4GERA

Crystal structure of gentlyase, the neutral metalloprotease of paenibacillus polymyxa
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
304
structure length
304
Chain Sequence
b'ATGTGKGVLGDTKSFTTTASGSSYQLKDTTRGNGVVTYTASNRQSIPGTILTDADNVWNDPAGVDAHTYAAKTYDYYKAKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGSTFIAFSGDPDVVGHELTHGVTEYTSNLEYYGESGALNEAFSDVIGNDIQRKNWLVGDDIYTPNIAGDALRSMSNPTLYDQPDHYSNLYTGSSDNGGVHTNSGIINKAYYLLAQGGTFHGVTVNGIGRDAAVQIYYSAFTNYLTSSSDFSNARAAVIQAAKDQYGANSAEATAAAKSFDAVGVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentlyase metalloprotease
publication title Structure of Gentlyase, the neutral metalloprotease of Paenibacillus polymyxa.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 112
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 3.4.24.28: Bacillolysin.
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 4gerA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 4gerA01
3FXPA 3FTVA 1FJWA 3T87A 5A3YA 1U4GA 2XPYA 3P7QE 3FUKA 3CHSA 4XNBA 4MS6A 5TLNA 1FJ3A 3FUJA 4K89A 1FJTA 4H57A 1LNDE 3MSFA 3P7WE 1QF0A 3T2IE 2DQMA 2TMNE 3MS3A 4K5OA 3KEDA 1H19A 4OI5E 4R7LA 1HYTA 1FJOA 5AENA 2A7GE 3B7TA 4RSYA 4XMZA 3EBHA 4XMUA 5BPPA 2G4ZA 3B2PA 4TMNE 4Q4IA 4ZW3A 5HQDA 4N66E 1FJVA 1PE5A 3FTYA 4XN1A 4XNAA 4D9WA 1KEIA 1Z9GE 3P7UE 4J3BA 5JS3E 4XN4A 7TLIA 1GXWA 1KJOA 3FU3A 4L2LA 4RVBA 4ZX3A 2R59A 1KTOA 3FLFA 4XN8A 3T73A 3T8FA 1GW6A 3MSAA 3DBKA 3NQZB 4XNDA 5DLHA 3FTUA 3DO0A 3FGDA 4QMEA 4M65A 2TLXA 4XMXA 4MXJE 2XQ0A 4QUOA 3B7UX 4XO4A 5FSPA 3B7RL 3FUMA 5TLIA 2TLIA 3Q43A 1LNFE 4XN9A 5DLLA 4GAAA 5FWQA 7TLNA 3FXSA 1QF2A 2GTQA 3FCQA 2HPTA 4ZW7A 4XMVA 1KL6A 3FUDA 3P7RE 4XMTA 1TMNE 1FJQA 1EZMA 2WI0A 3FVPA 4TNLA 1BQBA 3B34A 4N4EE 5FSJA 3F28A 3QGOA 1ESPA 3FHEA 3T74A 4N5PE 1KS7A 3FTWA 5K7TA 4ZW6A 3ZI6A 4ZW5A 3FV4A 3T8HA 4MKTA 3T8DA 3T8VA 3FH5A 2WHZA 1HS6A 3SSBA 3T8GA 4QPEA 5JT9E 1NPCA 1KR6A 4PU2A 1TLIA 4R5XA 4B52A 1KKKA 4XO3A 4K5LA 4Q4EA 4ZX5A 3U9WA 5JXNE 4DPRA 2VJ8A 3N21A 4XMWA 2ZXGA 1PE8A 3CHOA 3LS7A 4MZNE 4TLIA 3NQXA 2HPOA 4D91A 4ZW8A 3QH5A 3FUIA 3DNZA 5JVIE 3F2PA 4K5NA 3CHRA 1LNAE 3CHQA 4XN2A 3MSNA 3EBIA 2XPZA 3EIMA 3FTXA 3FUFA 5TMNE 1THLA 3FB0A 5DYFA 3TLIA 3B7SA 3P7TE 4ZX4A 6TLIA 1OS0A 3B2XA 5LIFE 5FSSA 1PE7A 1KJPA 3FU5A 1L3FE 5DPEE 6TMNE 3CHPA 3FU0A 3FH7A 3DO2A 4XO5A 4R5VA 4GERA 4PW4A 4ZQTA 5L41E 1TLXA 4QHPA 3NQYB 3P7SE 1QF1A 5LWDE 2DQ6A 4R5TA 8TLIA 8TLNE 3T2JE 4X2UA 5JSSE 3QJXA 1LNEE 3FUNA 4XN5A 3TMNE 1TLPE 3FUEA 2VQXA 4K90A 4QIRA 1ZDPE 3FTZA 5DPFE 1TRLA 3FUHA 1Y3GE 3P7PE 5L8PE 1LNCE 3FTSA 3P7VE 4MWPE 3FH8A 4MTWE 1LNBE 3FBOA 4K5MA 5L3UE 3DO1A 3FORA 3T2HE 3QH1A 3FULA 3FU6A 3B37A 4XN7A 3EBGA 1SQMA 3NN7A 3Q44A 1FJUA 4OW3A 4TLNA 5FXNA 4K5PA 3T8CA 4PVBA 4ZX6A 3CIAA 3PUUA 3B3BA 1KROA
chains in the Genus database with same CATH superfamily
3FUKA 4MS6A 4KXAA 4H57A 1LNDE 1QF0A 1H19A 4XMZA 4TMNE 4D9WA 7TLIA 4RVBA 3FLFA 4M65A 2TLXA 3T8CA 4QUOA 4FYTA 2TLIA 4GAAA 3FXSA 2GTQA 2HPTA 4FCAA 5CU5A 3FVPA 4FKKA 4N4EE 3FHEA 3T74A 4N5PE 1KS7A 3FTWA 3T8HA 4MKTA 3T8DA 3FH5A 5LHDA 3SSBA 4FYRA 5JXNE 4FGMA 4K5LA 4Q4EA 4ZX5A 2VJ8A 1PE8A 4MZNE 4TLIA 3Q7JA 4ZW8A 3F2PA 3CHRA 3MSNA 5AB2A 2XPZA 5TMNE 3FB0A 4KX8A 6TLIA 1OS0A 3B2XA 5LIFE 3FU5A 5DPEE 3CHPA 5L41E 4PW4A 4IHQA 3T2JE 4X2UA 3FUNA 2VQXA 4QIRA 3FUHA 1LNCE 3FTSA 3P7VE 4MWPE 3FH8A 4MTWE 4K5MA 3QH1A 3B37A 3EBGA 4PVBA 4ZX6A 3CIAA 1KROA 4KXDA 1FJWA 3T87A 2XPYA 3CHSA 5TLNA 1FJTA 5J6SA 3P7WE 5C97A 4K5OA 4R7LA 3MS3A 3KEDA 5AENA 1HYTA 1FJOA 5K1VA 3EBHA 4PJ6A 4KXCA 2G4ZA 5HQDA 3FTYA 4XNAA 1KEIA 4XN4A 3FU3A 4E36A 4L2LA 4ZX3A 4XN8A 3T8FA 1GW6A 3DBKA 3DO0A 4QMEA 3B7UX 5FSPA 3B7RL 3FUMA 5FWQA 1QF2A 3FCQA 4XMVA 1BQBA 3B34A 3QGOA 4NAQA 3T8GA 4PU2A 1TLIA 4R5XA 4B52A 4XO3A 3CHOA 4D91A 3FUIA 4NZ8A 3EIMA 3FTXA 3FUFA 4F5CA 3B7SA 4ZX4A 4QHPA 3P7SE 4R5TA 8TLIA 8TLNE 4ARFA 4XN5A 3FUEA 1LNBE 3DO1A 3FULA 4OW3A 1FJUA 3B7TA 3PUUA 3B3BA 3FXPA 5A3YA 1U4GA 3P7QE 4XNBA 3FUJA 4RSYA 4XMUA 3B2PA 4ZW3A 4N66E 4XN1A 1Z9GE 4KX7A 2R59A 1KTOA 4XNDA 2XQ0A 3QNFA 5TLIA 4KX9A 1LNFE 7TLNA 2YD0A 3FUDA 1Z1WA 1TMNE 1EZMA 4TNLA 5FSJA 3F28A 4FKHA 1ESPA 4P8QA 5K7TA 3ZI6A 5AB0A 3T8VA 2WHZA 1HS6A 1KR6A 3U9WA 4DPRA 1LMLA 3N21A 2ZXGA 3LS7A 3NQXA 2HPOA 3QH5A 4AR9A 4WZ9A 4K5NA 4XN2A 4KXBA 1THLA 3TLIA 1PE7A 6TMNE 3FU0A 4XO5A 4R5VA 4GERA 4Z7IA 3NQYB 5LDSA 1QF1A 5LWDE 2DQ6A 4AR1A 3TMNE 1TLPE 5DPFE 3SE6A 3FBOA 3T2HE 1SQMA 3NN7A 3Q44A 3MDJA 4XMWA 4ZW7A 4ZW5A 3FTVA 4HOMA 4JBSA 1FJ3A 4K89A 3MSFA 3T2IE 2DQMA 2TMNE 4OI5E 2A7GE 5BPPA 4Q4IA 1FJVA 1PE5A 3P7UE 4J3BA 5JS3E 4FYQA 1GXWA 1KJOA 3T73A 3MSAA 3NQZB 5DLHA 3FTUA 3FGDA 4XMXA 4MXJE 4XO4A 5LG6A 3Q43A 4XN9A 5DLLA 1KL6A 3P7RE 4XMTA 1FJQA 2WI0A 5EV7A 4AR8A 4OU3A 4ZW6A 3FV4A 4QPEA 5JT9E 1NPCA 1KKKA 4FKEA 3DNZA 5JVIE 1LNAE 3CHQA 3EBIA 5DYFA 3P7TE 5FSSA 1KJPA 1L3FE 3FH7A 3DO2A 4ZQTA 1TLXA 4II7A 4FYSA 5JSSE 3QJXA 1LNEE 4K90A 1ZDPE 3FTZA 1TRLA 3P7PE 1Y3GE 5L8PE 5L3UE 3FORA 1Z5HA 4XN7A 3FU6A 4TLNA 5FXNA 4K5PA
chains in the Genus database with same CATH topology
3FXPA 3FTVA 1FJWA 3T87A 5A3YA 1U4GA 2XPYA 3P7QE 3FUKA 3CHSA 4XNBA 4MS6A 5TLNA 1FJ3A 3FUJA 4K89A 1FJTA 4H57A 1LNDE 3MSFA 3P7WE 1QF0A 3T2IE 2DQMA 2TMNE 3MS3A 4K5OA 3KEDA 1H19A 4OI5E 4R7LA 1HYTA 1FJOA 5AENA 2A7GE 3B7TA 4RSYA 4XMZA 3EBHA 4XMUA 5BPPA 2G4ZA 3B2PA 4TMNE 4Q4IA 4ZW3A 5HQDA 4N66E 1FJVA 1PE5A 3FTYA 4XN1A 4XNAA 4D9WA 1KEIA 1Z9GE 3P7UE 4J3BA 5JS3E 4XN4A 7TLIA 1GXWA 1KJOA 3FU3A 4L2LA 4RVBA 4ZX3A 2R59A 1KTOA 3FLFA 4XN8A 3T73A 3T8FA 1GW6A 3MSAA 3DBKA 3NQZB 4XNDA 5DLHA 3FTUA 3DO0A 3FGDA 4QMEA 4M65A 2TLXA 4XMXA 4MXJE 2XQ0A 4QUOA 3B7UX 4XO4A 5FSPA 3B7RL 3FUMA 5TLIA 2TLIA 3Q43A 1LNFE 4XN9A 5DLLA 4GAAA 5FWQA 7TLNA 3FXSA 1QF2A 2GTQA 3FCQA 2HPTA 4ZW7A 4XMVA 1KL6A 3FUDA 3P7RE 4XMTA 1TMNE 1FJQA 1EZMA 2WI0A 3FVPA 4TNLA 1BQBA 3B34A 4N4EE 5FSJA 3F28A 3QGOA 1ESPA 3FHEA 3T74A 4N5PE 1KS7A 3FTWA 5K7TA 4ZW6A 3ZI6A 4ZW5A 3FV4A 3T8HA 4MKTA 3T8DA 3T8VA 3FH5A 2WHZA 1HS6A 3SSBA 3T8GA 4QPEA 5JT9E 1NPCA 1KR6A 4PU2A 1TLIA 4R5XA 4B52A 1KKKA 4XO3A 4K5LA 4Q4EA 4ZX5A 3U9WA 5JXNE 4DPRA 2VJ8A 3N21A 4XMWA 1LMLA 2ZXGA 1PE8A 3CHOA 3LS7A 4MZNE 4TLIA 3NQXA 2HPOA 4D91A 4ZW8A 3QH5A 3FUIA 3DNZA 5JVIE 3F2PA 4K5NA 3CHRA 1LNAE 3CHQA 4XN2A 3MSNA 3EBIA 2XPZA 3EIMA 3FTXA 3FUFA 5TMNE 1THLA 3FB0A 5DYFA 3TLIA 3B7SA 3P7TE 4ZX4A 6TLIA 1OS0A 3B2XA 5LIFE 5FSSA 1PE7A 1KJPA 3FU5A 1L3FE 5DPEE 6TMNE 3CHPA 3FU0A 3FH7A 3DO2A 4XO5A 4R5VA 4GERA 4PW4A 4ZQTA 5L41E 1TLXA 4QHPA 3NQYB 3P7SE 1QF1A 5LWDE 2DQ6A 4R5TA 8TLIA 8TLNE 3T2JE 4X2UA 5JSSE 3QJXA 1LNEE 3FUNA 4XN5A 3TMNE 1TLPE 3FUEA 2VQXA 4K90A 4QIRA 1ZDPE 3FTZA 5DPFE 1TRLA 3FUHA 1Y3GE 3P7PE 5L8PE 1LNCE 3FTSA 3P7VE 4MWPE 3FH8A 4MTWE 1LNBE 3FBOA 4K5MA 5L3UE 3DO1A 3FORA 3T2HE 3QH1A 3FULA 3FU6A 3B37A 4XN7A 3EBGA 1SQMA 3NN7A 3Q44A 1FJUA 4OW3A 4TLNA 5FXNA 4K5PA 3T8CA 4PVBA 4ZX6A 3CIAA 3PUUA 3B3BA 1KROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXP A;  3FTV A;  1FJW A;  3T87 A;  5A3Y A;  1U4G A;  2XPY A;  3P7Q E;  3FUK A;  3CHS A;  4XNB A;  4MS6 A;  5TLN A;  1FJ3 A;  3FUJ A;  4K89 A;  1FJT A;  4H57 A;  1LND E;  3MSF A;  3P7W E;  1QF0 A;  3T2I E;  2DQM A;  2TMN E;  3MS3 A;  4K5O A;  3KED A;  1H19 A;  4OI5 E;  4R7L A;  1HYT A;  1FJO A;  5AEN A;  2A7G E;  3B7T A;  4RSY A;  4XMZ A;  3EBH A;  4XMU A;  5BPP A;  2G4Z A;  3B2P A;  4TMN E;  4Q4I A;  4ZW3 A;  5HQD A;  4N66 E;  1FJV A;  1PE5 A;  3FTY A;  4XN1 A;  4XNA A;  4D9W A;  1KEI A;  1Z9G E;  3P7U E;  4J3B A;  5JS3 E;  4XN4 A;  7TLI A;  1GXW A;  1KJO A;  3FU3 A;  4L2L A;  4RVB A;  4ZX3 A;  2R59 A;  1KTO A;  3FLF A;  4XN8 A;  3T73 A;  3T8F A;  1GW6 A;  3MSA A;  3DBK A;  3NQZ B;  4XND A;  5DLH A;  3FTU A;  3DO0 A;  3FGD A;  4QME A;  4M65 A;  2TLX A;  4XMX A;  4MXJ E;  2XQ0 A;  4QUO A;  3B7U X;  4XO4 A;  5FSP A;  3B7R L;  3FUM A;  5TLI A;  2TLI A;  3Q43 A;  1LNF E;  4XN9 A;  5DLL A;  4GAA A;  5FWQ A;  7TLN A;  3FXS A;  1QF2 A;  2GTQ A;  3FCQ A;  2HPT A;  4ZW7 A;  4XMV A;  1KL6 A;  3FUD A;  3P7R E;  4XMT A;  1TMN E;  1FJQ A;  1EZM A;  2WI0 A;  3FVP A;  4TNL A;  1BQB A;  3B34 A;  4N4E E;  5FSJ A;  3F28 A;  3QGO A;  1ESP A;  3FHE A;  3T74 A;  4N5P E;  1KS7 A;  3FTW A;  5K7T A;  4ZW6 A;  3ZI6 A;  4ZW5 A;  3FV4 A;  3T8H A;  4MKT A;  3T8D A;  3T8V A;  3FH5 A;  2WHZ A;  1HS6 A;  3SSB A;  3T8G A;  4QPE A;  5JT9 E;  1NPC A;  1KR6 A;  4PU2 A;  1TLI A;  4R5X A;  4B52 A;  1KKK A;  4XO3 A;  4K5L A;  4Q4E A;  4ZX5 A;  3U9W A;  5JXN E;  4DPR A;  2VJ8 A;  3N21 A;  4XMW A;  2ZXG A;  1PE8 A;  3CHO A;  3LS7 A;  4MZN E;  4TLI A;  3NQX A;  2HPO A;  4D91 A;  4ZW8 A;  3QH5 A;  3FUI A;  3DNZ A;  5JVI E;  3F2P A;  4K5N A;  3CHR A;  1LNA E;  3CHQ A;  4XN2 A;  3MSN A;  3EBI A;  2XPZ A;  3EIM A;  3FTX A;  3FUF A;  5TMN E;  1THL A;  3FB0 A;  5DYF A;  3TLI A;  3B7S A;  3P7T E;  4ZX4 A;  6TLI A;  1OS0 A;  3B2X A;  5LIF E;  5FSS A;  1PE7 A;  1KJP A;  3FU5 A;  1L3F E;  5DPE E;  6TMN E;  3CHP A;  3FU0 A;  3FH7 A;  3DO2 A;  4XO5 A;  4R5V A;  4GER A;  4PW4 A;  4ZQT A;  5L41 E;  1TLX A;  4QHP A;  3NQY B;  3P7S E;  1QF1 A;  5LWD E;  2DQ6 A;  4R5T A;  8TLI A;  8TLN E;  3T2J E;  4X2U A;  5JSS E;  3QJX A;  1LNE E;  3FUN A;  4XN5 A;  3TMN E;  1TLP E;  3FUE A;  2VQX A;  4K90 A;  4QIR A;  1ZDP E;  3FTZ A;  5DPF E;  1TRL A;  3FUH A;  1Y3G E;  3P7P E;  5L8P E;  1LNC E;  3FTS A;  3P7V E;  4MWP E;  3FH8 A;  4MTW E;  1LNB E;  3FBO A;  4K5M A;  5L3U E;  3DO1 A;  3FOR A;  3T2H E;  3QH1 A;  3FUL A;  3FU6 A;  3B37 A;  4XN7 A;  3EBG A;  1SQM A;  3NN7 A;  3Q44 A;  1FJU A;  4OW3 A;  4TLN A;  5FXN A;  4K5P A;  3T8C A;  4PVB A;  4ZX6 A;  3CIA A;  3PUU A;  3B3B A;  1KRO A; 
#chains in the Genus database with same CATH topology
 3FUK A;  4MS6 A;  4KXA A;  4H57 A;  1LND E;  1QF0 A;  1H19 A;  4XMZ A;  4TMN E;  4D9W A;  7TLI A;  4RVB A;  3FLF A;  4M65 A;  2TLX A;  3T8C A;  4QUO A;  4FYT A;  2TLI A;  4GAA A;  3FXS A;  2GTQ A;  2HPT A;  4FCA A;  5CU5 A;  3FVP A;  4FKK A;  4N4E E;  3FHE A;  3T74 A;  4N5P E;  1KS7 A;  3FTW A;  3T8H A;  4MKT A;  3T8D A;  3FH5 A;  5LHD A;  3SSB A;  4FYR A;  5JXN E;  4FGM A;  4K5L A;  4Q4E A;  4ZX5 A;  2VJ8 A;  1PE8 A;  4MZN E;  4TLI A;  3Q7J A;  4ZW8 A;  3F2P A;  3CHR A;  3MSN A;  5AB2 A;  2XPZ A;  5TMN E;  3FB0 A;  4KX8 A;  6TLI A;  1OS0 A;  3B2X A;  5LIF E;  3FU5 A;  5DPE E;  3CHP A;  5L41 E;  4PW4 A;  4IHQ A;  3T2J E;  4X2U A;  3FUN A;  2VQX A;  4QIR A;  3FUH A;  1LNC E;  3FTS A;  3P7V E;  4MWP E;  3FH8 A;  4MTW E;  4K5M A;  3QH1 A;  3B37 A;  3EBG A;  4PVB A;  4ZX6 A;  3CIA A;  1KRO A;  4KXD A;  1FJW A;  3T87 A;  2XPY A;  3CHS A;  5TLN A;  1FJT A;  5J6S A;  3P7W E;  5C97 A;  4K5O A;  4R7L A;  3MS3 A;  3KED A;  5AEN A;  1HYT A;  1FJO A;  5K1V A;  3EBH A;  4PJ6 A;  4KXC A;  2G4Z A;  5HQD A;  3FTY A;  4XNA A;  1KEI A;  4XN4 A;  3FU3 A;  4E36 A;  4L2L A;  4ZX3 A;  4XN8 A;  3T8F A;  1GW6 A;  3DBK A;  3DO0 A;  4QME A;  3B7U X;  5FSP A;  3B7R L;  3FUM A;  5FWQ A;  1QF2 A;  3FCQ A;  4XMV A;  1BQB A;  3B34 A;  3QGO A;  4NAQ A;  3T8G A;  4PU2 A;  1TLI A;  4R5X A;  4B52 A;  4XO3 A;  3CHO A;  4D91 A;  3FUI A;  4NZ8 A;  3EIM A;  3FTX A;  3FUF A;  4F5C A;  3B7S A;  4ZX4 A;  4QHP A;  3P7S E;  4R5T A;  8TLI A;  8TLN E;  4ARF A;  4XN5 A;  3FUE A;  1LNB E;  3DO1 A;  3FUL A;  4OW3 A;  1FJU A;  3B7T A;  3PUU A;  3B3B A;  3FXP A;  5A3Y A;  1U4G A;  3P7Q E;  4XNB A;  3FUJ A;  4RSY A;  4XMU A;  3B2P A;  4ZW3 A;  4N66 E;  4XN1 A;  1Z9G E;  4KX7 A;  2R59 A;  1KTO A;  4XND A;  2XQ0 A;  3QNF A;  5TLI A;  4KX9 A;  1LNF E;  7TLN A;  2YD0 A;  3FUD A;  1Z1W A;  1TMN E;  1EZM A;  4TNL A;  5FSJ A;  3F28 A;  4FKH A;  1ESP A;  4P8Q A;  5K7T A;  3ZI6 A;  5AB0 A;  3T8V A;  2WHZ A;  1HS6 A;  1KR6 A;  3U9W A;  4DPR A;  1LML A;  3N21 A;  2ZXG A;  3LS7 A;  3NQX A;  2HPO A;  3QH5 A;  4AR9 A;  4WZ9 A;  4K5N A;  4XN2 A;  4KXB A;  1THL A;  3TLI A;  1PE7 A;  6TMN E;  3FU0 A;  4XO5 A;  4R5V A;  4GER A;  4Z7I A;  3NQY B;  5LDS A;  1QF1 A;  5LWD E;  2DQ6 A;  4AR1 A;  3TMN E;  1TLP E;  5DPF E;  3SE6 A;  3FBO A;  3T2H E;  1SQM A;  3NN7 A;  3Q44 A;  3MDJ A;  4XMW A;  4ZW7 A;  4ZW5 A;  3FTV A;  4HOM A;  4JBS A;  1FJ3 A;  4K89 A;  3MSF A;  3T2I E;  2DQM A;  2TMN E;  4OI5 E;  2A7G E;  5BPP A;  4Q4I A;  1FJV A;  1PE5 A;  3P7U E;  4J3B A;  5JS3 E;  4FYQ A;  1GXW A;  1KJO A;  3T73 A;  3MSA A;  3NQZ B;  5DLH A;  3FTU A;  3FGD A;  4XMX A;  4MXJ E;  4XO4 A;  5LG6 A;  3Q43 A;  4XN9 A;  5DLL A;  1KL6 A;  3P7R E;  4XMT A;  1FJQ A;  2WI0 A;  5EV7 A;  4AR8 A;  4OU3 A;  4ZW6 A;  3FV4 A;  4QPE A;  5JT9 E;  1NPC A;  1KKK A;  4FKE A;  3DNZ A;  5JVI E;  1LNA E;  3CHQ A;  3EBI A;  5DYF A;  3P7T E;  5FSS A;  1KJP A;  1L3F E;  3FH7 A;  3DO2 A;  4ZQT A;  1TLX A;  4II7 A;  4FYS A;  5JSS E;  3QJX A;  1LNE E;  4K90 A;  1ZDP E;  3FTZ A;  1TRL A;  3P7P E;  1Y3G E;  5L8P E;  5L3U E;  3FOR A;  1Z5H A;  4XN7 A;  3FU6 A;  4TLN A;  5FXN A;  4K5P A; 
#chains in the Genus database with same CATH homology
 3FXP A;  3FTV A;  1FJW A;  3T87 A;  5A3Y A;  1U4G A;  2XPY A;  3P7Q E;  3FUK A;  3CHS A;  4XNB A;  4MS6 A;  5TLN A;  1FJ3 A;  3FUJ A;  4K89 A;  1FJT A;  4H57 A;  1LND E;  3MSF A;  3P7W E;  1QF0 A;  3T2I E;  2DQM A;  2TMN E;  3MS3 A;  4K5O A;  3KED A;  1H19 A;  4OI5 E;  4R7L A;  1HYT A;  1FJO A;  5AEN A;  2A7G E;  3B7T A;  4RSY A;  4XMZ A;  3EBH A;  4XMU A;  5BPP A;  2G4Z A;  3B2P A;  4TMN E;  4Q4I A;  4ZW3 A;  5HQD A;  4N66 E;  1FJV A;  1PE5 A;  3FTY A;  4XN1 A;  4XNA A;  4D9W A;  1KEI A;  1Z9G E;  3P7U E;  4J3B A;  5JS3 E;  4XN4 A;  7TLI A;  1GXW A;  1KJO A;  3FU3 A;  4L2L A;  4RVB A;  4ZX3 A;  2R59 A;  1KTO A;  3FLF A;  4XN8 A;  3T73 A;  3T8F A;  1GW6 A;  3MSA A;  3DBK A;  3NQZ B;  4XND A;  5DLH A;  3FTU A;  3DO0 A;  3FGD A;  4QME A;  4M65 A;  2TLX A;  4XMX A;  4MXJ E;  2XQ0 A;  4QUO A;  3B7U X;  4XO4 A;  5FSP A;  3B7R L;  3FUM A;  5TLI A;  2TLI A;  3Q43 A;  1LNF E;  4XN9 A;  5DLL A;  4GAA A;  5FWQ A;  7TLN A;  3FXS A;  1QF2 A;  2GTQ A;  3FCQ A;  2HPT A;  4ZW7 A;  4XMV A;  1KL6 A;  3FUD A;  3P7R E;  4XMT A;  1TMN E;  1FJQ A;  1EZM A;  2WI0 A;  3FVP A;  4TNL A;  1BQB A;  3B34 A;  4N4E E;  5FSJ A;  3F28 A;  3QGO A;  1ESP A;  3FHE A;  3T74 A;  4N5P E;  1KS7 A;  3FTW A;  5K7T A;  4ZW6 A;  3ZI6 A;  4ZW5 A;  3FV4 A;  3T8H A;  4MKT A;  3T8D A;  3T8V A;  3FH5 A;  2WHZ A;  1HS6 A;  3SSB A;  3T8G A;  4QPE A;  5JT9 E;  1NPC A;  1KR6 A;  4PU2 A;  1TLI A;  4R5X A;  4B52 A;  1KKK A;  4XO3 A;  4K5L A;  4Q4E A;  4ZX5 A;  3U9W A;  5JXN E;  4DPR A;  2VJ8 A;  3N21 A;  4XMW A;  1LML A;  2ZXG A;  1PE8 A;  3CHO A;  3LS7 A;  4MZN E;  4TLI A;  3NQX A;  2HPO A;  4D91 A;  4ZW8 A;  3QH5 A;  3FUI A;  3DNZ A;  5JVI E;  3F2P A;  4K5N A;  3CHR A;  1LNA E;  3CHQ A;  4XN2 A;  3MSN A;  3EBI A;  2XPZ A;  3EIM A;  3FTX A;  3FUF A;  5TMN E;  1THL A;  3FB0 A;  5DYF A;  3TLI A;  3B7S A;  3P7T E;  4ZX4 A;  6TLI A;  1OS0 A;  3B2X A;  5LIF E;  5FSS A;  1PE7 A;  1KJP A;  3FU5 A;  1L3F E;  5DPE E;  6TMN E;  3CHP A;  3FU0 A;  3FH7 A;  3DO2 A;  4XO5 A;  4R5V A;  4GER A;  4PW4 A;  4ZQT A;  5L41 E;  1TLX A;  4QHP A;  3NQY B;  3P7S E;  1QF1 A;  5LWD E;  2DQ6 A;  4R5T A;  8TLI A;  8TLN E;  3T2J E;  4X2U A;  5JSS E;  3QJX A;  1LNE E;  3FUN A;  4XN5 A;  3TMN E;  1TLP E;  3FUE A;  2VQX A;  4K90 A;  4QIR A;  1ZDP E;  3FTZ A;  5DPF E;  1TRL A;  3FUH A;  1Y3G E;  3P7P E;  5L8P E;  1LNC E;  3FTS A;  3P7V E;  4MWP E;  3FH8 A;  4MTW E;  1LNB E;  3FBO A;  4K5M A;  5L3U E;  3DO1 A;  3FOR A;  3T2H E;  3QH1 A;  3FUL A;  3FU6 A;  3B37 A;  4XN7 A;  3EBG A;  1SQM A;  3NN7 A;  3Q44 A;  1FJU A;  4OW3 A;  4TLN A;  5FXN A;  4K5P A;  3T8C A;  4PVB A;  4ZX6 A;  3CIA A;  3PUU A;  3B3B A;  1KRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...