4B52A

Crystal structure of gentlyase, the neutral metalloprotease of paenibacillus polymyxa
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
304
structure length
304
Chain Sequence
ATGTGKGVLGDTKSFTTTASGSSYQLKDTTRGNGVVTYTASNRQSIPGTILTDADNVWNDPAGVDAHTYAAKTYDYYKAKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGSTFIAFSGDPDVVGHELTHGVTEYTSNLEYYGESGALNEAFSDVIGNDIQRKNWLVGDDIYTPNIAGDALRSMSNPTLYDQPDHYSNLYTGSSDNGGVHTNSGIINKAYYLLAQGGTFHGVTVNGIGRDAAVQIYYSAFTNYLTSSSDFSNARAAVIQAAKDQYGANSAEATAAAKSFDAVGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACILLOLYSIN
publication title Structure of Gentlyase, the Neutral Metalloprotease of Paenibacillus Polymyxa
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 108
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 3.4.24.4: Transferred entry: 3.4.24.25, 3.4.24.26, 3.4.24.27, 3.4.24.28, 3.4.24.29,
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 4b52A02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 4b52A01
3MSFA 3FTUA 4K5NA 4R7LA 1LNFE 3FTZA 3SSBA 3T74A 4XMUA 3FTVA 3NN7A 4K5MA 1KKKA 4Q4EA 3P7UE 3T8DA 5L8PE 2GTQA 3CHRA 4OW3A 4RSYA 1L3FE 2DQMA 3T8HA 1FJUA 4XN1A 4GERA 4ZW7A 1SQMA 1ZDPE 4ZX3A 8TLNE 3T87A 1FJQA 3NQXA 4M65A 3T73A 3FUDA 2VJ8A 5JS3E 3P7SE 5TLIA 3FB0A 4N66E 4XN7A 3B7RL 4XMZA 5TMNE 1THLA 1FJTA 5DPEE 4PU2A 4ZW5A 3LS7A 4K89A 7TLNA 5FSSA 3QH1A 3MS3A 3T8CA 4MS6A 3T8FA 4MXJE 2A7GE 3CHOA 4PW4A 3FORA 4ZW3A 1KJOA 3FUNA 4K5OA 3DNZA 4XNAA 3FLFA 4QHPA 2VQXA 1BQBA 3QGOA 2WHZA 3EBHA 1KROA 1QF1A 3FHEA 1OS0A 4XNDA 3FULA 3FH7A 1TLXA 4TNLA 5JVIE 3FTYA 3B7TA 3QJXA 1TLIA 4MWPE 3Q44A 3NQYB 2WI0A 3B2PA 4N4EE 5LWDE 3B7SA 1PE5A 1GXWA 3DO0A 3EBIA 3FU0A 4K5LA 5AENA 3T2JE 3ZI6A 1LNEE 5A3YA 5BPPA 1NPCA 3P7WE 5K7TA 1TMNE 2HPTA 4XN2A 5JT9E 4TLNA 4XO4A 1KTOA 1LNAE 1KEIA 8TLIA 4QPEA 2ZXGA 4QMEA 5L41E 4RVBA 1ESPA 5FSPA 1KR6A 5FXNA 3B34A 3FTXA 3EIMA 4TLIA 4XO5A 3F28A 4X2UA 2TLIA 5JXNE 3FV4A 5DLHA 4XO3A 4GAAA 4XMWA 4DPRA 1H19A 3NQZB 4XMTA 3P7QE 3CHSA 3T2HE 4D91A 3FH8A 2XPZA 5DLLA 3FU5A 3MSAA 4K90A 1EZMA 1FJOA 2TLXA 3EBGA 3QH5A 4XN8A 3MSNA 4L2LA 4D9WA 1Y3GE 4ZX5A 2G4ZA 1GW6A 4ZQTA 3FGDA 3FUFA 3FXPA 3KEDA 3DO2A 4MZNE 4QUOA 1Z9GE 4N5PE 1KJPA 1LNDE 4J3BA 3TLIA 3TMNE 2XQ0A 4PVBA 2TMNE 3FXSA 4XNBA 4R5XA 5TLNA 1KL6A 3PUUA 1U4GA 3Q43A 3CHPA 1LNCE 4MKTA 3B7UX 3FUKA 4R5VA 3T8VA 7TLIA 3CHQA 2DQ6A 1QF0A 1FJ3A 1QF2A 6TLIA 5HQDA 3FUMA 3B37A 4B52A 3FTWA 1PE8A 1HYTA 3FUHA 4TMNE 3FH5A 4XN4A 4XN9A 4ZX4A 1LNBE 5FWQA 3U9WA 3B2XA 3N21A 5DPFE 3FU3A 3FCQA 4OI5E 3P7TE 3FU6A 4QIRA 2R59A 3F2PA 1TRLA 3FUIA 4ZW8A 1HS6A 4ZW6A 5FSJA 5L3UE 5DYFA 4R5TA 3FUEA 4XN5A 4Q4IA 3FBOA 3DBKA 3FVPA 2XPYA 4K5PA 3DO1A 4XMXA 4XMVA 4MTWE 5JSSE 6TMNE 3FTSA 5LIFE 2HPOA 3T8GA 1PE7A 3P7VE 3CIAA 3T2IE 3FUJA 4H57A 4ZX6A 1KS7A 1TLPE 3B3BA 3P7RE 1FJVA 1FJWA 3P7PE
chains in the Genus database with same CATH superfamily
4R7LA 4XMUA 5L8PE 1KKKA 1L3FE 2YD0A 1FJUA 4XN1A 4ZW7A 1ZDPE 3T87A 3T73A 4AR9A 2VJ8A 5TLIA 4N66E 4XMZA 5CU5A 3LS7A 7TLNA 3QH1A 3T8FA 4PW4A 3FUNA 4P8QA 4XNDA 3FH7A 1TLXA 3FTYA 4AR8A 2WI0A 1PE5A 3FU0A 1LNEE 5K7TA 4RVBA 5FSPA 1KR6A 5FXNA 3B34A 3FTXA 3EIMA 4DPRA 4HOMA 3P7QE 3T2HE 4K90A 4XN8A 4D9WA 2G4ZA 3FGDA 3KEDA 3DO2A 4MZNE 3TLIA 1KJPA 1LNDE 5J6SA 2TMNE 4JBSA 3CHPA 4FYQA 4R5VA 7TLIA 1FJ3A 1PE8A 1LNBE 3N21A 3FCQA 3FU6A 1HS6A 5FSJA 5LG6A 3FBOA 2XPYA 4K5PA 4XMXA 4MTWE 1PE7A 3T2IE 1TLPE 3B3BA 4N4EE 4ZX5A 1FJVA 3T74A 4Q4EA 2GTQA 5C97A 1FJQA 4M65A 5JS3E 1FJTA 5DPEE 5LDSA 4K89A 4WZ9A 3MS3A 3T8CA 4MS6A 4ZW3A 4FKEA 1KJOA 4K5OA 3DNZA 3FLFA 4QHPA 4NAQA 3QGOA 4KX8A 4TNLA 3QJXA 1TLIA 5LWDE 4K5LA 4NZ8A 1TMNE 4KX9A 5JT9E 4TLNA 4OU3A 4QPEA 4QMEA 4TLIA 3F28A 4II7A 5JXNE 5DLHA 4XMWA 3NQZB 3CHSA 4D91A 3FU5A 3MSAA 1FJOA 3EBGA 4QUOA 3FXSA 4XNBA 3PUUA 3Q43A 5HQDA 4B52A 3FTWA 3FUHA 4ZX4A 3U9WA 5DPFE 3FU3A 4QIRA 1TRLA 4ZW8A 3SE6A 5L3UE 3FVPA 6TMNE 2HPOA 3T8GA 3FUJA 4H57A 3P7RE 3MSFA 3FTUA 3FTVA 4RSYA 4ZX3A 3NQXA 3FUDA 4KXDA 4XN7A 3B7RL 4ARFA 1THLA 5FSSA 4F5CA 4MXJE 2A7GE 3FORA 4AR1A 2VQXA 1BQBA 3EBHA 3FHEA 1OS0A 3FULA 4KX7A 3Q44A 3NQYB 3B2PA 1GXWA 5AB0A 3EBIA 5AENA 3T2JE 5A3YA 5K1VA 5BPPA 1NPCA 1KTOA 5L41E 1ESPA 4XO5A 2TLIA 3FV4A 4XO3A 4GAAA 4XMTA 5AB2A 5DLLA 3QH5A 4L2LA 1Y3GE 4ZQTA 1GW6A 3TMNE 4PVBA 1KL6A 1LNCE 4MKTA 3T8VA 3FUKA 6TLIA 3B37A 4TMNE 3FH5A 4XN9A 5FWQA 4OI5E 3P7TE 3F2PA 3FUIA 3FUEA 4FYRA 4Q4IA 4Z7IA 5JSSE 4KXAA 5LIFE 1KS7A 1Z5HA 1FJWA 3P7PE 4K5NA 1LNFE 3FTZA 3SSBA 3MDJA 3NN7A 4K5MA 3T8DA 3P7UE 4E36A 3CHRA 4FCAA 4OW3A 2DQMA 3T8HA 4GERA 1SQMA 8TLNE 3P7SE 3FB0A 5TMNE 4PU2A 4ZW5A 3CHOA 4XNAA 2WHZA 1KROA 1QF1A 5JVIE 3B7TA 4MWPE 3B7SA 4PJ6A 3DO0A 4KXCA 3ZI6A 3P7WE 2HPTA 4XN2A 4FKKA 4XO4A 1LNAE 8TLIA 1KEIA 2ZXGA 1LMLA 4KXBA 4IHQA 3QNFA 4X2UA 1H19A 3FH8A 2XPZA 1EZMA 2TLXA 3MSNA 3FUFA 3FXPA 5LHDA 1Z9GE 4N5PE 4J3BA 2XQ0A 4R5XA 5TLNA 1U4GA 3B7UX 3Q7JA 4FKHA 3CHQA 2DQ6A 1QF0A 1QF2A 3FUMA 1HYTA 4XN4A 3B2XA 4FYSA 4FYTA 2R59A 4ZW6A 5DYFA 4R5TA 4XN5A 4FGMA 3DBKA 3DO1A 4XMVA 3FTSA 1Z1WA 3P7VE 3CIAA 5EV7A 4ZX6A
chains in the Genus database with same CATH topology
3MSFA 3FTUA 4K5NA 4R7LA 1LNFE 3FTZA 3SSBA 3T74A 4XMUA 3FTVA 3NN7A 4K5MA 1KKKA 4Q4EA 3P7UE 3T8DA 5L8PE 2GTQA 3CHRA 4OW3A 4RSYA 1L3FE 2DQMA 3T8HA 1FJUA 4XN1A 4GERA 4ZW7A 1SQMA 1ZDPE 4ZX3A 8TLNE 3T87A 1FJQA 3NQXA 4M65A 3T73A 3FUDA 2VJ8A 5JS3E 3P7SE 5TLIA 3FB0A 4N66E 4XN7A 3B7RL 4XMZA 5TMNE 1THLA 1FJTA 5DPEE 4PU2A 4ZW5A 3LS7A 4K89A 7TLNA 5FSSA 3QH1A 3MS3A 3T8CA 4MS6A 3T8FA 4MXJE 2A7GE 3CHOA 4PW4A 3FORA 4ZW3A 1KJOA 3FUNA 4K5OA 3DNZA 4XNAA 3FLFA 4QHPA 2VQXA 1BQBA 3QGOA 2WHZA 3EBHA 1KROA 1QF1A 3FHEA 1OS0A 4XNDA 3FULA 3FH7A 1TLXA 4TNLA 5JVIE 3FTYA 3B7TA 3QJXA 1TLIA 4MWPE 3Q44A 3NQYB 2WI0A 3B2PA 4N4EE 5LWDE 3B7SA 1PE5A 1GXWA 3DO0A 3EBIA 3FU0A 4K5LA 5AENA 3T2JE 3ZI6A 1LNEE 5A3YA 5BPPA 1NPCA 3P7WE 5K7TA 1TMNE 2HPTA 4XN2A 5JT9E 4TLNA 4XO4A 1KTOA 1LNAE 1KEIA 8TLIA 4QPEA 2ZXGA 1LMLA 4QMEA 5L41E 4RVBA 1ESPA 5FSPA 1KR6A 5FXNA 3B34A 3FTXA 3EIMA 4TLIA 4XO5A 3F28A 4X2UA 2TLIA 5JXNE 3FV4A 5DLHA 4XO3A 4GAAA 4XMWA 4DPRA 1H19A 3NQZB 4XMTA 3P7QE 3CHSA 3T2HE 4D91A 3FH8A 2XPZA 5DLLA 3FU5A 3MSAA 4K90A 1EZMA 1FJOA 2TLXA 3EBGA 3QH5A 4XN8A 3MSNA 4L2LA 4D9WA 1Y3GE 4ZX5A 2G4ZA 1GW6A 4ZQTA 3FGDA 3FUFA 3FXPA 3KEDA 3DO2A 4MZNE 4QUOA 1Z9GE 4N5PE 1KJPA 1LNDE 4J3BA 3TLIA 3TMNE 2XQ0A 4PVBA 2TMNE 3FXSA 4XNBA 4R5XA 5TLNA 1KL6A 3PUUA 1U4GA 3Q43A 3CHPA 1LNCE 4MKTA 3B7UX 3FUKA 4R5VA 3T8VA 7TLIA 3CHQA 2DQ6A 1QF0A 1FJ3A 1QF2A 6TLIA 5HQDA 3FUMA 3B37A 4B52A 3FTWA 1PE8A 1HYTA 3FUHA 4TMNE 3FH5A 4XN4A 4XN9A 4ZX4A 1LNBE 5FWQA 3U9WA 3B2XA 3N21A 5DPFE 3FU3A 3FCQA 4OI5E 3P7TE 3FU6A 4QIRA 2R59A 3F2PA 1TRLA 3FUIA 4ZW8A 1HS6A 4ZW6A 5FSJA 5L3UE 5DYFA 4R5TA 3FUEA 4XN5A 4Q4IA 3FBOA 3DBKA 3FVPA 2XPYA 4K5PA 3DO1A 4XMXA 4XMVA 4MTWE 5JSSE 6TMNE 3FTSA 5LIFE 2HPOA 3T8GA 1PE7A 3P7VE 3CIAA 3T2IE 3FUJA 4H57A 4ZX6A 1KS7A 1TLPE 3B3BA 3P7RE 1FJVA 1FJWA 3P7PE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSF A;  3FTU A;  4K5N A;  4R7L A;  1LNF E;  3FTZ A;  3SSB A;  3T74 A;  4XMU A;  3FTV A;  3NN7 A;  4K5M A;  1KKK A;  4Q4E A;  3P7U E;  3T8D A;  5L8P E;  2GTQ A;  3CHR A;  4OW3 A;  4RSY A;  1L3F E;  2DQM A;  3T8H A;  1FJU A;  4XN1 A;  4GER A;  4ZW7 A;  1SQM A;  1ZDP E;  4ZX3 A;  8TLN E;  3T87 A;  1FJQ A;  3NQX A;  4M65 A;  3T73 A;  3FUD A;  2VJ8 A;  5JS3 E;  3P7S E;  5TLI A;  3FB0 A;  4N66 E;  4XN7 A;  3B7R L;  4XMZ A;  5TMN E;  1THL A;  1FJT A;  5DPE E;  4PU2 A;  4ZW5 A;  3LS7 A;  4K89 A;  7TLN A;  5FSS A;  3QH1 A;  3MS3 A;  3T8C A;  4MS6 A;  3T8F A;  4MXJ E;  2A7G E;  3CHO A;  4PW4 A;  3FOR A;  4ZW3 A;  1KJO A;  3FUN A;  4K5O A;  3DNZ A;  4XNA A;  3FLF A;  4QHP A;  2VQX A;  1BQB A;  3QGO A;  2WHZ A;  3EBH A;  1KRO A;  1QF1 A;  3FHE A;  1OS0 A;  4XND A;  3FUL A;  3FH7 A;  1TLX A;  4TNL A;  5JVI E;  3FTY A;  3B7T A;  3QJX A;  1TLI A;  4MWP E;  3Q44 A;  3NQY B;  2WI0 A;  3B2P A;  4N4E E;  5LWD E;  3B7S A;  1PE5 A;  1GXW A;  3DO0 A;  3EBI A;  3FU0 A;  4K5L A;  5AEN A;  3T2J E;  3ZI6 A;  1LNE E;  5A3Y A;  5BPP A;  1NPC A;  3P7W E;  5K7T A;  1TMN E;  2HPT A;  4XN2 A;  5JT9 E;  4TLN A;  4XO4 A;  1KTO A;  1LNA E;  1KEI A;  8TLI A;  4QPE A;  2ZXG A;  4QME A;  5L41 E;  4RVB A;  1ESP A;  5FSP A;  1KR6 A;  5FXN A;  3B34 A;  3FTX A;  3EIM A;  4TLI A;  4XO5 A;  3F28 A;  4X2U A;  2TLI A;  5JXN E;  3FV4 A;  5DLH A;  4XO3 A;  4GAA A;  4XMW A;  4DPR A;  1H19 A;  3NQZ B;  4XMT A;  3P7Q E;  3CHS A;  3T2H E;  4D91 A;  3FH8 A;  2XPZ A;  5DLL A;  3FU5 A;  3MSA A;  4K90 A;  1EZM A;  1FJO A;  2TLX A;  3EBG A;  3QH5 A;  4XN8 A;  3MSN A;  4L2L A;  4D9W A;  1Y3G E;  4ZX5 A;  2G4Z A;  1GW6 A;  4ZQT A;  3FGD A;  3FUF A;  3FXP A;  3KED A;  3DO2 A;  4MZN E;  4QUO A;  1Z9G E;  4N5P E;  1KJP A;  1LND E;  4J3B A;  3TLI A;  3TMN E;  2XQ0 A;  4PVB A;  2TMN E;  3FXS A;  4XNB A;  4R5X A;  5TLN A;  1KL6 A;  3PUU A;  1U4G A;  3Q43 A;  3CHP A;  1LNC E;  4MKT A;  3B7U X;  3FUK A;  4R5V A;  3T8V A;  7TLI A;  3CHQ A;  2DQ6 A;  1QF0 A;  1FJ3 A;  1QF2 A;  6TLI A;  5HQD A;  3FUM A;  3B37 A;  4B52 A;  3FTW A;  1PE8 A;  1HYT A;  3FUH A;  4TMN E;  3FH5 A;  4XN4 A;  4XN9 A;  4ZX4 A;  1LNB E;  5FWQ A;  3U9W A;  3B2X A;  3N21 A;  5DPF E;  3FU3 A;  3FCQ A;  4OI5 E;  3P7T E;  3FU6 A;  4QIR A;  2R59 A;  3F2P A;  1TRL A;  3FUI A;  4ZW8 A;  1HS6 A;  4ZW6 A;  5FSJ A;  5L3U E;  5DYF A;  4R5T A;  3FUE A;  4XN5 A;  4Q4I A;  3FBO A;  3DBK A;  3FVP A;  2XPY A;  4K5P A;  3DO1 A;  4XMX A;  4XMV A;  4MTW E;  5JSS E;  6TMN E;  3FTS A;  5LIF E;  2HPO A;  3T8G A;  1PE7 A;  3P7V E;  3CIA A;  3T2I E;  3FUJ A;  4H57 A;  4ZX6 A;  1KS7 A;  1TLP E;  3B3B A;  3P7R E;  1FJV A;  1FJW A;  3P7P E; 
#chains in the Genus database with same CATH topology
 4R7L A;  4XMU A;  5L8P E;  1KKK A;  1L3F E;  2YD0 A;  1FJU A;  4XN1 A;  4ZW7 A;  1ZDP E;  3T87 A;  3T73 A;  4AR9 A;  2VJ8 A;  5TLI A;  4N66 E;  4XMZ A;  5CU5 A;  3LS7 A;  7TLN A;  3QH1 A;  3T8F A;  4PW4 A;  3FUN A;  4P8Q A;  4XND A;  3FH7 A;  1TLX A;  3FTY A;  4AR8 A;  2WI0 A;  1PE5 A;  3FU0 A;  1LNE E;  5K7T A;  4RVB A;  5FSP A;  1KR6 A;  5FXN A;  3B34 A;  3FTX A;  3EIM A;  4DPR A;  4HOM A;  3P7Q E;  3T2H E;  4K90 A;  4XN8 A;  4D9W A;  2G4Z A;  3FGD A;  3KED A;  3DO2 A;  4MZN E;  3TLI A;  1KJP A;  1LND E;  5J6S A;  2TMN E;  4JBS A;  3CHP A;  4FYQ A;  4R5V A;  7TLI A;  1FJ3 A;  1PE8 A;  1LNB E;  3N21 A;  3FCQ A;  3FU6 A;  1HS6 A;  5FSJ A;  5LG6 A;  3FBO A;  2XPY A;  4K5P A;  4XMX A;  4MTW E;  1PE7 A;  3T2I E;  1TLP E;  3B3B A;  4N4E E;  4ZX5 A;  1FJV A;  3T74 A;  4Q4E A;  2GTQ A;  5C97 A;  1FJQ A;  4M65 A;  5JS3 E;  1FJT A;  5DPE E;  5LDS A;  4K89 A;  4WZ9 A;  3MS3 A;  3T8C A;  4MS6 A;  4ZW3 A;  4FKE A;  1KJO A;  4K5O A;  3DNZ A;  3FLF A;  4QHP A;  4NAQ A;  3QGO A;  4KX8 A;  4TNL A;  3QJX A;  1TLI A;  5LWD E;  4K5L A;  4NZ8 A;  1TMN E;  4KX9 A;  5JT9 E;  4TLN A;  4OU3 A;  4QPE A;  4QME A;  4TLI A;  3F28 A;  4II7 A;  5JXN E;  5DLH A;  4XMW A;  3NQZ B;  3CHS A;  4D91 A;  3FU5 A;  3MSA A;  1FJO A;  3EBG A;  4QUO A;  3FXS A;  4XNB A;  3PUU A;  3Q43 A;  5HQD A;  4B52 A;  3FTW A;  3FUH A;  4ZX4 A;  3U9W A;  5DPF E;  3FU3 A;  4QIR A;  1TRL A;  4ZW8 A;  3SE6 A;  5L3U E;  3FVP A;  6TMN E;  2HPO A;  3T8G A;  3FUJ A;  4H57 A;  3P7R E;  3MSF A;  3FTU A;  3FTV A;  4RSY A;  4ZX3 A;  3NQX A;  3FUD A;  4KXD A;  4XN7 A;  3B7R L;  4ARF A;  1THL A;  5FSS A;  4F5C A;  4MXJ E;  2A7G E;  3FOR A;  4AR1 A;  2VQX A;  1BQB A;  3EBH A;  3FHE A;  1OS0 A;  3FUL A;  4KX7 A;  3Q44 A;  3NQY B;  3B2P A;  1GXW A;  5AB0 A;  3EBI A;  5AEN A;  3T2J E;  5A3Y A;  5K1V A;  5BPP A;  1NPC A;  1KTO A;  5L41 E;  1ESP A;  4XO5 A;  2TLI A;  3FV4 A;  4XO3 A;  4GAA A;  4XMT A;  5AB2 A;  5DLL A;  3QH5 A;  4L2L A;  1Y3G E;  4ZQT A;  1GW6 A;  3TMN E;  4PVB A;  1KL6 A;  1LNC E;  4MKT A;  3T8V A;  3FUK A;  6TLI A;  3B37 A;  4TMN E;  3FH5 A;  4XN9 A;  5FWQ A;  4OI5 E;  3P7T E;  3F2P A;  3FUI A;  3FUE A;  4FYR A;  4Q4I A;  4Z7I A;  5JSS E;  4KXA A;  5LIF E;  1KS7 A;  1Z5H A;  1FJW A;  3P7P E;  4K5N A;  1LNF E;  3FTZ A;  3SSB A;  3MDJ A;  3NN7 A;  4K5M A;  3T8D A;  3P7U E;  4E36 A;  3CHR A;  4FCA A;  4OW3 A;  2DQM A;  3T8H A;  4GER A;  1SQM A;  8TLN E;  3P7S E;  3FB0 A;  5TMN E;  4PU2 A;  4ZW5 A;  3CHO A;  4XNA A;  2WHZ A;  1KRO A;  1QF1 A;  5JVI E;  3B7T A;  4MWP E;  3B7S A;  4PJ6 A;  3DO0 A;  4KXC A;  3ZI6 A;  3P7W E;  2HPT A;  4XN2 A;  4FKK A;  4XO4 A;  1LNA E;  8TLI A;  1KEI A;  2ZXG A;  1LML A;  4KXB A;  4IHQ A;  3QNF A;  4X2U A;  1H19 A;  3FH8 A;  2XPZ A;  1EZM A;  2TLX A;  3MSN A;  3FUF A;  3FXP A;  5LHD A;  1Z9G E;  4N5P E;  4J3B A;  2XQ0 A;  4R5X A;  5TLN A;  1U4G A;  3B7U X;  3Q7J A;  4FKH A;  3CHQ A;  2DQ6 A;  1QF0 A;  1QF2 A;  3FUM A;  1HYT A;  4XN4 A;  3B2X A;  4FYS A;  4FYT A;  2R59 A;  4ZW6 A;  5DYF A;  4R5T A;  4XN5 A;  4FGM A;  3DBK A;  3DO1 A;  4XMV A;  3FTS A;  1Z1W A;  3P7V E;  3CIA A;  5EV7 A;  4ZX6 A; 
#chains in the Genus database with same CATH homology
 3MSF A;  3FTU A;  4K5N A;  4R7L A;  1LNF E;  3FTZ A;  3SSB A;  3T74 A;  4XMU A;  3FTV A;  3NN7 A;  4K5M A;  1KKK A;  4Q4E A;  3P7U E;  3T8D A;  5L8P E;  2GTQ A;  3CHR A;  4OW3 A;  4RSY A;  1L3F E;  2DQM A;  3T8H A;  1FJU A;  4XN1 A;  4GER A;  4ZW7 A;  1SQM A;  1ZDP E;  4ZX3 A;  8TLN E;  3T87 A;  1FJQ A;  3NQX A;  4M65 A;  3T73 A;  3FUD A;  2VJ8 A;  5JS3 E;  3P7S E;  5TLI A;  3FB0 A;  4N66 E;  4XN7 A;  3B7R L;  4XMZ A;  5TMN E;  1THL A;  1FJT A;  5DPE E;  4PU2 A;  4ZW5 A;  3LS7 A;  4K89 A;  7TLN A;  5FSS A;  3QH1 A;  3MS3 A;  3T8C A;  4MS6 A;  3T8F A;  4MXJ E;  2A7G E;  3CHO A;  4PW4 A;  3FOR A;  4ZW3 A;  1KJO A;  3FUN A;  4K5O A;  3DNZ A;  4XNA A;  3FLF A;  4QHP A;  2VQX A;  1BQB A;  3QGO A;  2WHZ A;  3EBH A;  1KRO A;  1QF1 A;  3FHE A;  1OS0 A;  4XND A;  3FUL A;  3FH7 A;  1TLX A;  4TNL A;  5JVI E;  3FTY A;  3B7T A;  3QJX A;  1TLI A;  4MWP E;  3Q44 A;  3NQY B;  2WI0 A;  3B2P A;  4N4E E;  5LWD E;  3B7S A;  1PE5 A;  1GXW A;  3DO0 A;  3EBI A;  3FU0 A;  4K5L A;  5AEN A;  3T2J E;  3ZI6 A;  1LNE E;  5A3Y A;  5BPP A;  1NPC A;  3P7W E;  5K7T A;  1TMN E;  2HPT A;  4XN2 A;  5JT9 E;  4TLN A;  4XO4 A;  1KTO A;  1LNA E;  1KEI A;  8TLI A;  4QPE A;  2ZXG A;  1LML A;  4QME A;  5L41 E;  4RVB A;  1ESP A;  5FSP A;  1KR6 A;  5FXN A;  3B34 A;  3FTX A;  3EIM A;  4TLI A;  4XO5 A;  3F28 A;  4X2U A;  2TLI A;  5JXN E;  3FV4 A;  5DLH A;  4XO3 A;  4GAA A;  4XMW A;  4DPR A;  1H19 A;  3NQZ B;  4XMT A;  3P7Q E;  3CHS A;  3T2H E;  4D91 A;  3FH8 A;  2XPZ A;  5DLL A;  3FU5 A;  3MSA A;  4K90 A;  1EZM A;  1FJO A;  2TLX A;  3EBG A;  3QH5 A;  4XN8 A;  3MSN A;  4L2L A;  4D9W A;  1Y3G E;  4ZX5 A;  2G4Z A;  1GW6 A;  4ZQT A;  3FGD A;  3FUF A;  3FXP A;  3KED A;  3DO2 A;  4MZN E;  4QUO A;  1Z9G E;  4N5P E;  1KJP A;  1LND E;  4J3B A;  3TLI A;  3TMN E;  2XQ0 A;  4PVB A;  2TMN E;  3FXS A;  4XNB A;  4R5X A;  5TLN A;  1KL6 A;  3PUU A;  1U4G A;  3Q43 A;  3CHP A;  1LNC E;  4MKT A;  3B7U X;  3FUK A;  4R5V A;  3T8V A;  7TLI A;  3CHQ A;  2DQ6 A;  1QF0 A;  1FJ3 A;  1QF2 A;  6TLI A;  5HQD A;  3FUM A;  3B37 A;  4B52 A;  3FTW A;  1PE8 A;  1HYT A;  3FUH A;  4TMN E;  3FH5 A;  4XN4 A;  4XN9 A;  4ZX4 A;  1LNB E;  5FWQ A;  3U9W A;  3B2X A;  3N21 A;  5DPF E;  3FU3 A;  3FCQ A;  4OI5 E;  3P7T E;  3FU6 A;  4QIR A;  2R59 A;  3F2P A;  1TRL A;  3FUI A;  4ZW8 A;  1HS6 A;  4ZW6 A;  5FSJ A;  5L3U E;  5DYF A;  4R5T A;  3FUE A;  4XN5 A;  4Q4I A;  3FBO A;  3DBK A;  3FVP A;  2XPY A;  4K5P A;  3DO1 A;  4XMX A;  4XMV A;  4MTW E;  5JSS E;  6TMN E;  3FTS A;  5LIF E;  2HPO A;  3T8G A;  1PE7 A;  3P7V E;  3CIA A;  3T2I E;  3FUJ A;  4H57 A;  4ZX6 A;  1KS7 A;  1TLP E;  3B3B A;  3P7R E;  1FJV A;  1FJW A;  3P7P E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...