3DBKA

Pseudomonas aeruginosa elastase with phosphoramidon
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
b'AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase
publication title Structure of the Elastase of Pseudomonas aeruginosa Complexed with Phosphoramidon
rcsb
molecule tags Hydrolase
total genus 112
structure length 298
sequence length 298
ec nomenclature ec 3.4.24.26: Pseudolysin.
pdb deposition date 2008-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 3dbkA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 3dbkA01
4RVBA 3FLFA 4Q4EA 4B52A 5L8PE 4ZW6A 5JSSE 5BPPA 1KS7A 4ZX6A 1KEIA 2XPZA 4K90A 1GXWA 3DO2A 3KEDA 4QPEA 4MKTA 4XN4A 1LNAE 4J3BA 5FSSA 2VJ8A 3NQXA 3B7RL 1FJWA 4M65A 4RSYA 4TMNE 1PE8A 1FJ3A 4K5NA 4PU2A 3P7TE 1U4GA 4XN1A 5LWDE 3DO1A 1TRLA 3FV4A 4XMWA 3FU5A 4MTWE 3QJXA 3FTUA 1KJOA 4XN9A 5TLIA 4OW3A 3MSAA 5DPEE 1QF1A 3EBIA 4L2LA 4ZW7A 3DO0A 3FXPA 1KL6A 4XN7A 5JXNE 3T8FA 1ESPA 1H19A 1LNFE 7TLNA 1KROA 3T2HE 2TLIA 3EIMA 2R59A 4R5VA 5DLLA 1OS0A 4XO3A 4ZX4A 3FUKA 2G4ZA 3F28A 3MSFA 1FJUA 1FJVA 3FGDA 3FVPA 1EZMA 3P7WE 1QF2A 4TLIA 5DLHA 1LNDE 1FJOA 2DQMA 2TMNE 3FBOA 3EBHA 1KJPA 3FHEA 5TLNA 1TLIA 1FJTA 3Q43A 3NQZB 6TMNE 3B2XA 2HPOA 3FH5A 4DPRA 3FTZA 3FUEA 3TMNE 4XO4A 3T2IE 3CHPA 5K7TA 1HYTA 3B7SA 3CHSA 3FUFA 2XQ0A 1KR6A 4K5PA 4GERA 3T8VA 3B34A 3FUIA 4R5TA 4MZNE 3PUUA 1LNEE 2VQXA 4K5MA 1HS6A 6TLIA 2HPTA 3FUMA 3FTVA 4XMTA 1PE5A 4H57A 3P7PE 1L3FE 3CHQA 3B37A 4QUOA 1TMNE 1KTOA 2A7GE 1NPCA 3FUNA 2XPYA 5JT9E 4TLNA 5TMNE 5DPFE 4R7LA 4XMUA 4Q4IA 4ZQTA 7TLIA 4OI5E 3B7TA 4N66E 3MS3A 4ZW8A 5JS3E 4TNLA 2DQ6A 3CHRA 4MWPE 4XN5A 3NQYB 4PW4A 4ZW3A 3FU6A 1Z9GE 8TLIA 3SSBA 2WI0A 4QMEA 5FSJA 3FU3A 4K5LA 3B2PA 2WHZA 3P7SE 1KKKA 1SQMA 1THLA 3DBKA 3F2PA 4X2UA 4ZX5A 3QH1A 3FUJA 3MSNA 1BQBA 2GTQA 3FH7A 3FTYA 4GAAA 3T74A 1QF0A 3T8DA 4D91A 4QHPA 4XMZA 1LNBE 5LIFE 3EBGA 4N5PE 3T8GA 3U9WA 3FXSA 4ZW5A 5L3UE 3LS7A 4XN2A 3T87A 3FTWA 5L41E 3Q44A 4PVBA 4R5XA 3FCQA 3FULA 5A3YA 4ZX3A 5JVIE 1GW6A 2ZXGA 4XNDA 3N21A 4XMXA 3TLIA 3FORA 3FTXA 1LNCE 4XMVA 5FWQA 3T8CA 1FJQA 4MS6A 3FH8A 3FUHA 3B3BA 4XNAA 3FUDA 4K5OA 5FXNA 3ZI6A 3B7UX 1ZDPE 1Y3GE 3FTSA 3NN7A 3T2JE 4D9WA 1TLXA 3P7QE 3T73A 4XN8A 5HQDA 3CIAA 3CHOA 3P7UE 3P7VE 2TLXA 4N4EE 3QH5A 4XNBA 3T8HA 4XO5A 8TLNE 4QIRA 1PE7A 3DNZA 3FU0A 5DYFA 3FB0A 5FSPA 4MXJE 3P7RE 4K89A 5AENA 3QGOA 1TLPE
chains in the Genus database with same CATH superfamily
4ZW6A 5BPPA 1KS7A 1KEIA 3DO2A 4J3BA 4KX7A 1FJ3A 4PU2A 3P7TE 4MTWE 5TLIA 3MSAA 5DPEE 1QF1A 4KXCA 1H19A 3T2HE 3EIMA 2R59A 4XO3A 4ZX4A 3FVPA 3FBOA 3FTZA 1Z1WA 3FUFA 2XQ0A 1KR6A 4GERA 1LNEE 2VQXA 4H57A 1KTOA 4XMUA 7TLIA 4N66E 4XN5A 3B2PA 3F2PA 4ZX5A 3QH1A 1BQBA 2GTQA 3FH7A 5AB0A 1QF0A 4QHPA 1LNBE 5LIFE 5L3UE 4AR8A 3FXSA 4NAQA 3LS7A 4XN2A 1LMLA 4R5XA 3FULA 4ZX3A 3N21A 4KXBA 4FKEA 5FWQA 4OU3A 4K5OA 5FXNA 3FTSA 3NN7A 4FYSA 4KXAA 4XN8A 3P7VE 2TLXA 3T8HA 4XO5A 8TLNE 3FU0A 3P7RE 4FKHA 3QGOA 3FLFA 4Q4EA 5CU5A 5L8PE 2XPZA 3B7RL 1FJWA 1PE8A 4KX9A 1TRLA 5EV7A 1KJOA 4XN9A 4FYRA 4FYQA 4XN7A 1ESPA 4FCAA 7TLNA 5DLLA 3FUKA 3MSFA 3P7WE 1FJUA 1FJVA 1EZMA 1QF2A 4Z7IA 5DLHA 2TMNE 1KJPA 1TLIA 5K1VA 4DPRA 5AB2A 4XO4A 3FUIA 4AR9A 3PUUA 1PE5A 3P7PE 4QUOA 1NPCA 4Q4IA 3QNFA 4OI5E 4AR1A 5JS3E 4ZW8A 3MS3A 4TNLA 2DQ6A 4MWPE 3NQYB 4PW4A 3SSBA 5FSJA 3P7SE 1KKKA 3DBKA 2YD0A 3T74A 3FUJA 4D91A 4ARFA 4N5PE 3FTWA 5L41E 4PVBA 3FCQA 1GW6A 2ZXGA 4XNDA 3FORA 4XMVA 4MS6A 3ZI6A 4NZ8A 1ZDPE 1Y3GE 1TLXA 5HQDA 3P7UE 4N4EE 4QIRA 1PE7A 5DYFA 5FSPA 4K89A 5AENA 3T73A 4TLIA 1TLPE 3KEDA 5FSSA 4M65A 4TMNE 4KX8A 5LG6A 1U4GA 5LWDE 3DO1A 3FU5A 3SE6A 4OW3A 3EBIA 4ZW7A 3FXPA 1KL6A 3T8FA 4KXDA 1LNFE 4JBSA 1KROA 2TLIA 4R5VA 1OS0A 2G4ZA 3F28A 5LDSA 1FJOA 2DQMA 3FHEA 1FJTA 3Q43A 4PJ6A 1Z5HA 3B2XA 2HPOA 3FUEA 3Q7JA 5K7TA 1HYTA 3B7SA 3CHSA 4K5PA 4R5TA 4K5MA 6TLIA 4P8QA 3MDJA 2HPTA 5LHDA 3FTVA 1L3FE 2A7GE 3FUNA 4R7LA 4ZQTA 3B7TA 3CHRA 3FU6A 8TLIA 2WHZA 4GAAA 3MSNA 4II7A 3T8DA 4FKKA 4XMZA 3T8GA 4FYTA 3Q44A 5JVIE 3TLIA 1FJQA 3FUHA 4XNAA 3FUDA 4D9WA 4F5CA 4MXJE 4RVBA 4B52A 5JSSE 4ZX6A 4K90A 1GXWA 4QPEA 4MKTA 4XN4A 1LNAE 2VJ8A 3NQXA 4RSYA 4IHQA 4K5NA 4FGMA 4WZ9A 4XN1A 3FV4A 4XMWA 3QJXA 3FTUA 4L2LA 3DO0A 5JXNE 3FGDA 5C97A 1LNDE 3EBHA 5TLNA 6TMNE 3NQZB 3FH5A 3T2IE 3CHPA 3T8VA 3B34A 4MZNE 1HS6A 3FUMA 4XMTA 3CHQA 3B37A 1TMNE 5JT9E 2XPYA 4HOMA 4TLNA 5TMNE 5DPFE 5J6SA 4ZW3A 1Z9GE 2WI0A 4QMEA 3FU3A 4K5LA 1SQMA 1THLA 4X2UA 3FTYA 3EBGA 4ZW5A 3U9WA 3T87A 5A3YA 4XMXA 3FTXA 1LNCE 3T8CA 3FH8A 3B3BA 4E36A 3B7UX 3T2JE 3P7QE 3CIAA 3CHOA 3QH5A 4XNBA 3DNZA 3FB0A 3TMNE
chains in the Genus database with same CATH topology
4RVBA 3FLFA 4Q4EA 4B52A 5L8PE 4ZW6A 5JSSE 5BPPA 1KS7A 4ZX6A 1KEIA 2XPZA 4K90A 1GXWA 3DO2A 3KEDA 4QPEA 4MKTA 4XN4A 1LNAE 4J3BA 5FSSA 2VJ8A 3NQXA 3B7RL 1FJWA 4M65A 4RSYA 4TMNE 1PE8A 1FJ3A 4K5NA 4PU2A 3P7TE 1U4GA 4XN1A 5LWDE 3DO1A 1TRLA 3FV4A 4XMWA 3FU5A 4MTWE 3QJXA 3FTUA 1KJOA 4XN9A 5TLIA 4OW3A 3MSAA 5DPEE 1QF1A 3EBIA 4L2LA 4ZW7A 3DO0A 3FXPA 1KL6A 4XN7A 5JXNE 3T8FA 1ESPA 1H19A 1LNFE 7TLNA 1KROA 3T2HE 2TLIA 3EIMA 2R59A 4R5VA 5DLLA 1OS0A 4XO3A 4ZX4A 3FUKA 2G4ZA 3F28A 3MSFA 1FJUA 1FJVA 3FGDA 3FVPA 1EZMA 3P7WE 1QF2A 4TLIA 5DLHA 1LNDE 1FJOA 2DQMA 2TMNE 3FBOA 3EBHA 1KJPA 3FHEA 5TLNA 1TLIA 1FJTA 3Q43A 3NQZB 6TMNE 3B2XA 2HPOA 3FH5A 4DPRA 3FTZA 3FUEA 3TMNE 4XO4A 3T2IE 3CHPA 5K7TA 1HYTA 3B7SA 3CHSA 3FUFA 2XQ0A 1KR6A 4K5PA 4GERA 3T8VA 3B34A 3FUIA 4R5TA 4MZNE 3PUUA 1LNEE 2VQXA 4K5MA 1HS6A 6TLIA 2HPTA 3FUMA 3FTVA 4XMTA 1PE5A 4H57A 3P7PE 1L3FE 3CHQA 3B37A 4QUOA 1TMNE 1KTOA 2A7GE 1NPCA 3FUNA 2XPYA 5JT9E 4TLNA 5TMNE 5DPFE 4R7LA 4XMUA 4Q4IA 4ZQTA 7TLIA 4OI5E 3B7TA 4N66E 3MS3A 4ZW8A 5JS3E 4TNLA 2DQ6A 3CHRA 4MWPE 4XN5A 3NQYB 4PW4A 4ZW3A 3FU6A 1Z9GE 8TLIA 3SSBA 2WI0A 4QMEA 5FSJA 3FU3A 4K5LA 3B2PA 2WHZA 3P7SE 1KKKA 1SQMA 1THLA 3DBKA 3F2PA 4X2UA 4ZX5A 3QH1A 3FUJA 3MSNA 1BQBA 2GTQA 3FH7A 3FTYA 4GAAA 3T74A 1QF0A 3T8DA 4D91A 4QHPA 4XMZA 1LNBE 5LIFE 3EBGA 4N5PE 3T8GA 3U9WA 3FXSA 4ZW5A 5L3UE 3LS7A 4XN2A 3T87A 1LMLA 3FTWA 5L41E 3Q44A 4PVBA 4R5XA 3FCQA 3FULA 5A3YA 4ZX3A 5JVIE 1GW6A 2ZXGA 4XNDA 3N21A 4XMXA 3TLIA 3FORA 3FTXA 1LNCE 4XMVA 5FWQA 3T8CA 1FJQA 4MS6A 3FH8A 3FUHA 3B3BA 4XNAA 3FUDA 4K5OA 5FXNA 3ZI6A 3B7UX 1ZDPE 1Y3GE 3FTSA 3NN7A 3T2JE 4D9WA 1TLXA 3P7QE 3T73A 4XN8A 5HQDA 3CIAA 3CHOA 3P7UE 3P7VE 2TLXA 4N4EE 3QH5A 4XNBA 3T8HA 4XO5A 8TLNE 4QIRA 1PE7A 3DNZA 3FU0A 5DYFA 3FB0A 5FSPA 4MXJE 3P7RE 4K89A 5AENA 3QGOA 1TLPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RVB A;  3FLF A;  4Q4E A;  4B52 A;  5L8P E;  4ZW6 A;  5JSS E;  5BPP A;  1KS7 A;  4ZX6 A;  1KEI A;  2XPZ A;  4K90 A;  1GXW A;  3DO2 A;  3KED A;  4QPE A;  4MKT A;  4XN4 A;  1LNA E;  4J3B A;  5FSS A;  2VJ8 A;  3NQX A;  3B7R L;  1FJW A;  4M65 A;  4RSY A;  4TMN E;  1PE8 A;  1FJ3 A;  4K5N A;  4PU2 A;  3P7T E;  1U4G A;  4XN1 A;  5LWD E;  3DO1 A;  1TRL A;  3FV4 A;  4XMW A;  3FU5 A;  4MTW E;  3QJX A;  3FTU A;  1KJO A;  4XN9 A;  5TLI A;  4OW3 A;  3MSA A;  5DPE E;  1QF1 A;  3EBI A;  4L2L A;  4ZW7 A;  3DO0 A;  3FXP A;  1KL6 A;  4XN7 A;  5JXN E;  3T8F A;  1ESP A;  1H19 A;  1LNF E;  7TLN A;  1KRO A;  3T2H E;  2TLI A;  3EIM A;  2R59 A;  4R5V A;  5DLL A;  1OS0 A;  4XO3 A;  4ZX4 A;  3FUK A;  2G4Z A;  3F28 A;  3MSF A;  1FJU A;  1FJV A;  3FGD A;  3FVP A;  1EZM A;  3P7W E;  1QF2 A;  4TLI A;  5DLH A;  1LND E;  1FJO A;  2DQM A;  2TMN E;  3FBO A;  3EBH A;  1KJP A;  3FHE A;  5TLN A;  1TLI A;  1FJT A;  3Q43 A;  3NQZ B;  6TMN E;  3B2X A;  2HPO A;  3FH5 A;  4DPR A;  3FTZ A;  3FUE A;  3TMN E;  4XO4 A;  3T2I E;  3CHP A;  5K7T A;  1HYT A;  3B7S A;  3CHS A;  3FUF A;  2XQ0 A;  1KR6 A;  4K5P A;  4GER A;  3T8V A;  3B34 A;  3FUI A;  4R5T A;  4MZN E;  3PUU A;  1LNE E;  2VQX A;  4K5M A;  1HS6 A;  6TLI A;  2HPT A;  3FUM A;  3FTV A;  4XMT A;  1PE5 A;  4H57 A;  3P7P E;  1L3F E;  3CHQ A;  3B37 A;  4QUO A;  1TMN E;  1KTO A;  2A7G E;  1NPC A;  3FUN A;  2XPY A;  5JT9 E;  4TLN A;  5TMN E;  5DPF E;  4R7L A;  4XMU A;  4Q4I A;  4ZQT A;  7TLI A;  4OI5 E;  3B7T A;  4N66 E;  3MS3 A;  4ZW8 A;  5JS3 E;  4TNL A;  2DQ6 A;  3CHR A;  4MWP E;  4XN5 A;  3NQY B;  4PW4 A;  4ZW3 A;  3FU6 A;  1Z9G E;  8TLI A;  3SSB A;  2WI0 A;  4QME A;  5FSJ A;  3FU3 A;  4K5L A;  3B2P A;  2WHZ A;  3P7S E;  1KKK A;  1SQM A;  1THL A;  3DBK A;  3F2P A;  4X2U A;  4ZX5 A;  3QH1 A;  3FUJ A;  3MSN A;  1BQB A;  2GTQ A;  3FH7 A;  3FTY A;  4GAA A;  3T74 A;  1QF0 A;  3T8D A;  4D91 A;  4QHP A;  4XMZ A;  1LNB E;  5LIF E;  3EBG A;  4N5P E;  3T8G A;  3U9W A;  3FXS A;  4ZW5 A;  5L3U E;  3LS7 A;  4XN2 A;  3T87 A;  3FTW A;  5L41 E;  3Q44 A;  4PVB A;  4R5X A;  3FCQ A;  3FUL A;  5A3Y A;  4ZX3 A;  5JVI E;  1GW6 A;  2ZXG A;  4XND A;  3N21 A;  4XMX A;  3TLI A;  3FOR A;  3FTX A;  1LNC E;  4XMV A;  5FWQ A;  3T8C A;  1FJQ A;  4MS6 A;  3FH8 A;  3FUH A;  3B3B A;  4XNA A;  3FUD A;  4K5O A;  5FXN A;  3ZI6 A;  3B7U X;  1ZDP E;  1Y3G E;  3FTS A;  3NN7 A;  3T2J E;  4D9W A;  1TLX A;  3P7Q E;  3T73 A;  4XN8 A;  5HQD A;  3CIA A;  3CHO A;  3P7U E;  3P7V E;  2TLX A;  4N4E E;  3QH5 A;  4XNB A;  3T8H A;  4XO5 A;  8TLN E;  4QIR A;  1PE7 A;  3DNZ A;  3FU0 A;  5DYF A;  3FB0 A;  5FSP A;  4MXJ E;  3P7R E;  4K89 A;  5AEN A;  3QGO A;  1TLP E; 
#chains in the Genus database with same CATH topology
 4ZW6 A;  5BPP A;  1KS7 A;  1KEI A;  3DO2 A;  4J3B A;  4KX7 A;  1FJ3 A;  4PU2 A;  3P7T E;  4MTW E;  5TLI A;  3MSA A;  5DPE E;  1QF1 A;  4KXC A;  1H19 A;  3T2H E;  3EIM A;  2R59 A;  4XO3 A;  4ZX4 A;  3FVP A;  3FBO A;  3FTZ A;  1Z1W A;  3FUF A;  2XQ0 A;  1KR6 A;  4GER A;  1LNE E;  2VQX A;  4H57 A;  1KTO A;  4XMU A;  7TLI A;  4N66 E;  4XN5 A;  3B2P A;  3F2P A;  4ZX5 A;  3QH1 A;  1BQB A;  2GTQ A;  3FH7 A;  5AB0 A;  1QF0 A;  4QHP A;  1LNB E;  5LIF E;  5L3U E;  4AR8 A;  3FXS A;  4NAQ A;  3LS7 A;  4XN2 A;  1LML A;  4R5X A;  3FUL A;  4ZX3 A;  3N21 A;  4KXB A;  4FKE A;  5FWQ A;  4OU3 A;  4K5O A;  5FXN A;  3FTS A;  3NN7 A;  4FYS A;  4KXA A;  4XN8 A;  3P7V E;  2TLX A;  3T8H A;  4XO5 A;  8TLN E;  3FU0 A;  3P7R E;  4FKH A;  3QGO A;  3FLF A;  4Q4E A;  5CU5 A;  5L8P E;  2XPZ A;  3B7R L;  1FJW A;  1PE8 A;  4KX9 A;  1TRL A;  5EV7 A;  1KJO A;  4XN9 A;  4FYR A;  4FYQ A;  4XN7 A;  1ESP A;  4FCA A;  7TLN A;  5DLL A;  3FUK A;  3MSF A;  3P7W E;  1FJU A;  1FJV A;  1EZM A;  1QF2 A;  4Z7I A;  5DLH A;  2TMN E;  1KJP A;  1TLI A;  5K1V A;  4DPR A;  5AB2 A;  4XO4 A;  3FUI A;  4AR9 A;  3PUU A;  1PE5 A;  3P7P E;  4QUO A;  1NPC A;  4Q4I A;  3QNF A;  4OI5 E;  4AR1 A;  5JS3 E;  4ZW8 A;  3MS3 A;  4TNL A;  2DQ6 A;  4MWP E;  3NQY B;  4PW4 A;  3SSB A;  5FSJ A;  3P7S E;  1KKK A;  3DBK A;  2YD0 A;  3T74 A;  3FUJ A;  4D91 A;  4ARF A;  4N5P E;  3FTW A;  5L41 E;  4PVB A;  3FCQ A;  1GW6 A;  2ZXG A;  4XND A;  3FOR A;  4XMV A;  4MS6 A;  3ZI6 A;  4NZ8 A;  1ZDP E;  1Y3G E;  1TLX A;  5HQD A;  3P7U E;  4N4E E;  4QIR A;  1PE7 A;  5DYF A;  5FSP A;  4K89 A;  5AEN A;  3T73 A;  4TLI A;  1TLP E;  3KED A;  5FSS A;  4M65 A;  4TMN E;  4KX8 A;  5LG6 A;  1U4G A;  5LWD E;  3DO1 A;  3FU5 A;  3SE6 A;  4OW3 A;  3EBI A;  4ZW7 A;  3FXP A;  1KL6 A;  3T8F A;  4KXD A;  1LNF E;  4JBS A;  1KRO A;  2TLI A;  4R5V A;  1OS0 A;  2G4Z A;  3F28 A;  5LDS A;  1FJO A;  2DQM A;  3FHE A;  1FJT A;  3Q43 A;  4PJ6 A;  1Z5H A;  3B2X A;  2HPO A;  3FUE A;  3Q7J A;  5K7T A;  1HYT A;  3B7S A;  3CHS A;  4K5P A;  4R5T A;  4K5M A;  6TLI A;  4P8Q A;  3MDJ A;  2HPT A;  5LHD A;  3FTV A;  1L3F E;  2A7G E;  3FUN A;  4R7L A;  4ZQT A;  3B7T A;  3CHR A;  3FU6 A;  8TLI A;  2WHZ A;  4GAA A;  3MSN A;  4II7 A;  3T8D A;  4FKK A;  4XMZ A;  3T8G A;  4FYT A;  3Q44 A;  5JVI E;  3TLI A;  1FJQ A;  3FUH A;  4XNA A;  3FUD A;  4D9W A;  4F5C A;  4MXJ E;  4RVB A;  4B52 A;  5JSS E;  4ZX6 A;  4K90 A;  1GXW A;  4QPE A;  4MKT A;  4XN4 A;  1LNA E;  2VJ8 A;  3NQX A;  4RSY A;  4IHQ A;  4K5N A;  4FGM A;  4WZ9 A;  4XN1 A;  3FV4 A;  4XMW A;  3QJX A;  3FTU A;  4L2L A;  3DO0 A;  5JXN E;  3FGD A;  5C97 A;  1LND E;  3EBH A;  5TLN A;  6TMN E;  3NQZ B;  3FH5 A;  3T2I E;  3CHP A;  3T8V A;  3B34 A;  4MZN E;  1HS6 A;  3FUM A;  4XMT A;  3CHQ A;  3B37 A;  1TMN E;  5JT9 E;  2XPY A;  4HOM A;  4TLN A;  5TMN E;  5DPF E;  5J6S A;  4ZW3 A;  1Z9G E;  2WI0 A;  4QME A;  3FU3 A;  4K5L A;  1SQM A;  1THL A;  4X2U A;  3FTY A;  3EBG A;  4ZW5 A;  3U9W A;  3T87 A;  5A3Y A;  4XMX A;  3FTX A;  1LNC E;  3T8C A;  3FH8 A;  3B3B A;  4E36 A;  3B7U X;  3T2J E;  3P7Q E;  3CIA A;  3CHO A;  3QH5 A;  4XNB A;  3DNZ A;  3FB0 A;  3TMN E; 
#chains in the Genus database with same CATH homology
 4RVB A;  3FLF A;  4Q4E A;  4B52 A;  5L8P E;  4ZW6 A;  5JSS E;  5BPP A;  1KS7 A;  4ZX6 A;  1KEI A;  2XPZ A;  4K90 A;  1GXW A;  3DO2 A;  3KED A;  4QPE A;  4MKT A;  4XN4 A;  1LNA E;  4J3B A;  5FSS A;  2VJ8 A;  3NQX A;  3B7R L;  1FJW A;  4M65 A;  4RSY A;  4TMN E;  1PE8 A;  1FJ3 A;  4K5N A;  4PU2 A;  3P7T E;  1U4G A;  4XN1 A;  5LWD E;  3DO1 A;  1TRL A;  3FV4 A;  4XMW A;  3FU5 A;  4MTW E;  3QJX A;  3FTU A;  1KJO A;  4XN9 A;  5TLI A;  4OW3 A;  3MSA A;  5DPE E;  1QF1 A;  3EBI A;  4L2L A;  4ZW7 A;  3DO0 A;  3FXP A;  1KL6 A;  4XN7 A;  5JXN E;  3T8F A;  1ESP A;  1H19 A;  1LNF E;  7TLN A;  1KRO A;  3T2H E;  2TLI A;  3EIM A;  2R59 A;  4R5V A;  5DLL A;  1OS0 A;  4XO3 A;  4ZX4 A;  3FUK A;  2G4Z A;  3F28 A;  3MSF A;  1FJU A;  1FJV A;  3FGD A;  3FVP A;  1EZM A;  3P7W E;  1QF2 A;  4TLI A;  5DLH A;  1LND E;  1FJO A;  2DQM A;  2TMN E;  3FBO A;  3EBH A;  1KJP A;  3FHE A;  5TLN A;  1TLI A;  1FJT A;  3Q43 A;  3NQZ B;  6TMN E;  3B2X A;  2HPO A;  3FH5 A;  4DPR A;  3FTZ A;  3FUE A;  3TMN E;  4XO4 A;  3T2I E;  3CHP A;  5K7T A;  1HYT A;  3B7S A;  3CHS A;  3FUF A;  2XQ0 A;  1KR6 A;  4K5P A;  4GER A;  3T8V A;  3B34 A;  3FUI A;  4R5T A;  4MZN E;  3PUU A;  1LNE E;  2VQX A;  4K5M A;  1HS6 A;  6TLI A;  2HPT A;  3FUM A;  3FTV A;  4XMT A;  1PE5 A;  4H57 A;  3P7P E;  1L3F E;  3CHQ A;  3B37 A;  4QUO A;  1TMN E;  1KTO A;  2A7G E;  1NPC A;  3FUN A;  2XPY A;  5JT9 E;  4TLN A;  5TMN E;  5DPF E;  4R7L A;  4XMU A;  4Q4I A;  4ZQT A;  7TLI A;  4OI5 E;  3B7T A;  4N66 E;  3MS3 A;  4ZW8 A;  5JS3 E;  4TNL A;  2DQ6 A;  3CHR A;  4MWP E;  4XN5 A;  3NQY B;  4PW4 A;  4ZW3 A;  3FU6 A;  1Z9G E;  8TLI A;  3SSB A;  2WI0 A;  4QME A;  5FSJ A;  3FU3 A;  4K5L A;  3B2P A;  2WHZ A;  3P7S E;  1KKK A;  1SQM A;  1THL A;  3DBK A;  3F2P A;  4X2U A;  4ZX5 A;  3QH1 A;  3FUJ A;  3MSN A;  1BQB A;  2GTQ A;  3FH7 A;  3FTY A;  4GAA A;  3T74 A;  1QF0 A;  3T8D A;  4D91 A;  4QHP A;  4XMZ A;  1LNB E;  5LIF E;  3EBG A;  4N5P E;  3T8G A;  3U9W A;  3FXS A;  4ZW5 A;  5L3U E;  3LS7 A;  4XN2 A;  3T87 A;  1LML A;  3FTW A;  5L41 E;  3Q44 A;  4PVB A;  4R5X A;  3FCQ A;  3FUL A;  5A3Y A;  4ZX3 A;  5JVI E;  1GW6 A;  2ZXG A;  4XND A;  3N21 A;  4XMX A;  3TLI A;  3FOR A;  3FTX A;  1LNC E;  4XMV A;  5FWQ A;  3T8C A;  1FJQ A;  4MS6 A;  3FH8 A;  3FUH A;  3B3B A;  4XNA A;  3FUD A;  4K5O A;  5FXN A;  3ZI6 A;  3B7U X;  1ZDP E;  1Y3G E;  3FTS A;  3NN7 A;  3T2J E;  4D9W A;  1TLX A;  3P7Q E;  3T73 A;  4XN8 A;  5HQD A;  3CIA A;  3CHO A;  3P7U E;  3P7V E;  2TLX A;  4N4E E;  3QH5 A;  4XNB A;  3T8H A;  4XO5 A;  8TLN E;  4QIR A;  1PE7 A;  3DNZ A;  3FU0 A;  5DYF A;  3FB0 A;  5FSP A;  4MXJ E;  3P7R E;  4K89 A;  5AEN A;  3QGO A;  1TLP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...