3DBKA

Pseudomonas aeruginosa elastase with phosphoramidon
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase
publication title Structure of the Elastase of Pseudomonas aeruginosa Complexed with Phosphoramidon
rcsb
molecule tags Hydrolase
total genus 112
structure length 298
sequence length 298
ec nomenclature ec 3.4.24.26: Pseudolysin.
pdb deposition date 2008-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3dbkA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3dbkA01
2HPOA 1QF0A 1BQBA 3T2IE 1KROA 3NN7A 3B34A 3P7SE 3KEDA 4XNBA 4ZW8A 3FTSA 2WI0A 3DO2A 3ZI6A 4L2LA 4XN5A 1FJVA 4K5MA 4TLIA 3MSNA 3DO1A 4XN4A 3T87A 1QF1A 5L3UE 4DPRA 3Q44A 4XN8A 5AENA 4TLNA 4XO4A 5FSJA 3MSAA 4TNLA 4Q4EA 5DLHA 2ZXGA 3FORA 4K90A 3FH5A 4Q4IA 3FTUA 3FH8A 3PUUA 3FU6A 3DNZA 2TLIA 4MS6A 5TLIA 4ZQTA 3FVPA 4K5NA 3QJXA 5LWDE 1FJUA 5K7TA 2XQ0A 3FLFA 4D9WA 4K89A 3FH7A 6TLIA 1TMNE 3B2PA 3CHOA 3P7WE 4K5LA 6TMNE 4XMVA 2DQMA 4MXJE 2HPTA 4GAAA 3T74A 4ZX4A 1FJTA 3FCQA 4QPEA 4XMWA 1LNFE 1U4GA 1PE8A 1QF2A 3FUKA 4R5XA 4ZW5A 2VJ8A 4PU2A 3FTWA 4RVBA 5JSSE 1KKKA 3FUDA 2XPZA 3DBKA 4TMNE 3FU5A 4XN1A 5TLNA 3FTYA 5TMNE 5HQDA 2WHZA 3T8FA 3DO0A 1TLXA 3CHRA 1LNAE 3FUEA 3FUIA 2R59A 4XO5A 4XN2A 3FTZA 5DPEE 2VQXA 3EBGA 3NQZB 4M65A 4XMZA 4X2UA 2GTQA 1L3FE 3P7UE 1GXWA 3B37A 4R5TA 4ZW6A 7TLNA 3MSFA 2XPYA 4XN7A 3FU0A 3B7UX 4QIRA 4QUOA 4ZX6A 4H57A 1PE7A 3B2XA 3B7TA 1TRLA 3P7TE 5DYFA 5FSSA 4XMXA 4R7LA 5L8PE 4K5PA 2A7GE 2DQ6A 5JXNE 5FWQA 3FU3A 3MS3A 3EBHA 4J3BA 3P7PE 4QHPA 1KJPA 1FJWA 1KR6A 3QH5A 3QGOA 3SSBA 1Z9GE 3Q43A 3F2PA 3CHSA 4PW4A 1KTOA 4ZX5A 1EZMA 1KEIA 5FSPA 4MKTA 3P7VE 3T2HE 4QMEA 4GERA 3N21A 4XN9A 3TMNE 4XNDA 4ZX3A 3LS7A 8TLIA 1LNDE 3T73A 5BPPA 3FGDA 3FBOA 3P7QE 1LNCE 3CIAA 4XO3A 3T8HA 4N5PE 5LIFE 1ESPA 4N4EE 4R5VA 3TLIA 5JVIE 1TLPE 4MTWE 1TLIA 4N66E 3T8CA 3FTVA 1FJOA 1Y3GE 1KS7A 3NQXA 3F28A 1H19A 3T2JE 1ZDPE 5A3YA 1THLA 3FUNA 1HYTA 3QH1A 4XMUA 4XNAA 3FTXA 1HS6A 3FUJA 3FULA 3FB0A 1GW6A 4MZNE 3B7RL 5JS3E 4PVBA 1LNBE 3CHPA 3FUHA 3B7SA 1NPCA 2TLXA 3FUMA 5L41E 4ZW3A 3T8DA 4MWPE 8TLNE 3NQYB 4K5OA 3FV4A 3FXSA 5DPFE 1PE5A 1OS0A 4ZW7A 3T8GA 4RSYA 3FHEA 5FXNA 1KL6A 1LNEE 3B3BA 3CHQA 1FJQA 1KJOA 3FUFA 3EIMA 2TMNE 3FXPA 7TLIA 5JT9E 4OW3A 4D91A 1FJ3A 3T8VA 5DLLA 3U9WA 2G4ZA 3EBIA 4OI5E 4B52A 4XMTA 3P7RE 1SQMA
chains in the Genus database with same CATH superfamily
1KROA 3NN7A 4XNBA 3KEDA 4K5MA 3MSNA 3Q44A 1Z5HA 4Q4EA 3FTUA 3FU6A 5LWDE 1FJUA 2XQ0A 4D9WA 3B2PA 6TMNE 4KXAA 4XMWA 4QPEA 1LNFE 4FKKA 1QF2A 4RVBA 3FUDA 4XN1A 5HQDA 2WHZA 3CHRA 5DPEE 2R59A 2VQXA 3EBGA 3NQZB 4M65A 5LHDA 4R5TA 4FKHA 5J6SA 4FKEA 3B2XA 4R7LA 2DQ6A 5FWQA 3FU3A 4J3BA 1FJWA 5EV7A 3F2PA 3CHSA 1KTOA 4JBSA 4FYTA 3Q7JA 4QMEA 4GERA 4XNDA 1LMLA 3FBOA 4N5PE 1ESPA 3FTVA 1KS7A 4AR1A 3T2JE 3F28A 1THLA 3FUNA 3QH1A 5CU5A 4XNAA 5JS3E 5L41E 4MWPE 4ZW7A 3B3BA 1FJQA 4OU3A 5JT9E 4D91A 4OI5E 1SQMA 4ZW8A 3FTSA 2WI0A 4FYQA 4XN5A 4TLIA 5LDSA 5L3UE 5AENA 4TLNA 4XO4A 4TNLA 2ZXGA 3FORA 4K90A 3FH8A 3PUUA 3DNZA 5TLIA 4ZQTA 4ARFA 3FVPA 5LG6A 2YD0A 4XMVA 1Z1WA 2DQMA 4GAAA 1U4GA 4R5XA 3FTWA 4TMNE 5TMNE 3FU5A 1LNAE 4XO5A 4XN2A 3P7UE 4KXCA 1GXWA 3B37A 3MSFA 2XPYA 4ZX6A 1PE7A 3P7TE 3B7TA 1TRLA 5DYFA 3MS3A 3EBHA 4ZX5A 3P7VE 3T2HE 4XN9A 3TMNE 3FGDA 4XO3A 3CIAA 3QNFA 4N4EE 4MTWE 1TLIA 4FCAA 3NQXA 1ZDPE 5A3YA 1HYTA 3FTXA 3FB0A 3SE6A 3FUHA 3T8DA 3FV4A 5DPFE 5FXNA 4II7A 1LNEE 3CHQA 7TLIA 1FJ3A 1TMNE 3P7WE 3EBIA 4RSYA 3P7RE 1QF0A 3T2IE 4KXDA 3B34A 3P7SE 3ZI6A 3DO2A 1FJVA 3DO1A 4XN4A 3T87A 1QF1A 4DPRA 4XN8A 3MSAA 4AR9A 3FH5A 2TLIA 4K5NA 3QJXA 3FLFA 4K89A 3FH7A 6TLIA 3CHOA 4K5LA 4WZ9A 2HPTA 3T74A 3FCQA 4ZW5A 2VJ8A 5JSSE 5TLNA 3DBKA 3FTYA 3T8FA 3DO0A 4XMZA 4FYRA 2GTQA 4FYSA 4XN7A 4QIRA 4XMXA 4K5PA 3P7PE 3QH5A 3QGOA 3SSBA 7TLNA 1Z9GE 4PW4A 1EZMA 5FSPA 4ZX3A 5K1VA 3LS7A 8TLIA 1LNDE 1LNCE 3T8HA 5LIFE 4R5VA 4N66E 4KXBA 1Y3GE 1H19A 1HS6A 3FULA 1GW6A 4MZNE 4PVBA 3CHPA 4P8QA 3B7SA 4ZW3A 4K5OA 1PE5A 1OS0A 3T8GA 3FHEA 1KJOA 3FUFA 3T8VA 5DLLA 4XMTA 3MDJA 4XMUA 2HPOA 1BQBA 4Z7IA 4L2LA 4IHQA 4NAQA 5C97A 4NZ8A 5FSJA 4HOMA 5DLHA 4Q4IA 4MS6A 4PJ6A 5K7TA 4MXJE 4ZX4A 1FJTA 4FGMA 1PE8A 3FUKA 4PU2A 4AR8A 1KKKA 2XPZA 5AB2A 1TLXA 3FUEA 3FUIA 3FTZA 4X2UA 1L3FE 4KX9A 4ZW6A 3FU0A 3B7UX 4QUOA 4H57A 5FSSA 5L8PE 2A7GE 5JXNE 5AB0A 4QHPA 1KJPA 4KX7A 1KR6A 3Q43A 1KEIA 4E36A 4MKTA 3N21A 3T73A 5BPPA 3P7QE 4KX8A 3TLIA 5JVIE 1TLPE 3T8CA 1FJOA 4F5CA 3FUJA 3B7RL 1LNBE 1NPCA 2TLXA 3FUMA 8TLNE 3NQYB 3FXSA 1KL6A 3EIMA 2TMNE 3FXPA 4OW3A 3U9WA 2G4ZA 4B52A
chains in the Genus database with same CATH topology
2HPOA 1QF0A 1BQBA 3T2IE 1KROA 3NN7A 3B34A 3P7SE 3KEDA 4XNBA 4ZW8A 3FTSA 2WI0A 3DO2A 3ZI6A 4L2LA 4XN5A 1FJVA 4K5MA 4TLIA 3MSNA 3DO1A 4XN4A 3T87A 1QF1A 5L3UE 4DPRA 3Q44A 4XN8A 5AENA 4TLNA 4XO4A 5FSJA 3MSAA 4TNLA 4Q4EA 5DLHA 2ZXGA 3FORA 4K90A 3FH5A 4Q4IA 3FTUA 3FH8A 3PUUA 3FU6A 3DNZA 2TLIA 4MS6A 5TLIA 4ZQTA 3FVPA 4K5NA 3QJXA 5LWDE 1FJUA 5K7TA 2XQ0A 3FLFA 4D9WA 4K89A 3FH7A 6TLIA 1TMNE 3B2PA 3CHOA 3P7WE 4K5LA 6TMNE 4XMVA 2DQMA 4MXJE 2HPTA 4GAAA 3T74A 4ZX4A 1FJTA 3FCQA 4QPEA 4XMWA 1LNFE 1U4GA 1PE8A 1QF2A 3FUKA 4R5XA 4ZW5A 2VJ8A 4PU2A 3FTWA 4RVBA 5JSSE 1KKKA 3FUDA 2XPZA 3DBKA 4TMNE 3FU5A 4XN1A 5TLNA 3FTYA 5TMNE 5HQDA 2WHZA 3T8FA 3DO0A 1TLXA 3CHRA 1LNAE 3FUEA 3FUIA 2R59A 4XO5A 4XN2A 3FTZA 5DPEE 2VQXA 3EBGA 3NQZB 4M65A 4XMZA 4X2UA 2GTQA 1L3FE 3P7UE 1GXWA 3B37A 4R5TA 4ZW6A 7TLNA 3MSFA 2XPYA 4XN7A 3FU0A 3B7UX 4QIRA 4QUOA 4ZX6A 4H57A 1PE7A 3B2XA 3B7TA 1TRLA 3P7TE 5DYFA 5FSSA 4XMXA 4R7LA 5L8PE 4K5PA 2A7GE 2DQ6A 5JXNE 5FWQA 3FU3A 3MS3A 3EBHA 4J3BA 3P7PE 4QHPA 1KJPA 1FJWA 1KR6A 3QH5A 3QGOA 3SSBA 1Z9GE 3Q43A 3F2PA 3CHSA 4PW4A 1KTOA 4ZX5A 1EZMA 1KEIA 5FSPA 4MKTA 3P7VE 3T2HE 4QMEA 4GERA 3N21A 4XN9A 3TMNE 4XNDA 4ZX3A 3LS7A 8TLIA 1LNDE 3T73A 5BPPA 3FGDA 1LMLA 3FBOA 3P7QE 1LNCE 3CIAA 4XO3A 3T8HA 4N5PE 5LIFE 1ESPA 4N4EE 4R5VA 3TLIA 5JVIE 1TLPE 4MTWE 1TLIA 4N66E 3T8CA 3FTVA 1FJOA 1Y3GE 1KS7A 3NQXA 3F28A 1H19A 3T2JE 1ZDPE 5A3YA 1THLA 3FUNA 1HYTA 3QH1A 4XMUA 4XNAA 3FTXA 1HS6A 3FUJA 3FULA 3FB0A 1GW6A 4MZNE 3B7RL 5JS3E 4PVBA 1LNBE 3CHPA 3FUHA 3B7SA 1NPCA 2TLXA 3FUMA 5L41E 4ZW3A 3T8DA 4MWPE 8TLNE 3NQYB 4K5OA 3FV4A 3FXSA 5DPFE 1PE5A 1OS0A 4ZW7A 3T8GA 4RSYA 3FHEA 5FXNA 1KL6A 1LNEE 3B3BA 3CHQA 1FJQA 1KJOA 3FUFA 3EIMA 2TMNE 3FXPA 7TLIA 5JT9E 4OW3A 4D91A 1FJ3A 3T8VA 5DLLA 3U9WA 2G4ZA 3EBIA 4OI5E 4B52A 4XMTA 3P7RE 1SQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPO A;  1QF0 A;  1BQB A;  3T2I E;  1KRO A;  3NN7 A;  3B34 A;  3P7S E;  3KED A;  4XNB A;  4ZW8 A;  3FTS A;  2WI0 A;  3DO2 A;  3ZI6 A;  4L2L A;  4XN5 A;  1FJV A;  4K5M A;  4TLI A;  3MSN A;  3DO1 A;  4XN4 A;  3T87 A;  1QF1 A;  5L3U E;  4DPR A;  3Q44 A;  4XN8 A;  5AEN A;  4TLN A;  4XO4 A;  5FSJ A;  3MSA A;  4TNL A;  4Q4E A;  5DLH A;  2ZXG A;  3FOR A;  4K90 A;  3FH5 A;  4Q4I A;  3FTU A;  3FH8 A;  3PUU A;  3FU6 A;  3DNZ A;  2TLI A;  4MS6 A;  5TLI A;  4ZQT A;  3FVP A;  4K5N A;  3QJX A;  5LWD E;  1FJU A;  5K7T A;  2XQ0 A;  3FLF A;  4D9W A;  4K89 A;  3FH7 A;  6TLI A;  1TMN E;  3B2P A;  3CHO A;  3P7W E;  4K5L A;  6TMN E;  4XMV A;  2DQM A;  4MXJ E;  2HPT A;  4GAA A;  3T74 A;  4ZX4 A;  1FJT A;  3FCQ A;  4QPE A;  4XMW A;  1LNF E;  1U4G A;  1PE8 A;  1QF2 A;  3FUK A;  4R5X A;  4ZW5 A;  2VJ8 A;  4PU2 A;  3FTW A;  4RVB A;  5JSS E;  1KKK A;  3FUD A;  2XPZ A;  3DBK A;  4TMN E;  3FU5 A;  4XN1 A;  5TLN A;  3FTY A;  5TMN E;  5HQD A;  2WHZ A;  3T8F A;  3DO0 A;  1TLX A;  3CHR A;  1LNA E;  3FUE A;  3FUI A;  2R59 A;  4XO5 A;  4XN2 A;  3FTZ A;  5DPE E;  2VQX A;  3EBG A;  3NQZ B;  4M65 A;  4XMZ A;  4X2U A;  2GTQ A;  1L3F E;  3P7U E;  1GXW A;  3B37 A;  4R5T A;  4ZW6 A;  7TLN A;  3MSF A;  2XPY A;  4XN7 A;  3FU0 A;  3B7U X;  4QIR A;  4QUO A;  4ZX6 A;  4H57 A;  1PE7 A;  3B2X A;  3B7T A;  1TRL A;  3P7T E;  5DYF A;  5FSS A;  4XMX A;  4R7L A;  5L8P E;  4K5P A;  2A7G E;  2DQ6 A;  5JXN E;  5FWQ A;  3FU3 A;  3MS3 A;  3EBH A;  4J3B A;  3P7P E;  4QHP A;  1KJP A;  1FJW A;  1KR6 A;  3QH5 A;  3QGO A;  3SSB A;  1Z9G E;  3Q43 A;  3F2P A;  3CHS A;  4PW4 A;  1KTO A;  4ZX5 A;  1EZM A;  1KEI A;  5FSP A;  4MKT A;  3P7V E;  3T2H E;  4QME A;  4GER A;  3N21 A;  4XN9 A;  3TMN E;  4XND A;  4ZX3 A;  3LS7 A;  8TLI A;  1LND E;  3T73 A;  5BPP A;  3FGD A;  3FBO A;  3P7Q E;  1LNC E;  3CIA A;  4XO3 A;  3T8H A;  4N5P E;  5LIF E;  1ESP A;  4N4E E;  4R5V A;  3TLI A;  5JVI E;  1TLP E;  4MTW E;  1TLI A;  4N66 E;  3T8C A;  3FTV A;  1FJO A;  1Y3G E;  1KS7 A;  3NQX A;  3F28 A;  1H19 A;  3T2J E;  1ZDP E;  5A3Y A;  1THL A;  3FUN A;  1HYT A;  3QH1 A;  4XMU A;  4XNA A;  3FTX A;  1HS6 A;  3FUJ A;  3FUL A;  3FB0 A;  1GW6 A;  4MZN E;  3B7R L;  5JS3 E;  4PVB A;  1LNB E;  3CHP A;  3FUH A;  3B7S A;  1NPC A;  2TLX A;  3FUM A;  5L41 E;  4ZW3 A;  3T8D A;  4MWP E;  8TLN E;  3NQY B;  4K5O A;  3FV4 A;  3FXS A;  5DPF E;  1PE5 A;  1OS0 A;  4ZW7 A;  3T8G A;  4RSY A;  3FHE A;  5FXN A;  1KL6 A;  1LNE E;  3B3B A;  3CHQ A;  1FJQ A;  1KJO A;  3FUF A;  3EIM A;  2TMN E;  3FXP A;  7TLI A;  5JT9 E;  4OW3 A;  4D91 A;  1FJ3 A;  3T8V A;  5DLL A;  3U9W A;  2G4Z A;  3EBI A;  4OI5 E;  4B52 A;  4XMT A;  3P7R E;  1SQM A; 
#chains in the Genus database with same CATH topology
 1KRO A;  3NN7 A;  4XNB A;  3KED A;  4K5M A;  3MSN A;  3Q44 A;  1Z5H A;  4Q4E A;  3FTU A;  3FU6 A;  5LWD E;  1FJU A;  2XQ0 A;  4D9W A;  3B2P A;  6TMN E;  4KXA A;  4XMW A;  4QPE A;  1LNF E;  4FKK A;  1QF2 A;  4RVB A;  3FUD A;  4XN1 A;  5HQD A;  2WHZ A;  3CHR A;  5DPE E;  2R59 A;  2VQX A;  3EBG A;  3NQZ B;  4M65 A;  5LHD A;  4R5T A;  4FKH A;  5J6S A;  4FKE A;  3B2X A;  4R7L A;  2DQ6 A;  5FWQ A;  3FU3 A;  4J3B A;  1FJW A;  5EV7 A;  3F2P A;  3CHS A;  1KTO A;  4JBS A;  4FYT A;  3Q7J A;  4QME A;  4GER A;  4XND A;  1LML A;  3FBO A;  4N5P E;  1ESP A;  3FTV A;  1KS7 A;  4AR1 A;  3T2J E;  3F28 A;  1THL A;  3FUN A;  3QH1 A;  5CU5 A;  4XNA A;  5JS3 E;  5L41 E;  4MWP E;  4ZW7 A;  3B3B A;  1FJQ A;  4OU3 A;  5JT9 E;  4D91 A;  4OI5 E;  1SQM A;  4ZW8 A;  3FTS A;  2WI0 A;  4FYQ A;  4XN5 A;  4TLI A;  5LDS A;  5L3U E;  5AEN A;  4TLN A;  4XO4 A;  4TNL A;  2ZXG A;  3FOR A;  4K90 A;  3FH8 A;  3PUU A;  3DNZ A;  5TLI A;  4ZQT A;  4ARF A;  3FVP A;  5LG6 A;  2YD0 A;  4XMV A;  1Z1W A;  2DQM A;  4GAA A;  1U4G A;  4R5X A;  3FTW A;  4TMN E;  5TMN E;  3FU5 A;  1LNA E;  4XO5 A;  4XN2 A;  3P7U E;  4KXC A;  1GXW A;  3B37 A;  3MSF A;  2XPY A;  4ZX6 A;  1PE7 A;  3P7T E;  3B7T A;  1TRL A;  5DYF A;  3MS3 A;  3EBH A;  4ZX5 A;  3P7V E;  3T2H E;  4XN9 A;  3TMN E;  3FGD A;  4XO3 A;  3CIA A;  3QNF A;  4N4E E;  4MTW E;  1TLI A;  4FCA A;  3NQX A;  1ZDP E;  5A3Y A;  1HYT A;  3FTX A;  3FB0 A;  3SE6 A;  3FUH A;  3T8D A;  3FV4 A;  5DPF E;  5FXN A;  4II7 A;  1LNE E;  3CHQ A;  7TLI A;  1FJ3 A;  1TMN E;  3P7W E;  3EBI A;  4RSY A;  3P7R E;  1QF0 A;  3T2I E;  4KXD A;  3B34 A;  3P7S E;  3ZI6 A;  3DO2 A;  1FJV A;  3DO1 A;  4XN4 A;  3T87 A;  1QF1 A;  4DPR A;  4XN8 A;  3MSA A;  4AR9 A;  3FH5 A;  2TLI A;  4K5N A;  3QJX A;  3FLF A;  4K89 A;  3FH7 A;  6TLI A;  3CHO A;  4K5L A;  4WZ9 A;  2HPT A;  3T74 A;  3FCQ A;  4ZW5 A;  2VJ8 A;  5JSS E;  5TLN A;  3DBK A;  3FTY A;  3T8F A;  3DO0 A;  4XMZ A;  4FYR A;  2GTQ A;  4FYS A;  4XN7 A;  4QIR A;  4XMX A;  4K5P A;  3P7P E;  3QH5 A;  3QGO A;  3SSB A;  7TLN A;  1Z9G E;  4PW4 A;  1EZM A;  5FSP A;  4ZX3 A;  5K1V A;  3LS7 A;  8TLI A;  1LND E;  1LNC E;  3T8H A;  5LIF E;  4R5V A;  4N66 E;  4KXB A;  1Y3G E;  1H19 A;  1HS6 A;  3FUL A;  1GW6 A;  4MZN E;  4PVB A;  3CHP A;  4P8Q A;  3B7S A;  4ZW3 A;  4K5O A;  1PE5 A;  1OS0 A;  3T8G A;  3FHE A;  1KJO A;  3FUF A;  3T8V A;  5DLL A;  4XMT A;  3MDJ A;  4XMU A;  2HPO A;  1BQB A;  4Z7I A;  4L2L A;  4IHQ A;  4NAQ A;  5C97 A;  4NZ8 A;  5FSJ A;  4HOM A;  5DLH A;  4Q4I A;  4MS6 A;  4PJ6 A;  5K7T A;  4MXJ E;  4ZX4 A;  1FJT A;  4FGM A;  1PE8 A;  3FUK A;  4PU2 A;  4AR8 A;  1KKK A;  2XPZ A;  5AB2 A;  1TLX A;  3FUE A;  3FUI A;  3FTZ A;  4X2U A;  1L3F E;  4KX9 A;  4ZW6 A;  3FU0 A;  3B7U X;  4QUO A;  4H57 A;  5FSS A;  5L8P E;  2A7G E;  5JXN E;  5AB0 A;  4QHP A;  1KJP A;  4KX7 A;  1KR6 A;  3Q43 A;  1KEI A;  4E36 A;  4MKT A;  3N21 A;  3T73 A;  5BPP A;  3P7Q E;  4KX8 A;  3TLI A;  5JVI E;  1TLP E;  3T8C A;  1FJO A;  4F5C A;  3FUJ A;  3B7R L;  1LNB E;  1NPC A;  2TLX A;  3FUM A;  8TLN E;  3NQY B;  3FXS A;  1KL6 A;  3EIM A;  2TMN E;  3FXP A;  4OW3 A;  3U9W A;  2G4Z A;  4B52 A; 
#chains in the Genus database with same CATH homology
 2HPO A;  1QF0 A;  1BQB A;  3T2I E;  1KRO A;  3NN7 A;  3B34 A;  3P7S E;  3KED A;  4XNB A;  4ZW8 A;  3FTS A;  2WI0 A;  3DO2 A;  3ZI6 A;  4L2L A;  4XN5 A;  1FJV A;  4K5M A;  4TLI A;  3MSN A;  3DO1 A;  4XN4 A;  3T87 A;  1QF1 A;  5L3U E;  4DPR A;  3Q44 A;  4XN8 A;  5AEN A;  4TLN A;  4XO4 A;  5FSJ A;  3MSA A;  4TNL A;  4Q4E A;  5DLH A;  2ZXG A;  3FOR A;  4K90 A;  3FH5 A;  4Q4I A;  3FTU A;  3FH8 A;  3PUU A;  3FU6 A;  3DNZ A;  2TLI A;  4MS6 A;  5TLI A;  4ZQT A;  3FVP A;  4K5N A;  3QJX A;  5LWD E;  1FJU A;  5K7T A;  2XQ0 A;  3FLF A;  4D9W A;  4K89 A;  3FH7 A;  6TLI A;  1TMN E;  3B2P A;  3CHO A;  3P7W E;  4K5L A;  6TMN E;  4XMV A;  2DQM A;  4MXJ E;  2HPT A;  4GAA A;  3T74 A;  4ZX4 A;  1FJT A;  3FCQ A;  4QPE A;  4XMW A;  1LNF E;  1U4G A;  1PE8 A;  1QF2 A;  3FUK A;  4R5X A;  4ZW5 A;  2VJ8 A;  4PU2 A;  3FTW A;  4RVB A;  5JSS E;  1KKK A;  3FUD A;  2XPZ A;  3DBK A;  4TMN E;  3FU5 A;  4XN1 A;  5TLN A;  3FTY A;  5TMN E;  5HQD A;  2WHZ A;  3T8F A;  3DO0 A;  1TLX A;  3CHR A;  1LNA E;  3FUE A;  3FUI A;  2R59 A;  4XO5 A;  4XN2 A;  3FTZ A;  5DPE E;  2VQX A;  3EBG A;  3NQZ B;  4M65 A;  4XMZ A;  4X2U A;  2GTQ A;  1L3F E;  3P7U E;  1GXW A;  3B37 A;  4R5T A;  4ZW6 A;  7TLN A;  3MSF A;  2XPY A;  4XN7 A;  3FU0 A;  3B7U X;  4QIR A;  4QUO A;  4ZX6 A;  4H57 A;  1PE7 A;  3B2X A;  3B7T A;  1TRL A;  3P7T E;  5DYF A;  5FSS A;  4XMX A;  4R7L A;  5L8P E;  4K5P A;  2A7G E;  2DQ6 A;  5JXN E;  5FWQ A;  3FU3 A;  3MS3 A;  3EBH A;  4J3B A;  3P7P E;  4QHP A;  1KJP A;  1FJW A;  1KR6 A;  3QH5 A;  3QGO A;  3SSB A;  1Z9G E;  3Q43 A;  3F2P A;  3CHS A;  4PW4 A;  1KTO A;  4ZX5 A;  1EZM A;  1KEI A;  5FSP A;  4MKT A;  3P7V E;  3T2H E;  4QME A;  4GER A;  3N21 A;  4XN9 A;  3TMN E;  4XND A;  4ZX3 A;  3LS7 A;  8TLI A;  1LND E;  3T73 A;  5BPP A;  3FGD A;  1LML A;  3FBO A;  3P7Q E;  1LNC E;  3CIA A;  4XO3 A;  3T8H A;  4N5P E;  5LIF E;  1ESP A;  4N4E E;  4R5V A;  3TLI A;  5JVI E;  1TLP E;  4MTW E;  1TLI A;  4N66 E;  3T8C A;  3FTV A;  1FJO A;  1Y3G E;  1KS7 A;  3NQX A;  3F28 A;  1H19 A;  3T2J E;  1ZDP E;  5A3Y A;  1THL A;  3FUN A;  1HYT A;  3QH1 A;  4XMU A;  4XNA A;  3FTX A;  1HS6 A;  3FUJ A;  3FUL A;  3FB0 A;  1GW6 A;  4MZN E;  3B7R L;  5JS3 E;  4PVB A;  1LNB E;  3CHP A;  3FUH A;  3B7S A;  1NPC A;  2TLX A;  3FUM A;  5L41 E;  4ZW3 A;  3T8D A;  4MWP E;  8TLN E;  3NQY B;  4K5O A;  3FV4 A;  3FXS A;  5DPF E;  1PE5 A;  1OS0 A;  4ZW7 A;  3T8G A;  4RSY A;  3FHE A;  5FXN A;  1KL6 A;  1LNE E;  3B3B A;  3CHQ A;  1FJQ A;  1KJO A;  3FUF A;  3EIM A;  2TMN E;  3FXP A;  7TLI A;  5JT9 E;  4OW3 A;  4D91 A;  1FJ3 A;  3T8V A;  5DLL A;  3U9W A;  2G4Z A;  3EBI A;  4OI5 E;  4B52 A;  4XMT A;  3P7R E;  1SQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...