4GERA

Crystal structure of gentlyase, the neutral metalloprotease of paenibacillus polymyxa
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
304
structure length
304
Chain Sequence
ATGTGKGVLGDTKSFTTTASGSSYQLKDTTRGNGVVTYTASNRQSIPGTILTDADNVWNDPAGVDAHTYAAKTYDYYKAKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGSTFIAFSGDPDVVGHELTHGVTEYTSNLEYYGESGALNEAFSDVIGNDIQRKNWLVGDDIYTPNIAGDALRSMSNPTLYDQPDHYSNLYTGSSDNGGVHTNSGIINKAYYLLAQGGTFHGVTVNGIGRDAAVQIYYSAFTNYLTSSSDFSNARAAVIQAAKDQYGANSAEATAAAKSFDAVGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Gentlyase, the neutral metalloprotease of Paenibacillus polymyxa.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords Gentlyase metalloprotease
total genus 112
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 3.4.24.28: Bacillolysin.
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 4gerA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 4gerA01
3CHQA 3QJXA 2TMNE 4R5TA 3NQXA 1KKKA 4QHPA 3FVPA 1U4GA 3T8GA 3U9WA 3P7VE 1LNDE 4D91A 2VJ8A 3TMNE 1BQBA 3FB0A 4XMVA 3N21A 4ZW3A 5TLIA 1TLPE 4XO4A 2HPOA 4OW3A 5K7TA 4K5OA 4TMNE 1TRLA 3FBOA 4K89A 5FXNA 4MKTA 1KROA 3B7UX 3FV4A 4X2UA 5FSPA 3KEDA 3MSNA 4XO3A 4XN1A 3ZI6A 4GERA 3FULA 4Q4EA 2G4ZA 3FCQA 4K5NA 3FTSA 4ZX5A 4DPRA 3T74A 4ZW8A 3T2HE 4PVBA 4XN8A 5L3UE 4R7LA 5DPFE 3B7SA 3FTXA 3CHPA 1LNAE 3Q43A 1KEIA 4K5PA 4XO5A 5DLLA 3FH8A 3T2JE 1TLIA 1PE8A 3T8FA 4ZX4A 5JS3E 4XNAA 4OI5E 4TNLA 5HQDA 3B7TA 4N5PE 1QF0A 4K5LA 1PE5A 3CHSA 3T8VA 3P7SE 5A3YA 3FUMA 4PU2A 3FUNA 2DQ6A 2R59A 4K5MA 3P7UE 3FU5A 1QF1A 2ZXGA 1FJ3A 2A7GE 3FHEA 1LNEE 5JT9E 4QMEA 2GTQA 3B37A 4XN2A 4RVBA 5FSSA 4ZX6A 1SQMA 3T73A 1KJPA 4XNDA 3NQYB 3MSFA 3B7RL 5DLHA 1ZDPE 3FH5A 3FUKA 3EBGA 3B2PA 3FXPA 3DO2A 3FUEA 5DYFA 4GAAA 3QGOA 1TLXA 1OS0A 4XMTA 4QIRA 2DQMA 1EZMA 3DO0A 1PE7A 1KL6A 4XN4A 5FWQA 1L3FE 5FSJA 3FUHA 4R5XA 4Q4IA 5L8PE 1Y3GE 3FXSA 5BPPA 3P7RE 3MS3A 3FUJA 1LNCE 4D9WA 3FORA 1GW6A 6TLIA 3B34A 4XN5A 5JVIE 4ZQTA 4ZW5A 7TLNA 3P7TE 5TMNE 4H57A 2TLIA 3CIAA 3FTWA 1ESPA 3Q44A 3P7WE 4XMWA 1FJOA 1NPCA 3P7QE 2TLXA 3T2IE 3FGDA 1KR6A 3QH1A 1FJVA 3T8DA 2VQXA 4L2LA 4QPEA 3TLIA 4ZX3A 1H19A 2WI0A 4J3BA 3F2PA 3MSAA 1TMNE 4N66E 4XMZA 3SSBA 4PW4A 3FUIA 5LIFE 3EIMA 4XN9A 1GXWA 3LS7A 3B2XA 2XQ0A 4MWPE 1KS7A 4RSYA 4ZW7A 5TLNA 3DNZA 1QF2A 1KJOA 4MS6A 3NN7A 3T8HA 4B52A 4ZW6A 3FTUA 4XN7A 3FU3A 4XMUA 5JXNE 1FJTA 1KTOA 4K90A 5AENA 3T87A 4M65A 3F28A 1HYTA 3QH5A 3CHRA 3FU0A 4R5VA 3CHOA 5DPEE 4XMXA 1FJUA 2XPZA 3FUFA 5JSSE 1LNBE 1FJWA 8TLIA 3FTYA 3NQZB 3PUUA 4TLIA 4QUOA 1THLA 1Z9GE 3EBIA 3FTZA 3FUDA 3EBHA 8TLNE 3DO1A 3FLFA 2HPTA 5LWDE 1FJQA 3DBKA 1HS6A 2XPYA 4MTWE 4TLNA 4XNBA 5L41E 3FU6A 3P7PE 3T8CA 7TLIA 4MZNE 3FH7A 2WHZA 4N4EE 3FTVA 1LNFE 6TMNE 4MXJE 3B3BA
chains in the Genus database with same CATH superfamily
3CHQA 3QJXA 2TMNE 5CU5A 4R5TA 3NQXA 1KKKA 4QHPA 3FVPA 1U4GA 3T8GA 3U9WA 3P7VE 1LNDE 4D91A 2VJ8A 3TMNE 1BQBA 3FB0A 4XMVA 3N21A 4ZW3A 5TLIA 1TLPE 4XO4A 2HPOA 4OW3A 4WZ9A 5K7TA 4K5OA 4TMNE 1TRLA 3FBOA 3QNFA 4K89A 5FXNA 4MKTA 4FKKA 1KROA 3B7UX 3FV4A 4X2UA 5FSPA 3Q7JA 3KEDA 5J6SA 3MSNA 4JBSA 4XO3A 4XN1A 3ZI6A 4FKEA 4GERA 3FULA 4Q4EA 2G4ZA 3FCQA 4K5NA 3FTSA 4ZX5A 4DPRA 3T74A 4ZW8A 3T2HE 4PVBA 4XN8A 5L3UE 4R7LA 5DPFE 3B7SA 3FTXA 3CHPA 1LNAE 3Q43A 1KEIA 4K5PA 4NZ8A 4XO5A 3FH8A 5DLLA 1TLIA 1PE8A 3T8FA 4ZX4A 5JS3E 5LHDA 4XNAA 4OI5E 4FYRA 4TNLA 3B7TA 4FYTA 4N5PE 5HQDA 1QF0A 4K5LA 1PE5A 3CHSA 4KXDA 3T8VA 3P7SE 4HOMA 5A3YA 3FUMA 4PU2A 3FUNA 2DQ6A 2R59A 4K5MA 1Z1WA 3FU5A 1QF1A 2ZXGA 3P7UE 1FJ3A 3SE6A 2A7GE 3FHEA 1LNEE 5JT9E 4QMEA 2GTQA 3B37A 4KX9A 4RVBA 4XN2A 5FSSA 1SQMA 3T73A 1KJPA 4AR1A 4ZX6A 4XNDA 4II7A 3NQYB 3MSFA 3B7RL 4FCAA 4NAQA 1LMLA 4KX8A 4P8QA 1ZDPE 5DLHA 4KXCA 3FH5A 3FUKA 3EBGA 3B2PA 3FXPA 3DO2A 3FUEA 5DYFA 4GAAA 3QGOA 1TLXA 1OS0A 4XMTA 4QIRA 2DQMA 1EZMA 2YD0A 1PE7A 1KL6A 3DO0A 4XN4A 5FWQA 5FSJA 3FUHA 4R5XA 4Q4IA 5L8PE 1Y3GE 3FXSA 5BPPA 5AB2A 3P7RE 1Z5HA 3FUJA 1LNCE 3MS3A 4D9WA 3FORA 1GW6A 6TLIA 3B34A 4XN5A 5JVIE 4ZQTA 4ZW5A 7TLNA 3P7TE 5TMNE 4H57A 2TLIA 4PJ6A 3CIAA 3FTWA 4Z7IA 1ESPA 3Q44A 3P7WE 4XMWA 1FJOA 1NPCA 3P7QE 5C97A 5LDSA 2TLXA 3T2IE 4IHQA 3FGDA 1KR6A 3QH1A 1FJVA 3T8DA 5EV7A 2VQXA 4L2LA 4QPEA 3TLIA 4ZX3A 1H19A 2WI0A 4J3BA 3F2PA 3MSAA 1TMNE 4N66E 4XMZA 3SSBA 4PW4A 3FUIA 5K1VA 5LIFE 3EIMA 4XN9A 1GXWA 3LS7A 3B2XA 2XQ0A 4MWPE 1KS7A 4FKHA 4RSYA 4ZW7A 3DNZA 1QF2A 1KJOA 4MS6A 3NN7A 3T8HA 4B52A 4ZW6A 3FTUA 4XN7A 3FU3A 4XMUA 4KXBA 5JXNE 1FJTA 1KTOA 4K90A 1L3FE 5AENA 3T87A 4M65A 5AB0A 3F28A 1HYTA 3QH5A 3CHRA 3FU0A 4F5CA 4R5VA 3CHOA 5DPEE 4XMXA 1FJUA 4E36A 4AR9A 4OU3A 2XPZA 3FUFA 5JSSE 1LNBE 1FJWA 4ARFA 4KX7A 8TLIA 3FTYA 4FGMA 3NQZB 3PUUA 4TLIA 4QUOA 1THLA 4FYQA 1Z9GE 3EBIA 3FTZA 3FUDA 4FYSA 3EBHA 8TLNE 3DO1A 3FLFA 2HPTA 5LWDE 3MDJA 5LG6A 1FJQA 4KXAA 3DBKA 1HS6A 2XPYA 4MTWE 4TLNA 4XNBA 5L41E 3FU6A 3P7PE 3T8CA 7TLIA 5TLNA 3T2JE 4MZNE 3FH7A 2WHZA 4N4EE 3FTVA 4AR8A 1LNFE 6TMNE 4MXJE 3B3BA
chains in the Genus database with same CATH topology
3CHQA 3QJXA 2TMNE 4R5TA 3NQXA 1KKKA 4QHPA 3FVPA 1U4GA 3T8GA 3U9WA 3P7VE 1LNDE 4D91A 2VJ8A 3TMNE 1BQBA 3FB0A 4XMVA 3N21A 4ZW3A 5TLIA 1TLPE 4XO4A 2HPOA 4OW3A 5K7TA 4K5OA 4TMNE 1TRLA 3FBOA 4K89A 5FXNA 4MKTA 1KROA 3B7UX 3FV4A 4X2UA 5FSPA 3KEDA 3MSNA 4XO3A 4XN1A 3ZI6A 4GERA 3FULA 4Q4EA 2G4ZA 3FCQA 4K5NA 3FTSA 4ZX5A 4DPRA 3T74A 4ZW8A 3T2HE 4PVBA 4XN8A 5L3UE 4R7LA 5DPFE 3B7SA 3FTXA 3CHPA 1LNAE 3Q43A 1KEIA 4K5PA 4XO5A 5DLLA 3FH8A 3T2JE 1TLIA 1PE8A 3T8FA 4ZX4A 5JS3E 4XNAA 4OI5E 4TNLA 5HQDA 3B7TA 4N5PE 1QF0A 4K5LA 1PE5A 3CHSA 3T8VA 3P7SE 5A3YA 3FUMA 4PU2A 3FUNA 2DQ6A 2R59A 4K5MA 3P7UE 3FU5A 1QF1A 2ZXGA 1FJ3A 2A7GE 3FHEA 1LNEE 5JT9E 4QMEA 2GTQA 3B37A 4XN2A 4RVBA 5FSSA 4ZX6A 1SQMA 3T73A 1KJPA 4XNDA 3NQYB 3MSFA 3B7RL 1LMLA 5DLHA 1ZDPE 3FH5A 3FUKA 3EBGA 3B2PA 3FXPA 3DO2A 3FUEA 5DYFA 4GAAA 3QGOA 1TLXA 1OS0A 4XMTA 4QIRA 2DQMA 1EZMA 3DO0A 1PE7A 1KL6A 4XN4A 5FWQA 1L3FE 5FSJA 3FUHA 4R5XA 4Q4IA 5L8PE 1Y3GE 3FXSA 5BPPA 3P7RE 3MS3A 3FUJA 1LNCE 4D9WA 3FORA 1GW6A 6TLIA 3B34A 4XN5A 5JVIE 4ZQTA 4ZW5A 7TLNA 3P7TE 5TMNE 4H57A 2TLIA 3CIAA 3FTWA 1ESPA 3Q44A 3P7WE 4XMWA 1FJOA 1NPCA 3P7QE 2TLXA 3T2IE 3FGDA 1KR6A 3QH1A 1FJVA 3T8DA 2VQXA 4L2LA 4QPEA 3TLIA 4ZX3A 1H19A 2WI0A 4J3BA 3F2PA 3MSAA 1TMNE 4N66E 4XMZA 3SSBA 4PW4A 3FUIA 5LIFE 3EIMA 4XN9A 1GXWA 3LS7A 3B2XA 2XQ0A 4MWPE 1KS7A 4RSYA 4ZW7A 5TLNA 3DNZA 1QF2A 1KJOA 4MS6A 3NN7A 3T8HA 4B52A 4ZW6A 3FTUA 4XN7A 3FU3A 4XMUA 5JXNE 1FJTA 1KTOA 4K90A 5AENA 3T87A 4M65A 3F28A 1HYTA 3QH5A 3CHRA 3FU0A 4R5VA 3CHOA 5DPEE 4XMXA 1FJUA 2XPZA 3FUFA 5JSSE 1LNBE 1FJWA 8TLIA 3FTYA 3NQZB 3PUUA 4TLIA 4QUOA 1THLA 1Z9GE 3EBIA 3FTZA 3FUDA 3EBHA 8TLNE 3DO1A 3FLFA 2HPTA 5LWDE 1FJQA 3DBKA 1HS6A 2XPYA 4MTWE 4TLNA 4XNBA 5L41E 3FU6A 3P7PE 3T8CA 7TLIA 4MZNE 3FH7A 2WHZA 4N4EE 3FTVA 1LNFE 6TMNE 4MXJE 3B3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CHQ A;  3QJX A;  2TMN E;  4R5T A;  3NQX A;  1KKK A;  4QHP A;  3FVP A;  1U4G A;  3T8G A;  3U9W A;  3P7V E;  1LND E;  4D91 A;  2VJ8 A;  3TMN E;  1BQB A;  3FB0 A;  4XMV A;  3N21 A;  4ZW3 A;  5TLI A;  1TLP E;  4XO4 A;  2HPO A;  4OW3 A;  5K7T A;  4K5O A;  4TMN E;  1TRL A;  3FBO A;  4K89 A;  5FXN A;  4MKT A;  1KRO A;  3B7U X;  3FV4 A;  4X2U A;  5FSP A;  3KED A;  3MSN A;  4XO3 A;  4XN1 A;  3ZI6 A;  4GER A;  3FUL A;  4Q4E A;  2G4Z A;  3FCQ A;  4K5N A;  3FTS A;  4ZX5 A;  4DPR A;  3T74 A;  4ZW8 A;  3T2H E;  4PVB A;  4XN8 A;  5L3U E;  4R7L A;  5DPF E;  3B7S A;  3FTX A;  3CHP A;  1LNA E;  3Q43 A;  1KEI A;  4K5P A;  4XO5 A;  5DLL A;  3FH8 A;  3T2J E;  1TLI A;  1PE8 A;  3T8F A;  4ZX4 A;  5JS3 E;  4XNA A;  4OI5 E;  4TNL A;  5HQD A;  3B7T A;  4N5P E;  1QF0 A;  4K5L A;  1PE5 A;  3CHS A;  3T8V A;  3P7S E;  5A3Y A;  3FUM A;  4PU2 A;  3FUN A;  2DQ6 A;  2R59 A;  4K5M A;  3P7U E;  3FU5 A;  1QF1 A;  2ZXG A;  1FJ3 A;  2A7G E;  3FHE A;  1LNE E;  5JT9 E;  4QME A;  2GTQ A;  3B37 A;  4XN2 A;  4RVB A;  5FSS A;  4ZX6 A;  1SQM A;  3T73 A;  1KJP A;  4XND A;  3NQY B;  3MSF A;  3B7R L;  5DLH A;  1ZDP E;  3FH5 A;  3FUK A;  3EBG A;  3B2P A;  3FXP A;  3DO2 A;  3FUE A;  5DYF A;  4GAA A;  3QGO A;  1TLX A;  1OS0 A;  4XMT A;  4QIR A;  2DQM A;  1EZM A;  3DO0 A;  1PE7 A;  1KL6 A;  4XN4 A;  5FWQ A;  1L3F E;  5FSJ A;  3FUH A;  4R5X A;  4Q4I A;  5L8P E;  1Y3G E;  3FXS A;  5BPP A;  3P7R E;  3MS3 A;  3FUJ A;  1LNC E;  4D9W A;  3FOR A;  1GW6 A;  6TLI A;  3B34 A;  4XN5 A;  5JVI E;  4ZQT A;  4ZW5 A;  7TLN A;  3P7T E;  5TMN E;  4H57 A;  2TLI A;  3CIA A;  3FTW A;  1ESP A;  3Q44 A;  3P7W E;  4XMW A;  1FJO A;  1NPC A;  3P7Q E;  2TLX A;  3T2I E;  3FGD A;  1KR6 A;  3QH1 A;  1FJV A;  3T8D A;  2VQX A;  4L2L A;  4QPE A;  3TLI A;  4ZX3 A;  1H19 A;  2WI0 A;  4J3B A;  3F2P A;  3MSA A;  1TMN E;  4N66 E;  4XMZ A;  3SSB A;  4PW4 A;  3FUI A;  5LIF E;  3EIM A;  4XN9 A;  1GXW A;  3LS7 A;  3B2X A;  2XQ0 A;  4MWP E;  1KS7 A;  4RSY A;  4ZW7 A;  5TLN A;  3DNZ A;  1QF2 A;  1KJO A;  4MS6 A;  3NN7 A;  3T8H A;  4B52 A;  4ZW6 A;  3FTU A;  4XN7 A;  3FU3 A;  4XMU A;  5JXN E;  1FJT A;  1KTO A;  4K90 A;  5AEN A;  3T87 A;  4M65 A;  3F28 A;  1HYT A;  3QH5 A;  3CHR A;  3FU0 A;  4R5V A;  3CHO A;  5DPE E;  4XMX A;  1FJU A;  2XPZ A;  3FUF A;  5JSS E;  1LNB E;  1FJW A;  8TLI A;  3FTY A;  3NQZ B;  3PUU A;  4TLI A;  4QUO A;  1THL A;  1Z9G E;  3EBI A;  3FTZ A;  3FUD A;  3EBH A;  8TLN E;  3DO1 A;  3FLF A;  2HPT A;  5LWD E;  1FJQ A;  3DBK A;  1HS6 A;  2XPY A;  4MTW E;  4TLN A;  4XNB A;  5L41 E;  3FU6 A;  3P7P E;  3T8C A;  7TLI A;  4MZN E;  3FH7 A;  2WHZ A;  4N4E E;  3FTV A;  1LNF E;  6TMN E;  4MXJ E;  3B3B A; 
#chains in the Genus database with same CATH topology
 3CHQ A;  3QJX A;  2TMN E;  5CU5 A;  4R5T A;  3NQX A;  1KKK A;  4QHP A;  3FVP A;  1U4G A;  3T8G A;  3U9W A;  3P7V E;  1LND E;  4D91 A;  2VJ8 A;  3TMN E;  1BQB A;  3FB0 A;  4XMV A;  3N21 A;  4ZW3 A;  5TLI A;  1TLP E;  4XO4 A;  2HPO A;  4OW3 A;  4WZ9 A;  5K7T A;  4K5O A;  4TMN E;  1TRL A;  3FBO A;  3QNF A;  4K89 A;  5FXN A;  4MKT A;  4FKK A;  1KRO A;  3B7U X;  3FV4 A;  4X2U A;  5FSP A;  3Q7J A;  3KED A;  5J6S A;  3MSN A;  4JBS A;  4XO3 A;  4XN1 A;  3ZI6 A;  4FKE A;  4GER A;  3FUL A;  4Q4E A;  2G4Z A;  3FCQ A;  4K5N A;  3FTS A;  4ZX5 A;  4DPR A;  3T74 A;  4ZW8 A;  3T2H E;  4PVB A;  4XN8 A;  5L3U E;  4R7L A;  5DPF E;  3B7S A;  3FTX A;  3CHP A;  1LNA E;  3Q43 A;  1KEI A;  4K5P A;  4NZ8 A;  4XO5 A;  3FH8 A;  5DLL A;  1TLI A;  1PE8 A;  3T8F A;  4ZX4 A;  5JS3 E;  5LHD A;  4XNA A;  4OI5 E;  4FYR A;  4TNL A;  3B7T A;  4FYT A;  4N5P E;  5HQD A;  1QF0 A;  4K5L A;  1PE5 A;  3CHS A;  4KXD A;  3T8V A;  3P7S E;  4HOM A;  5A3Y A;  3FUM A;  4PU2 A;  3FUN A;  2DQ6 A;  2R59 A;  4K5M A;  1Z1W A;  3FU5 A;  1QF1 A;  2ZXG A;  3P7U E;  1FJ3 A;  3SE6 A;  2A7G E;  3FHE A;  1LNE E;  5JT9 E;  4QME A;  2GTQ A;  3B37 A;  4KX9 A;  4RVB A;  4XN2 A;  5FSS A;  1SQM A;  3T73 A;  1KJP A;  4AR1 A;  4ZX6 A;  4XND A;  4II7 A;  3NQY B;  3MSF A;  3B7R L;  4FCA A;  4NAQ A;  1LML A;  4KX8 A;  4P8Q A;  1ZDP E;  5DLH A;  4KXC A;  3FH5 A;  3FUK A;  3EBG A;  3B2P A;  3FXP A;  3DO2 A;  3FUE A;  5DYF A;  4GAA A;  3QGO A;  1TLX A;  1OS0 A;  4XMT A;  4QIR A;  2DQM A;  1EZM A;  2YD0 A;  1PE7 A;  1KL6 A;  3DO0 A;  4XN4 A;  5FWQ A;  5FSJ A;  3FUH A;  4R5X A;  4Q4I A;  5L8P E;  1Y3G E;  3FXS A;  5BPP A;  5AB2 A;  3P7R E;  1Z5H A;  3FUJ A;  1LNC E;  3MS3 A;  4D9W A;  3FOR A;  1GW6 A;  6TLI A;  3B34 A;  4XN5 A;  5JVI E;  4ZQT A;  4ZW5 A;  7TLN A;  3P7T E;  5TMN E;  4H57 A;  2TLI A;  4PJ6 A;  3CIA A;  3FTW A;  4Z7I A;  1ESP A;  3Q44 A;  3P7W E;  4XMW A;  1FJO A;  1NPC A;  3P7Q E;  5C97 A;  5LDS A;  2TLX A;  3T2I E;  4IHQ A;  3FGD A;  1KR6 A;  3QH1 A;  1FJV A;  3T8D A;  5EV7 A;  2VQX A;  4L2L A;  4QPE A;  3TLI A;  4ZX3 A;  1H19 A;  2WI0 A;  4J3B A;  3F2P A;  3MSA A;  1TMN E;  4N66 E;  4XMZ A;  3SSB A;  4PW4 A;  3FUI A;  5K1V A;  5LIF E;  3EIM A;  4XN9 A;  1GXW A;  3LS7 A;  3B2X A;  2XQ0 A;  4MWP E;  1KS7 A;  4FKH A;  4RSY A;  4ZW7 A;  3DNZ A;  1QF2 A;  1KJO A;  4MS6 A;  3NN7 A;  3T8H A;  4B52 A;  4ZW6 A;  3FTU A;  4XN7 A;  3FU3 A;  4XMU A;  4KXB A;  5JXN E;  1FJT A;  1KTO A;  4K90 A;  1L3F E;  5AEN A;  3T87 A;  4M65 A;  5AB0 A;  3F28 A;  1HYT A;  3QH5 A;  3CHR A;  3FU0 A;  4F5C A;  4R5V A;  3CHO A;  5DPE E;  4XMX A;  1FJU A;  4E36 A;  4AR9 A;  4OU3 A;  2XPZ A;  3FUF A;  5JSS E;  1LNB E;  1FJW A;  4ARF A;  4KX7 A;  8TLI A;  3FTY A;  4FGM A;  3NQZ B;  3PUU A;  4TLI A;  4QUO A;  1THL A;  4FYQ A;  1Z9G E;  3EBI A;  3FTZ A;  3FUD A;  4FYS A;  3EBH A;  8TLN E;  3DO1 A;  3FLF A;  2HPT A;  5LWD E;  3MDJ A;  5LG6 A;  1FJQ A;  4KXA A;  3DBK A;  1HS6 A;  2XPY A;  4MTW E;  4TLN A;  4XNB A;  5L41 E;  3FU6 A;  3P7P E;  3T8C A;  7TLI A;  5TLN A;  3T2J E;  4MZN E;  3FH7 A;  2WHZ A;  4N4E E;  3FTV A;  4AR8 A;  1LNF E;  6TMN E;  4MXJ E;  3B3B A; 
#chains in the Genus database with same CATH homology
 3CHQ A;  3QJX A;  2TMN E;  4R5T A;  3NQX A;  1KKK A;  4QHP A;  3FVP A;  1U4G A;  3T8G A;  3U9W A;  3P7V E;  1LND E;  4D91 A;  2VJ8 A;  3TMN E;  1BQB A;  3FB0 A;  4XMV A;  3N21 A;  4ZW3 A;  5TLI A;  1TLP E;  4XO4 A;  2HPO A;  4OW3 A;  5K7T A;  4K5O A;  4TMN E;  1TRL A;  3FBO A;  4K89 A;  5FXN A;  4MKT A;  1KRO A;  3B7U X;  3FV4 A;  4X2U A;  5FSP A;  3KED A;  3MSN A;  4XO3 A;  4XN1 A;  3ZI6 A;  4GER A;  3FUL A;  4Q4E A;  2G4Z A;  3FCQ A;  4K5N A;  3FTS A;  4ZX5 A;  4DPR A;  3T74 A;  4ZW8 A;  3T2H E;  4PVB A;  4XN8 A;  5L3U E;  4R7L A;  5DPF E;  3B7S A;  3FTX A;  3CHP A;  1LNA E;  3Q43 A;  1KEI A;  4K5P A;  4XO5 A;  5DLL A;  3FH8 A;  3T2J E;  1TLI A;  1PE8 A;  3T8F A;  4ZX4 A;  5JS3 E;  4XNA A;  4OI5 E;  4TNL A;  5HQD A;  3B7T A;  4N5P E;  1QF0 A;  4K5L A;  1PE5 A;  3CHS A;  3T8V A;  3P7S E;  5A3Y A;  3FUM A;  4PU2 A;  3FUN A;  2DQ6 A;  2R59 A;  4K5M A;  3P7U E;  3FU5 A;  1QF1 A;  2ZXG A;  1FJ3 A;  2A7G E;  3FHE A;  1LNE E;  5JT9 E;  4QME A;  2GTQ A;  3B37 A;  4XN2 A;  4RVB A;  5FSS A;  4ZX6 A;  1SQM A;  3T73 A;  1KJP A;  4XND A;  3NQY B;  3MSF A;  3B7R L;  1LML A;  5DLH A;  1ZDP E;  3FH5 A;  3FUK A;  3EBG A;  3B2P A;  3FXP A;  3DO2 A;  3FUE A;  5DYF A;  4GAA A;  3QGO A;  1TLX A;  1OS0 A;  4XMT A;  4QIR A;  2DQM A;  1EZM A;  3DO0 A;  1PE7 A;  1KL6 A;  4XN4 A;  5FWQ A;  1L3F E;  5FSJ A;  3FUH A;  4R5X A;  4Q4I A;  5L8P E;  1Y3G E;  3FXS A;  5BPP A;  3P7R E;  3MS3 A;  3FUJ A;  1LNC E;  4D9W A;  3FOR A;  1GW6 A;  6TLI A;  3B34 A;  4XN5 A;  5JVI E;  4ZQT A;  4ZW5 A;  7TLN A;  3P7T E;  5TMN E;  4H57 A;  2TLI A;  3CIA A;  3FTW A;  1ESP A;  3Q44 A;  3P7W E;  4XMW A;  1FJO A;  1NPC A;  3P7Q E;  2TLX A;  3T2I E;  3FGD A;  1KR6 A;  3QH1 A;  1FJV A;  3T8D A;  2VQX A;  4L2L A;  4QPE A;  3TLI A;  4ZX3 A;  1H19 A;  2WI0 A;  4J3B A;  3F2P A;  3MSA A;  1TMN E;  4N66 E;  4XMZ A;  3SSB A;  4PW4 A;  3FUI A;  5LIF E;  3EIM A;  4XN9 A;  1GXW A;  3LS7 A;  3B2X A;  2XQ0 A;  4MWP E;  1KS7 A;  4RSY A;  4ZW7 A;  5TLN A;  3DNZ A;  1QF2 A;  1KJO A;  4MS6 A;  3NN7 A;  3T8H A;  4B52 A;  4ZW6 A;  3FTU A;  4XN7 A;  3FU3 A;  4XMU A;  5JXN E;  1FJT A;  1KTO A;  4K90 A;  5AEN A;  3T87 A;  4M65 A;  3F28 A;  1HYT A;  3QH5 A;  3CHR A;  3FU0 A;  4R5V A;  3CHO A;  5DPE E;  4XMX A;  1FJU A;  2XPZ A;  3FUF A;  5JSS E;  1LNB E;  1FJW A;  8TLI A;  3FTY A;  3NQZ B;  3PUU A;  4TLI A;  4QUO A;  1THL A;  1Z9G E;  3EBI A;  3FTZ A;  3FUD A;  3EBH A;  8TLN E;  3DO1 A;  3FLF A;  2HPT A;  5LWD E;  1FJQ A;  3DBK A;  1HS6 A;  2XPY A;  4MTW E;  4TLN A;  4XNB A;  5L41 E;  3FU6 A;  3P7P E;  3T8C A;  7TLI A;  4MZN E;  3FH7 A;  2WHZ A;  4N4E E;  3FTV A;  1LNF E;  6TMN E;  4MXJ E;  3B3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...