 A;  4RSY A;  4RVB A;  3FXP A;  1GW6 A;  4GAA A;  5FXN A;  1HYT A;  3Q43 A;  2R59 A;  5BPP A;  3F2P A;  5FSJ A;  1KKK A;  5FSP A;  2VJ8 A;  4N5P E;  4XN2 A;  4PW4 A;  1KL6 A;  3T2H E;  3FH7 A;  3NQZ B;  3PUU A;  4ZX6 A;  1KTO A;  3NQY B;  4H57 A;  3QH1 A;  1KEI A;  4ZX4 A;  3EBI A;  1KJP A;  4XNB A;  5L3U E;  2HPT A;  3P7V E;  5DLH A;  4XO5 A;  4XMW A;  3P7S E;  4ZW8 A;  4ZQT A;  1FJV A;  4D91 A;  1SQM A;  1EZM A;  1LNE E;  3FCQ A;  3FTV A;  4K5O A;  1BQB A;  4XMU A;  1LML A;  4XN1 A;  1FJW A;  3FUI A;  3EIM A;  5JS3 E;  1TLI A;  3FUF A;  1KJO A;  4TLN A;  3NQX A;  4MZN E;  5L8P E;  4XNA A;  4QME A;  3MSF A;  3TMN E;  4XMZ A;  3FBO A;  4X2U A;  1Y3G E;  1L3F E;  3FUJ A;  3T8V A;  4MTW E;  3T73 A;  3FTX A;  1QF2 A;  3QGO A;  4XO4 A;  3FUN A;  3B37 A;  3DO0 A;  5TMN E;  5K7T A;  4ZX5 A;  1LNA E;  1KR6 A;  3FUD A;  5FWQ A;  3B7S A;  4K90 A;  4XMV A;  5TLN A;  3T8G A;  5LWD E;  1GXW A;  5JSS E;  1FJQ A;  3P7Q E;  1LNB E;  4M65 A;  4QHP A;  8TLI A;  4K5N A;  3T8D A;  1LNC E;  5DYF A;  3CIA A;  3FU5 A;  4L2L A;  3FUH A;  4QIR A;  4ZW5 A;  4XN9 A;  3DBK A;  1LNF E;  2DQ6 A;  5FSS A;  6TMN E;  4QUO A;  4ZX3 A;  1Z9G E;  5TLI A;  3T8C A;  1TMN E;  3P7W E;  3F28 A;  3NN7 A;  4XN7 A;  3TLI A;  1ESP A;  3DO1 A;  1NPC A;  4QPE A;  3T8H A;  1KRO A;  4DPR A;  2TMN E;  3DO2 A;  1PE7 A;  5JXN E;  3FUK A;  2TLI A;  4K5P A;  3DNZ A;  3U9W A;  4ZW3 A;  1TLP E;  1FJO A;  2A7G E;  2WHZ A;  3LS7 A;  3P7R E;  3QJX A;  4Q4E A;  2TLX A;  4PU2 A;  4XN8 A;  3T87 A;  2VQX A;  1LND E;  3P7T E;  1FJU A;  2XQ0 A;  3B7U X;  5JVI E;  8TLN E;  4N66 E;  3FV4 A;  2G4Z A;  5JT9 E;  2DQM A;  3EBG A;  3FB0 A;  4R5T A;  4XND A;  4ZW7 A;  1ZDP E;  4MWP E;  3EBH A;  3CHQ A;  3FU0 A;  4OI5 E;  3FUM A;  5DPE E;  1FJT A;  1H19 A;  4D9W A;  1TLX A;  3FU3 A;  3FH8 A;  4GER A;  1PE8 A;  3FTZ A;  2HPO A;  3MSN A;  3T2I E;  4PVB A;  4MXJ E;  4K5L A;  3MS3 A;  5A3Y A;  3B2X A;  3FU6 A;  3FUE A;  3P7U E;  3KED A;  4N4E E;  4B52 A;  5AEN A;  3B7R L;  4MS6 A;  4R5V A;  4XN5 A;  2GTQ A;  3CHO A;  3SSB A;  7TLI A;  4K5M A;  3ZI6 A;  1TRL A;  3B34 A;  4XMX A;  4R5X A;  3P7P E;  4XN4 A;  3FXS A;  2XPZ A;  1KS7 A;  1U4G A;  4TNL A;  3FH5 A;  1OS0 A;  1HS6 A;  4XMT A;  5DLL A;  3QH5 A;  4K89 A;  3FUL A;  3FHE A;  4TLI A;  4Q4I A;  3B2P A;  3B7T A;  1FJ3 A;  1THL A;  3FTS A;  5LIF E;  2WI0 A;  3CHS A;  3FTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...