1EZMA

Three-dimensional structure of the elastase of pseudomonas aeruginosa at 1.5 angstroms resolution
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
298
structure length
298
Chain Sequence
AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the elastase of Pseudomonas aeruginosa at 1.5-A resolution.
pubmed rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords PSEUDOMONAS ELASTASE
total genus 114
structure length 298
sequence length 298
ec nomenclature ec 3.4.24.26: Pseudolysin.
pdb deposition date 1992-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 1ezmA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 1ezmA01
2TLXA 1PE7A 3FHEA 3MS3A 5FSSA 5TLNA 3DNZA 4K90A 1KEIA 1EZMA 3FUNA 3T2HE 2HPOA 4PVBA 4MS6A 5DLLA 4XO3A 3B2XA 3B7RL 1Y3GE 4N5PE 3FTSA 3N21A 3FUDA 3CHOA 3SSBA 4MTWE 5TMNE 1ESPA 3FB0A 4ZW7A 5HQDA 3FU3A 4ZX3A 4TLNA 4XN8A 4DPRA 4XMWA 1KR6A 3FUKA 4OW3A 3DO1A 3FULA 4XO4A 5DPFE 3B3BA 3CIAA 3NQYB 1Z9GE 5K7TA 4TNLA 5AENA 1TRLA 1FJ3A 4ZQTA 1BQBA 3FXSA 4ZX6A 2HPTA 4D9WA 4MZNE 1LNBE 3DO0A 1THLA 4D91A 3FUIA 3T8CA 3NN7A 3FTYA 1H19A 6TMNE 3B7TA 3FV4A 4XMVA 3T8VA 4ZW3A 2G4ZA 3T2IE 3FTUA 1GW6A 3FCQA 3EBHA 3FH8A 3KEDA 4K5PA 4XO5A 7TLIA 1TMNE 3F28A 3MSAA 3NQZB 4GAAA 4QPEA 3MSNA 4Q4IA 5FSJA 3TLIA 3B7UX 3FU0A 1KKKA 3P7QE 1KL6A 3EBGA 3LS7A 5JVIE 1LNEE 3CHQA 4XN2A 1FJTA 4J3BA 1PE5A 1KTOA 1TLXA 2XPZA 5TLIA 5LWDE 4K89A 4MXJE 2WHZA 5FXNA 4K5MA 1TLIA 1U4GA 5FSPA 3FTWA 4MKTA 5DLHA 4XN5A 2R59A 5L3UE 3B37A 3FTXA 3FLFA 3ZI6A 3FVPA 1PE8A 4B52A 7TLNA 4N4EE 4XN7A 4XMXA 4TMNE 4R5VA 8TLNE 3T8DA 3MSFA 1FJUA 3DO2A 3DBKA 3F2PA 1KJOA 4XN1A 1ZDPE 2DQMA 3FUHA 3CHRA 1QF2A 1FJOA 3NQXA 4PW4A 4ZX4A 3FUJA 3T73A 5JS3E 4L2LA 5FWQA 3FU5A 1KJPA 3P7UE 5DPEE 3B2PA 4QIRA 2DQ6A 3P7WE 4QHPA 5DYFA 4RSYA 2XQ0A 4K5OA 3T2JE 4XNDA 1OS0A 1HS6A 3T74A 3QJXA 3EIMA 2A7GE 3T87A 4XMTA 2TMNE 1FJQA 1QF0A 4H57A 3QH5A 4QMEA 3EBIA 3CHSA 1GXWA 2VJ8A 3FGDA 3FH7A 3FXPA 3P7TE 4N66E 4K5NA 4R7LA 1HYTA 4ZX5A 1SQMA 3P7SE 4ZW8A 3FBOA 1TLPE 1LNCE 4Q4EA 2WI0A 5JT9E 4R5TA 4R5XA 3P7VE 3T8GA 4TLIA 4XN4A 3QH1A 5BPPA 3Q43A 4ZW5A 4PU2A 3P7RE 4MWPE 3FTVA 6TLIA 5JSSE 3FTZA 3T8HA 4OI5E 4QUOA 1NPCA 3CHPA 3PUUA 3FH5A 4RVBA 3B34A 2XPYA 3B7SA 4X2UA 4ZW6A 3FUMA 4M65A 3QGOA 1QF1A 1KROA 3FU6A 1LNAE 3FUEA 5L8PE 4GERA 2TLIA 1FJVA 3Q44A 4XMUA 3U9WA 3FUFA 5L41E 4XMZA 4XNBA 4XN9A 5A3YA 4K5LA 3T8FA 3TMNE 2VQXA 1LNDE 2ZXGA 8TLIA 5JXNE 5LIFE 1LNFE 4XNAA 1FJWA 1KS7A 1L3FE 3P7PE 3FORA 2GTQA
chains in the Genus database with same CATH superfamily
2TLXA 4NZ8A 1PE7A 3FHEA 3MS3A 4KXCA 5FSSA 3DNZA 4K90A 5TLNA 1KEIA 5LG6A 1EZMA 3FUNA 5K1VA 2HPOA 4FYTA 4MS6A 4PJ6A 5DLLA 3T2HE 4PVBA 1LMLA 4II7A 4XO3A 3B2XA 3B7RL 1Y3GE 3MDJA 4N5PE 5LDSA 3FTSA 3N21A 3FUDA 3CHOA 3SSBA 4MTWE 5TMNE 1ESPA 3FB0A 4FKKA 4ZW7A 4KXDA 3FU3A 4ZX3A 5HQDA 4TLNA 4XN8A 4DPRA 4XMWA 1KR6A 3FUKA 4OW3A 3DO1A 4KX7A 3FULA 4XO4A 5DPFE 4KXAA 3B3BA 3CIAA 3NQYB 1Z9GE 5K7TA 4TNLA 5AENA 1TRLA 1FJ3A 4ZQTA 1BQBA 3FXSA 4ZX6A 2HPTA 4WZ9A 4D9WA 4MZNE 1LNBE 3DO0A 1THLA 4IHQA 4D91A 3FUIA 3T8CA 3NN7A 3FTYA 1H19A 6TMNE 3B7TA 3FV4A 4XMVA 3T8VA 4ZW3A 2G4ZA 3T2IE 4KX9A 3FTUA 5EV7A 1GW6A 3FCQA 3EBHA 3FH8A 3KEDA 4K5PA 4XO5A 5CU5A 1TMNE 4F5CA 7TLIA 3F28A 3MSAA 3NQZB 4GAAA 4QPEA 3MSNA 4Q4IA 5FSJA 3TLIA 3B7UX 3FU0A 1KKKA 3P7QE 4FKHA 5AB0A 1KL6A 3EBGA 3LS7A 5JVIE 1LNEE 3CHQA 4XN2A 1FJTA 4J3BA 1PE5A 1KTOA 5LHDA 1TLXA 2XPZA 5TLIA 5LWDE 1Z5HA 4K89A 4MXJE 2WHZA 5FXNA 4K5MA 1TLIA 1U4GA 5FSPA 3FTWA 4MKTA 4KX8A 5DLHA 4NAQA 4XN5A 2R59A 5L3UE 3B37A 3FTXA 3FLFA 4FYQA 3ZI6A 3FVPA 1PE8A 4B52A 7TLNA 4N4EE 4XN7A 4XMXA 4KXBA 4TMNE 4R5VA 8TLNE 3T8DA 4AR8A 3MSFA 1FJUA 3DO2A 3DBKA 3F2PA 1KJOA 4XN1A 1ZDPE 2DQMA 3FUHA 3CHRA 1QF2A 1FJOA 3NQXA 4PW4A 4ZX4A 4AR9A 3FUJA 4FGMA 3T73A 5JS3E 4L2LA 5FWQA 3FU5A 5J6SA 1KJPA 3P7UE 5DPEE 3B2PA 4QIRA 2DQ6A 3P7WE 4QHPA 5DYFA 4RSYA 2XQ0A 4K5OA 3T2JE 4XNDA 4E36A 1OS0A 1HS6A 4FCAA 3T74A 3QJXA 3EIMA 2A7GE 3T87A 4XMTA 2TMNE 1FJQA 1QF0A 4H57A 3QH5A 4QMEA 3EBIA 3CHSA 1GXWA 2VJ8A 3FGDA 3FH7A 3FXPA 3P7TE 4N66E 4K5NA 4R7LA 1HYTA 1Z1WA 4ZX5A 1SQMA 3P7SE 4ZW8A 3FBOA 1TLPE 1LNCE 4Q4EA 2WI0A 5JT9E 4R5TA 4FYRA 4FKEA 4R5XA 3P7VE 3T8GA 4TLIA 4XN4A 5C97A 3QH1A 5BPPA 3Q43A 4ZW5A 4PU2A 3P7RE 5AB2A 4MWPE 3FTVA 6TLIA 5JSSE 3QNFA 3FTZA 3T8HA 4OI5E 4QUOA 1NPCA 3CHPA 3PUUA 3FH5A 4RVBA 3B34A 2XPYA 3B7SA 4X2UA 4ZW6A 4AR1A 4P8QA 3FUMA 4M65A 3QGOA 1QF1A 1KROA 3FU6A 1LNAE 3FUEA 3Q7JA 4FYSA 4GERA 5L8PE 2TLIA 1FJVA 3Q44A 4XMUA 3U9WA 4OU3A 3FUFA 5L41E 4HOMA 4XMZA 4XNBA 4XN9A 5A3YA 4K5LA 3T8FA 3SE6A 3TMNE 2VQXA 1LNDE 2YD0A 2ZXGA 4JBSA 4ARFA 8TLIA 1LNFE 4XNAA 4Z7IA 5JXNE 1FJWA 1KS7A 5LIFE 1L3FE 3P7PE 3FORA 2GTQA
chains in the Genus database with same CATH topology
2TLXA 1PE7A 3FHEA 3MS3A 5FSSA 5TLNA 3DNZA 4K90A 1KEIA 1EZMA 3FUNA 3T2HE 2HPOA 4PVBA 4MS6A 5DLLA 1LMLA 4XO3A 3B2XA 3B7RL 1Y3GE 4N5PE 3FTSA 3N21A 3FUDA 3CHOA 3SSBA 4MTWE 5TMNE 1ESPA 3FB0A 4ZW7A 5HQDA 3FU3A 4ZX3A 4TLNA 4XN8A 4DPRA 4XMWA 1KR6A 3FUKA 4OW3A 3DO1A 3FULA 4XO4A 5DPFE 3B3BA 3CIAA 3NQYB 1Z9GE 5K7TA 4TNLA 5AENA 1TRLA 1FJ3A 4ZQTA 1BQBA 3FXSA 4ZX6A 2HPTA 4D9WA 4MZNE 1LNBE 3DO0A 1THLA 4D91A 3FUIA 3T8CA 3NN7A 3FTYA 1H19A 6TMNE 3B7TA 3FV4A 4XMVA 3T8VA 4ZW3A 2G4ZA 3T2IE 3FTUA 1GW6A 3FCQA 3EBHA 3FH8A 3KEDA 4K5PA 4XO5A 7TLIA 1TMNE 3F28A 3MSAA 3NQZB 4GAAA 4QPEA 3MSNA 4Q4IA 5FSJA 3TLIA 3B7UX 3FU0A 1KKKA 3P7QE 1KL6A 3EBGA 3LS7A 5JVIE 1LNEE 3CHQA 4XN2A 1FJTA 4J3BA 1PE5A 1KTOA 1TLXA 2XPZA 5TLIA 5LWDE 4K89A 4MXJE 2WHZA 5FXNA 4K5MA 1TLIA 1U4GA 5FSPA 3FTWA 4MKTA 5DLHA 4XN5A 2R59A 5L3UE 3B37A 3FTXA 3FLFA 3ZI6A 3FVPA 1PE8A 4B52A 7TLNA 4N4EE 4XN7A 4XMXA 4TMNE 4R5VA 8TLNE 3T8DA 3MSFA 1FJUA 3DO2A 3DBKA 3F2PA 1KJOA 4XN1A 1ZDPE 2DQMA 3FUHA 3CHRA 1QF2A 1FJOA 3NQXA 4PW4A 4ZX4A 3FUJA 3T73A 5JS3E 4L2LA 5FWQA 3FU5A 1KJPA 3P7UE 5DPEE 3B2PA 4QIRA 2DQ6A 3P7WE 4QHPA 5DYFA 4RSYA 2XQ0A 4K5OA 3T2JE 4XNDA 1OS0A 1HS6A 3T74A 3QJXA 3EIMA 2A7GE 3T87A 4XMTA 2TMNE 1FJQA 1QF0A 4H57A 3QH5A 4QMEA 3EBIA 3CHSA 1GXWA 2VJ8A 3FGDA 3FH7A 3FXPA 3P7TE 4N66E 4K5NA 4R7LA 1HYTA 4ZX5A 1SQMA 3P7SE 4ZW8A 3FBOA 1TLPE 1LNCE 4Q4EA 2WI0A 5JT9E 4R5TA 4R5XA 3P7VE 3T8GA 4TLIA 4XN4A 3QH1A 5BPPA 3Q43A 4ZW5A 4PU2A 3P7RE 4MWPE 3FTVA 6TLIA 5JSSE 3FTZA 3T8HA 4OI5E 4QUOA 1NPCA 3CHPA 3PUUA 3FH5A 4RVBA 3B34A 2XPYA 3B7SA 4X2UA 4ZW6A 3FUMA 4M65A 3QGOA 1QF1A 1KROA 3FU6A 1LNAE 3FUEA 5L8PE 4GERA 2TLIA 1FJVA 3Q44A 4XMUA 3U9WA 3FUFA 5L41E 4XMZA 4XNBA 4XN9A 5A3YA 4K5LA 3T8FA 3TMNE 2VQXA 1LNDE 2ZXGA 8TLIA 5JXNE 5LIFE 1LNFE 4XNAA 1FJWA 1KS7A 1L3FE 3P7PE 3FORA 2GTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TLX A;  1PE7 A;  3FHE A;  3MS3 A;  5FSS A;  5TLN A;  3DNZ A;  4K90 A;  1KEI A;  1EZM A;  3FUN A;  3T2H E;  2HPO A;  4PVB A;  4MS6 A;  5DLL A;  4XO3 A;  3B2X A;  3B7R L;  1Y3G E;  4N5P E;  3FTS A;  3N21 A;  3FUD A;  3CHO A;  3SSB A;  4MTW E;  5TMN E;  1ESP A;  3FB0 A;  4ZW7 A;  5HQD A;  3FU3 A;  4ZX3 A;  4TLN A;  4XN8 A;  4DPR A;  4XMW A;  1KR6 A;  3FUK A;  4OW3 A;  3DO1 A;  3FUL A;  4XO4 A;  5DPF E;  3B3B A;  3CIA A;  3NQY B;  1Z9G E;  5K7T A;  4TNL A;  5AEN A;  1TRL A;  1FJ3 A;  4ZQT A;  1BQB A;  3FXS A;  4ZX6 A;  2HPT A;  4D9W A;  4MZN E;  1LNB E;  3DO0 A;  1THL A;  4D91 A;  3FUI A;  3T8C A;  3NN7 A;  3FTY A;  1H19 A;  6TMN E;  3B7T A;  3FV4 A;  4XMV A;  3T8V A;  4ZW3 A;  2G4Z A;  3T2I E;  3FTU A;  1GW6 A;  3FCQ A;  3EBH A;  3FH8 A;  3KED A;  4K5P A;  4XO5 A;  7TLI A;  1TMN E;  3F28 A;  3MSA A;  3NQZ B;  4GAA A;  4QPE A;  3MSN A;  4Q4I A;  5FSJ A;  3TLI A;  3B7U X;  3FU0 A;  1KKK A;  3P7Q E;  1KL6 A;  3EBG A;  3LS7 A;  5JVI E;  1LNE E;  3CHQ A;  4XN2 A;  1FJT A;  4J3B A;  1PE5 A;  1KTO A;  1TLX A;  2XPZ A;  5TLI A;  5LWD E;  4K89 A;  4MXJ E;  2WHZ A;  5FXN A;  4K5M A;  1TLI A;  1U4G A;  5FSP A;  3FTW A;  4MKT A;  5DLH A;  4XN5 A;  2R59 A;  5L3U E;  3B37 A;  3FTX A;  3FLF A;  3ZI6 A;  3FVP A;  1PE8 A;  4B52 A;  7TLN A;  4N4E E;  4XN7 A;  4XMX A;  4TMN E;  4R5V A;  8TLN E;  3T8D A;  3MSF A;  1FJU A;  3DO2 A;  3DBK A;  3F2P A;  1KJO A;  4XN1 A;  1ZDP E;  2DQM A;  3FUH A;  3CHR A;  1QF2 A;  1FJO A;  3NQX A;  4PW4 A;  4ZX4 A;  3FUJ A;  3T73 A;  5JS3 E;  4L2L A;  5FWQ A;  3FU5 A;  1KJP A;  3P7U E;  5DPE E;  3B2P A;  4QIR A;  2DQ6 A;  3P7W E;  4QHP A;  5DYF A;  4RSY A;  2XQ0 A;  4K5O A;  3T2J E;  4XND A;  1OS0 A;  1HS6 A;  3T74 A;  3QJX A;  3EIM A;  2A7G E;  3T87 A;  4XMT A;  2TMN E;  1FJQ A;  1QF0 A;  4H57 A;  3QH5 A;  4QME A;  3EBI A;  3CHS A;  1GXW A;  2VJ8 A;  3FGD A;  3FH7 A;  3FXP A;  3P7T E;  4N66 E;  4K5N A;  4R7L A;  1HYT A;  4ZX5 A;  1SQM A;  3P7S E;  4ZW8 A;  3FBO A;  1TLP E;  1LNC E;  4Q4E A;  2WI0 A;  5JT9 E;  4R5T A;  4R5X A;  3P7V E;  3T8G A;  4TLI A;  4XN4 A;  3QH1 A;  5BPP A;  3Q43 A;  4ZW5 A;  4PU2 A;  3P7R E;  4MWP E;  3FTV A;  6TLI A;  5JSS E;  3FTZ A;  3T8H A;  4OI5 E;  4QUO A;  1NPC A;  3CHP A;  3PUU A;  3FH5 A;  4RVB A;  3B34 A;  2XPY A;  3B7S A;  4X2U A;  4ZW6 A;  3FUM A;  4M65 A;  3QGO A;  1QF1 A;  1KRO A;  3FU6 A;  1LNA E;  3FUE A;  5L8P E;  4GER A;  2TLI A;  1FJV A;  3Q44 A;  4XMU A;  3U9W A;  3FUF A;  5L41 E;  4XMZ A;  4XNB A;  4XN9 A;  5A3Y A;  4K5L A;  3T8F A;  3TMN E;  2VQX A;  1LND E;  2ZXG A;  8TLI A;  5JXN E;  5LIF E;  1LNF E;  4XNA A;  1FJW A;  1KS7 A;  1L3F E;  3P7P E;  3FOR A;  2GTQ A; 
#chains in the Genus database with same CATH topology
 2TLX A;  4NZ8 A;  1PE7 A;  3FHE A;  3MS3 A;  4KXC A;  5FSS A;  3DNZ A;  4K90 A;  5TLN A;  1KEI A;  5LG6 A;  1EZM A;  3FUN A;  5K1V A;  2HPO A;  4FYT A;  4MS6 A;  4PJ6 A;  5DLL A;  3T2H E;  4PVB A;  1LML A;  4II7 A;  4XO3 A;  3B2X A;  3B7R L;  1Y3G E;  3MDJ A;  4N5P E;  5LDS A;  3FTS A;  3N21 A;  3FUD A;  3CHO A;  3SSB A;  4MTW E;  5TMN E;  1ESP A;  3FB0 A;  4FKK A;  4ZW7 A;  4KXD A;  3FU3 A;  4ZX3 A;  5HQD A;  4TLN A;  4XN8 A;  4DPR A;  4XMW A;  1KR6 A;  3FUK A;  4OW3 A;  3DO1 A;  4KX7 A;  3FUL A;  4XO4 A;  5DPF E;  4KXA A;  3B3B A;  3CIA A;  3NQY B;  1Z9G E;  5K7T A;  4TNL A;  5AEN A;  1TRL A;  1FJ3 A;  4ZQT A;  1BQB A;  3FXS A;  4ZX6 A;  2HPT A;  4WZ9 A;  4D9W A;  4MZN E;  1LNB E;  3DO0 A;  1THL A;  4IHQ A;  4D91 A;  3FUI A;  3T8C A;  3NN7 A;  3FTY A;  1H19 A;  6TMN E;  3B7T A;  3FV4 A;  4XMV A;  3T8V A;  4ZW3 A;  2G4Z A;  3T2I E;  4KX9 A;  3FTU A;  5EV7 A;  1GW6 A;  3FCQ A;  3EBH A;  3FH8 A;  3KED A;  4K5P A;  4XO5 A;  5CU5 A;  1TMN E;  4F5C A;  7TLI A;  3F28 A;  3MSA A;  3NQZ B;  4GAA A;  4QPE A;  3MSN A;  4Q4I A;  5FSJ A;  3TLI A;  3B7U X;  3FU0 A;  1KKK A;  3P7Q E;  4FKH A;  5AB0 A;  1KL6 A;  3EBG A;  3LS7 A;  5JVI E;  1LNE E;  3CHQ A;  4XN2 A;  1FJT A;  4J3B A;  1PE5 A;  1KTO A;  5LHD A;  1TLX A;  2XPZ A;  5TLI A;  5LWD E;  1Z5H A;  4K89 A;  4MXJ E;  2WHZ A;  5FXN A;  4K5M A;  1TLI A;  1U4G A;  5FSP A;  3FTW A;  4MKT A;  4KX8 A;  5DLH A;  4NAQ A;  4XN5 A;  2R59 A;  5L3U E;  3B37 A;  3FTX A;  3FLF A;  4FYQ A;  3ZI6 A;  3FVP A;  1PE8 A;  4B52 A;  7TLN A;  4N4E E;  4XN7 A;  4XMX A;  4KXB A;  4TMN E;  4R5V A;  8TLN E;  3T8D A;  4AR8 A;  3MSF A;  1FJU A;  3DO2 A;  3DBK A;  3F2P A;  1KJO A;  4XN1 A;  1ZDP E;  2DQM A;  3FUH A;  3CHR A;  1QF2 A;  1FJO A;  3NQX A;  4PW4 A;  4ZX4 A;  4AR9 A;  3FUJ A;  4FGM A;  3T73 A;  5JS3 E;  4L2L A;  5FWQ A;  3FU5 A;  5J6S A;  1KJP A;  3P7U E;  5DPE E;  3B2P A;  4QIR A;  2DQ6 A;  3P7W E;  4QHP A;  5DYF A;  4RSY A;  2XQ0 A;  4K5O A;  3T2J E;  4XND A;  4E36 A;  1OS0 A;  1HS6 A;  4FCA A;  3T74 A;  3QJX A;  3EIM A;  2A7G E;  3T87 A;  4XMT A;  2TMN E;  1FJQ A;  1QF0 A;  4H57 A;  3QH5 A;  4QME A;  3EBI A;  3CHS A;  1GXW A;  2VJ8 A;  3FGD A;  3FH7 A;  3FXP A;  3P7T E;  4N66 E;  4K5N A;  4R7L A;  1HYT A;  1Z1W A;  4ZX5 A;  1SQM A;  3P7S E;  4ZW8 A;  3FBO A;  1TLP E;  1LNC E;  4Q4E A;  2WI0 A;  5JT9 E;  4R5T A;  4FYR A;  4FKE A;  4R5X A;  3P7V E;  3T8G A;  4TLI A;  4XN4 A;  5C97 A;  3QH1 A;  5BPP A;  3Q43 A;  4ZW5 A;  4PU2 A;  3P7R E;  5AB2 A;  4MWP E;  3FTV A;  6TLI A;  5JSS E;  3QNF A;  3FTZ A;  3T8H A;  4OI5 E;  4QUO A;  1NPC A;  3CHP A;  3PUU A;  3FH5 A;  4RVB A;  3B34 A;  2XPY A;  3B7S A;  4X2U A;  4ZW6 A;  4AR1 A;  4P8Q A;  3FUM A;  4M65 A;  3QGO A;  1QF1 A;  1KRO A;  3FU6 A;  1LNA E;  3FUE A;  3Q7J A;  4FYS A;  4GER A;  5L8P E;  2TLI A;  1FJV A;  3Q44 A;  4XMU A;  3U9W A;  4OU3 A;  3FUF A;  5L41 E;  4HOM A;  4XMZ A;  4XNB A;  4XN9 A;  5A3Y A;  4K5L A;  3T8F A;  3SE6 A;  3TMN E;  2VQX A;  1LND E;  2YD0 A;  2ZXG A;  4JBS A;  4ARF A;  8TLI A;  1LNF E;  4XNA A;  4Z7I A;  5JXN E;  1FJW A;  1KS7 A;  5LIF E;  1L3F E;  3P7P E;  3FOR A;  2GTQ A; 
#chains in the Genus database with same CATH homology
 2TLX A;  1PE7 A;  3FHE A;  3MS3 A;  5FSS A;  5TLN A;  3DNZ A;  4K90 A;  1KEI A;  1EZM A;  3FUN A;  3T2H E;  2HPO A;  4PVB A;  4MS6 A;  5DLL A;  1LML A;  4XO3 A;  3B2X A;  3B7R L;  1Y3G E;  4N5P E;  3FTS A;  3N21 A;  3FUD A;  3CHO A;  3SSB A;  4MTW E;  5TMN E;  1ESP A;  3FB0 A;  4ZW7 A;  5HQD A;  3FU3 A;  4ZX3 A;  4TLN A;  4XN8 A;  4DPR A;  4XMW A;  1KR6 A;  3FUK A;  4OW3 A;  3DO1 A;  3FUL A;  4XO4 A;  5DPF E;  3B3B A;  3CIA A;  3NQY B;  1Z9G E;  5K7T A;  4TNL A;  5AEN A;  1TRL A;  1FJ3 A;  4ZQT A;  1BQB A;  3FXS A;  4ZX6 A;  2HPT A;  4D9W A;  4MZN E;  1LNB E;  3DO0 A;  1THL A;  4D91 A;  3FUI A;  3T8C A;  3NN7 A;  3FTY A;  1H19 A;  6TMN E;  3B7T A;  3FV4 A;  4XMV A;  3T8V A;  4ZW3 A;  2G4Z A;  3T2I E;  3FTU A;  1GW6 A;  3FCQ A;  3EBH A;  3FH8 A;  3KED A;  4K5P A;  4XO5 A;  7TLI A;  1TMN E;  3F28 A;  3MSA A;  3NQZ B;  4GAA A;  4QPE A;  3MSN A;  4Q4I A;  5FSJ A;  3TLI A;  3B7U X;  3FU0 A;  1KKK A;  3P7Q E;  1KL6 A;  3EBG A;  3LS7 A;  5JVI E;  1LNE E;  3CHQ A;  4XN2 A;  1FJT A;  4J3B A;  1PE5 A;  1KTO A;  1TLX A;  2XPZ A;  5TLI A;  5LWD E;  4K89 A;  4MXJ E;  2WHZ A;  5FXN A;  4K5M A;  1TLI A;  1U4G A;  5FSP A;  3FTW A;  4MKT A;  5DLH A;  4XN5 A;  2R59 A;  5L3U E;  3B37 A;  3FTX A;  3FLF A;  3ZI6 A;  3FVP A;  1PE8 A;  4B52 A;  7TLN A;  4N4E E;  4XN7 A;  4XMX A;  4TMN E;  4R5V A;  8TLN E;  3T8D A;  3MSF A;  1FJU A;  3DO2 A;  3DBK A;  3F2P A;  1KJO A;  4XN1 A;  1ZDP E;  2DQM A;  3FUH A;  3CHR A;  1QF2 A;  1FJO A;  3NQX A;  4PW4 A;  4ZX4 A;  3FUJ A;  3T73 A;  5JS3 E;  4L2L A;  5FWQ A;  3FU5 A;  1KJP A;  3P7U E;  5DPE E;  3B2P A;  4QIR A;  2DQ6 A;  3P7W E;  4QHP A;  5DYF A;  4RSY A;  2XQ0 A;  4K5O A;  3T2J E;  4XND A;  1OS0 A;  1HS6 A;  3T74 A;  3QJX A;  3EIM A;  2A7G E;  3T87 A;  4XMT A;  2TMN E;  1FJQ A;  1QF0 A;  4H57 A;  3QH5 A;  4QME A;  3EBI A;  3CHS A;  1GXW A;  2VJ8 A;  3FGD A;  3FH7 A;  3FXP A;  3P7T E;  4N66 E;  4K5N A;  4R7L A;  1HYT A;  4ZX5 A;  1SQM A;  3P7S E;  4ZW8 A;  3FBO A;  1TLP E;  1LNC E;  4Q4E A;  2WI0 A;  5JT9 E;  4R5T A;  4R5X A;  3P7V E;  3T8G A;  4TLI A;  4XN4 A;  3QH1 A;  5BPP A;  3Q43 A;  4ZW5 A;  4PU2 A;  3P7R E;  4MWP E;  3FTV A;  6TLI A;  5JSS E;  3FTZ A;  3T8H A;  4OI5 E;  4QUO A;  1NPC A;  3CHP A;  3PUU A;  3FH5 A;  4RVB A;  3B34 A;  2XPY A;  3B7S A;  4X2U A;  4ZW6 A;  3FUM A;  4M65 A;  3QGO A;  1QF1 A;  1KRO A;  3FU6 A;  1LNA E;  3FUE A;  5L8P E;  4GER A;  2TLI A;  1FJV A;  3Q44 A;  4XMU A;  3U9W A;  3FUF A;  5L41 E;  4XMZ A;  4XNB A;  4XN9 A;  5A3Y A;  4K5L A;  3T8F A;  3TMN E;  2VQX A;  1LND E;  2ZXG A;  8TLI A;  5JXN E;  5LIF E;  1LNF E;  4XNA A;  1FJW A;  1KS7 A;  1L3F E;  3P7P E;  3FOR A;  2GTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...