4GERA

Crystal structure of gentlyase, the neutral metalloprotease of paenibacillus polymyxa
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
304
structure length
304
Chain Sequence
ATGTGKGVLGDTKSFTTTASGSSYQLKDTTRGNGVVTYTASNRQSIPGTILTDADNVWNDPAGVDAHTYAAKTYDYYKAKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGSTFIAFSGDPDVVGHELTHGVTEYTSNLEYYGESGALNEAFSDVIGNDIQRKNWLVGDDIYTPNIAGDALRSMSNPTLYDQPDHYSNLYTGSSDNGGVHTNSGIINKAYYLLAQGGTFHGVTVNGIGRDAAVQIYYSAFTNYLTSSSDFSNARAAVIQAAKDQYGANSAEATAAAKSFDAVGVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentlyase metalloprotease
publication title Structure of Gentlyase, the neutral metalloprotease of Paenibacillus polymyxa.
pubmed doi rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
total genus 112
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 3.4.24.28: Bacillolysin.
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 4gerA02
3.10.170.10 Alpha Beta Roll Elastase; domain 1 Elastase; domain 1 4gerA01
3FORA 3T87A 8TLNE 4TLNA 5AENA 3FUIA 2ZXGA 3FXSA 1L3FE 3T8HA 3FTXA 4XN2A 3DNZA 4MXJE 5HQDA 4XO3A 1GW6A 5FXNA 4XMVA 3T8GA 4RVBA 3FUEA 4MTWE 3FUKA 4Q4IA 4XN7A 4K5LA 3QH5A 3TLIA 5LIFE 4ZX3A 3EIMA 3ZI6A 1KTOA 3FTYA 3U9WA 1TLXA 4K5OA 4OW3A 3P7RE 6TLIA 3QGOA 2VJ8A 4K90A 4ZW3A 5DPEE 4XMTA 1ZDPE 2TMNE 4XN5A 1GXWA 1FJWA 1PE5A 5L41E 1TRLA 5JS3E 3FTVA 3FUJA 3FTSA 4GERA 3B7RL 4D91A 3LS7A 1QF2A 2G4ZA 4M65A 5LWDE 4XN9A 3F28A 3FU6A 6TMNE 1EZMA 2DQ6A 5DLHA 3FB0A 5DYFA 3T73A 5FSPA 1FJUA 4XN4A 3T8CA 3FVPA 3FV4A 1HYTA 4ZW8A 3PUUA 3B7TA 4XNBA 1TMNE 2VQXA 4K89A 4ZW7A 1LNFE 3FUFA 3P7QE 3FLFA 3B37A 3NQZB 4K5MA 4R7LA 1LNCE 4J3BA 4Q4EA 4QHPA 3FTWA 4XO4A 4PU2A 2DQMA 2HPTA 3T8FA 1KKKA 3B7SA 3FHEA 3DBKA 3FXPA 3FTZA 4GAAA 4XMZA 4XN1A 2WHZA 3FGDA 3T8VA 1FJTA 1TLPE 1LNDE 5BPPA 1KEIA 4ZX6A 1PE8A 3QH1A 3Q43A 5TLNA 1KJOA 4PW4A 5L8PE 4RSYA 1QF1A 5JT9E 1KL6A 4N4EE 4QUOA 3F2PA 1BQBA 4N5PE 3NQXA 2XPZA 3MSFA 4X2UA 5DLLA 4K5PA 4MS6A 5FSSA 4TNLA 4XMUA 4XMWA 2GTQA 5DPFE 4ZW5A 3EBGA 8TLIA 5K7TA 2TLXA 1THLA 3FULA 3NQYB 1FJ3A 1Y3GE 4R5VA 3Q44A 5JXNE 3P7PE 1HS6A 2XPYA 1LNBE 4ZW6A 3MSAA 3SSBA 1FJQA 2HPOA 1U4GA 3FH5A 3QJXA 4QMEA 5FSJA 4PVBA 3FUDA 3T2IE 3CHRA 2TLIA 3T2HE 3FU0A 3NN7A 4N66E 4OI5E 3B2XA 1LNEE 4D9WA 3B7UX 4DPRA 1OS0A 3MS3A 7TLNA 1H19A 3FTUA 3CHQA 5JSSE 1NPCA 4XN8A 1PE7A 1KROA 3P7TE 3FH7A 4TLIA 5TLIA 3T2JE 3CHSA 4B52A 7TLIA 3B34A 1TLIA 3FU3A 4XNAA 3TMNE 5JVIE 3P7SE 1KR6A 5TMNE 3FCQA 2XQ0A 3EBHA 4ZQTA 3FUHA 5L3UE 1KJPA 2WI0A 1Z9GE 3B3BA 3CHOA 3DO1A 4QPEA 4XMXA 4ZX5A 1LNAE 3P7UE 3KEDA 3CIAA 5A3YA 1KS7A 2A7GE 3T8DA 3P7WE 4TMNE 5FWQA 3B2PA 4XNDA 1FJOA 3FBOA 1ESPA 4H57A 4XO5A 1SQMA 3FUNA 4L2LA 3FUMA 3DO0A 4R5TA 4MZNE 4MWPE 4ZX4A 3MSNA 4K5NA 3FH8A 3P7VE 4MKTA 4R5XA 3N21A 1QF0A 2R59A 3EBIA 4QIRA 3FU5A 3T74A 3CHPA 1FJVA 3DO2A
chains in the Genus database with same CATH superfamily
1L3FE 3T8HA 3FXSA 4XO3A 4XMVA 3FUKA 5EV7A 5LIFE 5AB0A 3ZI6A 1KTOA 3U9WA 5C97A 4K90A 4XMTA 2TMNE 1PE5A 1TRLA 5JS3E 3FTVA 4KX7A 3B7RL 4D91A 3LS7A 1EZMA 4XN4A 3FVPA 3B7TA 5LHDA 3FLFA 3NQZB 4K5MA 4FYQA 4Q4EA 4XMZA 1FJTA 4FYSA 3Q43A 5L8PE 1KL6A 4N4EE 1BQBA 3MSFA 5DLLA 4K5PA 5FSSA 5DPFE 3EBGA 3Q44A 3P7PE 3MSAA 1U4GA 3FH5A 4QMEA 3CHRA 3FU0A 3NN7A 4N66E 4DPRA 4OI5E 3B2XA 3CHQA 5TLIA 3FH7A 4TLIA 3CHSA 1TLIA 3MDJA 3P7SE 1Z5HA 1KR6A 2WI0A 3DO1A 1Z9GE 3P7UE 4TMNE 1ESPA 4XO5A 4MWPE 4K5NA 4MKTA 1LMLA 3T74A 3T87A 4OU3A 4TLNA 3FUIA 3FTXA 4XN2A 3DNZA 4MXJE 4Q4IA 4K5LA 3QH5A 4ZX3A 4JBSA 4PJ6A 3Q7JA 4OW3A 3P7RE 6TLIA 4KX8A 1FJWA 1QF2A 4M65A 5LWDE 4XN9A 3FB0A 5FSPA 1FJUA 1HYTA 3PUUA 5LDSA 3B37A 4XO4A 3QNFA 2DQMA 3FXPA 4XN1A 3T8VA 4FKKA 1TLPE 1LNDE 1KEIA 1PE8A 4RSYA 3NQXA 2XPZA 4MS6A 4XMWA 4ZW5A 2TLXA 3FULA 3NQYB 1FJ3A 1LNBE 3SSBA 1FJQA 3QJXA 2TLIA 3T2HE 4P8QA 4D9WA 5LG6A 3FTUA 4E36A 4II7A 1NPCA 1KROA 7TLIA 4XNAA 5TMNE 2XQ0A 4ZQTA 5L3UE 3B3BA 4QPEA 4FYRA 3T8DA 2A7GE 3P7WE 1FJOA 3FBOA 4L2LA 4MZNE 3N21A 1QF0A 4AR1A 3FU5A 3DO2A 3FORA 8TLNE 5AENA 2ZXGA 4HOMA 5HQDA 1GW6A 4RVBA 4XN7A 3FTYA 4K5OA 3QGOA 4ZW3A 1ZDPE 4XN5A 3FUJA 4AR8A 6TMNE 5DYFA 3T8CA 3FV4A 1LNFE 4AR9A 4QHPA 1LNCE 3T8FA 1KKKA 3B7SA 3FTZA 4ZX6A 3QH1A 1KJOA 4PW4A 1QF1A 4QUOA 4X2UA 5JXNE 4XMUA 2GTQA 4FKEA 1THLA 2XPYA 2HPOA 5FSJA 4ARFA 4KX9A 7TLNA 1OS0A 1H19A 5JSSE 4XN8A 5K1VA 1PE7A 3T2JE 4B52A 3FU3A 1Z1WA 5JVIE 4WZ9A 1KJPA 4ZX5A 1LNAE 5A3YA 3CIAA 1KS7A 5FWQA 3B2PA 3FUNA 3FUMA 3DO0A 4R5TA 4ZX4A 5AB2A 3MSNA 4FGMA 3P7VE 2R59A 4QIRA 5FXNA 3T8GA 3FUEA 4MTWE 3TLIA 4KXDA 3EIMA 1TLXA 2VJ8A 5DPEE 1GXWA 5L41E 4IHQA 4F5CA 4NAQA 3FTSA 4GERA 2G4ZA 3F28A 3FU6A 4NZ8A 2DQ6A 3T73A 3SE6A 4ZW8A 2YD0A 4XNBA 1TMNE 2VQXA 4K89A 4ZW7A 3FUFA 3P7QE 4R7LA 4ZW6A 4J3BA 2HPTA 3FTWA 4PU2A 5DLHA 3FHEA 4GAAA 3DBKA 2WHZA 3FGDA 4KXAA 5BPPA 5TLNA 4FCAA 5JT9E 3F2PA 4N5PE 4FKHA 4KXBA 4TNLA 5K7TA 8TLIA 1Y3GE 4R5VA 1HS6A 4PVBA 3FUDA 3T2IE 5CU5A 4Z7IA 5J6SA 1LNEE 3B7UX 3MS3A 4KXCA 3P7TE 3B34A 3TMNE 3FCQA 3EBHA 3FUHA 3CHOA 4XMXA 3KEDA 4FYTA 4XNDA 4H57A 1SQMA 4R5XA 3FH8A 3EBIA 3CHPA 1FJVA
chains in the Genus database with same CATH topology
3FORA 3T87A 8TLNE 4TLNA 5AENA 3FUIA 2ZXGA 3FXSA 1L3FE 3T8HA 3FTXA 4XN2A 3DNZA 4MXJE 5HQDA 4XO3A 1GW6A 5FXNA 4XMVA 3T8GA 4RVBA 3FUEA 4MTWE 3FUKA 4Q4IA 4XN7A 4K5LA 3QH5A 3TLIA 5LIFE 4ZX3A 3EIMA 3ZI6A 1KTOA 3FTYA 3U9WA 1TLXA 4K5OA 4OW3A 3P7RE 6TLIA 3QGOA 2VJ8A 4K90A 4ZW3A 5DPEE 4XMTA 1ZDPE 2TMNE 4XN5A 1GXWA 1FJWA 1PE5A 5L41E 1TRLA 5JS3E 3FTVA 3FUJA 3FTSA 4GERA 3B7RL 4D91A 3LS7A 1QF2A 2G4ZA 4M65A 5LWDE 4XN9A 3F28A 3FU6A 6TMNE 1EZMA 2DQ6A 5DLHA 3FB0A 5DYFA 3T73A 5FSPA 1FJUA 4XN4A 3T8CA 3FVPA 3FV4A 1HYTA 4ZW8A 3PUUA 3B7TA 4XNBA 1TMNE 2VQXA 4K89A 4ZW7A 1LNFE 3FUFA 3P7QE 3FLFA 3B37A 3NQZB 4K5MA 4R7LA 1LNCE 4J3BA 4Q4EA 4QHPA 3FTWA 4XO4A 4PU2A 2DQMA 2HPTA 3T8FA 1KKKA 3B7SA 3FHEA 3DBKA 3FXPA 3FTZA 4GAAA 4XMZA 4XN1A 2WHZA 3FGDA 3T8VA 1FJTA 1TLPE 1LNDE 5BPPA 1KEIA 4ZX6A 1PE8A 3QH1A 3Q43A 5TLNA 1KJOA 4PW4A 5L8PE 4RSYA 1QF1A 5JT9E 1KL6A 4N4EE 4QUOA 3F2PA 1BQBA 4N5PE 3NQXA 2XPZA 3MSFA 4X2UA 5DLLA 4K5PA 4MS6A 5FSSA 4TNLA 4XMUA 4XMWA 2GTQA 5DPFE 4ZW5A 3EBGA 8TLIA 5K7TA 2TLXA 1THLA 3FULA 3NQYB 1FJ3A 1Y3GE 4R5VA 3Q44A 5JXNE 3P7PE 1HS6A 2XPYA 1LNBE 4ZW6A 3MSAA 3SSBA 1FJQA 2HPOA 1U4GA 3FH5A 3QJXA 4QMEA 5FSJA 4PVBA 3FUDA 3T2IE 3CHRA 2TLIA 3T2HE 3FU0A 3NN7A 4N66E 4OI5E 3B2XA 1LNEE 4D9WA 3B7UX 4DPRA 1OS0A 3MS3A 7TLNA 1H19A 3FTUA 3CHQA 5JSSE 1NPCA 4XN8A 1PE7A 1KROA 3P7TE 3FH7A 4TLIA 5TLIA 3T2JE 3CHSA 4B52A 7TLIA 3B34A 1TLIA 3FU3A 4XNAA 3TMNE 5JVIE 3P7SE 1KR6A 5TMNE 3FCQA 2XQ0A 3EBHA 4ZQTA 3FUHA 5L3UE 1KJPA 2WI0A 1Z9GE 3B3BA 3CHOA 3DO1A 4QPEA 4XMXA 4ZX5A 1LNAE 3P7UE 3KEDA 3CIAA 5A3YA 1KS7A 2A7GE 3T8DA 3P7WE 4TMNE 5FWQA 3B2PA 4XNDA 1FJOA 3FBOA 1ESPA 4H57A 4XO5A 1SQMA 3FUNA 4L2LA 3FUMA 3DO0A 4R5TA 4MZNE 4MWPE 4ZX4A 3MSNA 4K5NA 3FH8A 3P7VE 4MKTA 4R5XA 3N21A 1LMLA 1QF0A 2R59A 3EBIA 4QIRA 3FU5A 3T74A 3CHPA 1FJVA 3DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOR A;  3T87 A;  8TLN E;  4TLN A;  5AEN A;  3FUI A;  2ZXG A;  3FXS A;  1L3F E;  3T8H A;  3FTX A;  4XN2 A;  3DNZ A;  4MXJ E;  5HQD A;  4XO3 A;  1GW6 A;  5FXN A;  4XMV A;  3T8G A;  4RVB A;  3FUE A;  4MTW E;  3FUK A;  4Q4I A;  4XN7 A;  4K5L A;  3QH5 A;  3TLI A;  5LIF E;  4ZX3 A;  3EIM A;  3ZI6 A;  1KTO A;  3FTY A;  3U9W A;  1TLX A;  4K5O A;  4OW3 A;  3P7R E;  6TLI A;  3QGO A;  2VJ8 A;  4K90 A;  4ZW3 A;  5DPE E;  4XMT A;  1ZDP E;  2TMN E;  4XN5 A;  1GXW A;  1FJW A;  1PE5 A;  5L41 E;  1TRL A;  5JS3 E;  3FTV A;  3FUJ A;  3FTS A;  4GER A;  3B7R L;  4D91 A;  3LS7 A;  1QF2 A;  2G4Z A;  4M65 A;  5LWD E;  4XN9 A;  3F28 A;  3FU6 A;  6TMN E;  1EZM A;  2DQ6 A;  5DLH A;  3FB0 A;  5DYF A;  3T73 A;  5FSP A;  1FJU A;  4XN4 A;  3T8C A;  3FVP A;  3FV4 A;  1HYT A;  4ZW8 A;  3PUU A;  3B7T A;  4XNB A;  1TMN E;  2VQX A;  4K89 A;  4ZW7 A;  1LNF E;  3FUF A;  3P7Q E;  3FLF A;  3B37 A;  3NQZ B;  4K5M A;  4R7L A;  1LNC E;  4J3B A;  4Q4E A;  4QHP A;  3FTW A;  4XO4 A;  4PU2 A;  2DQM A;  2HPT A;  3T8F A;  1KKK A;  3B7S A;  3FHE A;  3DBK A;  3FXP A;  3FTZ A;  4GAA A;  4XMZ A;  4XN1 A;  2WHZ A;  3FGD A;  3T8V A;  1FJT A;  1TLP E;  1LND E;  5BPP A;  1KEI A;  4ZX6 A;  1PE8 A;  3QH1 A;  3Q43 A;  5TLN A;  1KJO A;  4PW4 A;  5L8P E;  4RSY A;  1QF1 A;  5JT9 E;  1KL6 A;  4N4E E;  4QUO A;  3F2P A;  1BQB A;  4N5P E;  3NQX A;  2XPZ A;  3MSF A;  4X2U A;  5DLL A;  4K5P A;  4MS6 A;  5FSS A;  4TNL A;  4XMU A;  4XMW A;  2GTQ A;  5DPF E;  4ZW5 A;  3EBG A;  8TLI A;  5K7T A;  2TLX A;  1THL A;  3FUL A;  3NQY B;  1FJ3 A;  1Y3G E;  4R5V A;  3Q44 A;  5JXN E;  3P7P E;  1HS6 A;  2XPY A;  1LNB E;  4ZW6 A;  3MSA A;  3SSB A;  1FJQ A;  2HPO A;  1U4G A;  3FH5 A;  3QJX A;  4QME A;  5FSJ A;  4PVB A;  3FUD A;  3T2I E;  3CHR A;  2TLI A;  3T2H E;  3FU0 A;  3NN7 A;  4N66 E;  4OI5 E;  3B2X A;  1LNE E;  4D9W A;  3B7U X;  4DPR A;  1OS0 A;  3MS3 A;  7TLN A;  1H19 A;  3FTU A;  3CHQ A;  5JSS E;  1NPC A;  4XN8 A;  1PE7 A;  1KRO A;  3P7T E;  3FH7 A;  4TLI A;  5TLI A;  3T2J E;  3CHS A;  4B52 A;  7TLI A;  3B34 A;  1TLI A;  3FU3 A;  4XNA A;  3TMN E;  5JVI E;  3P7S E;  1KR6 A;  5TMN E;  3FCQ A;  2XQ0 A;  3EBH A;  4ZQT A;  3FUH A;  5L3U E;  1KJP A;  2WI0 A;  1Z9G E;  3B3B A;  3CHO A;  3DO1 A;  4QPE A;  4XMX A;  4ZX5 A;  1LNA E;  3P7U E;  3KED A;  3CIA A;  5A3Y A;  1KS7 A;  2A7G E;  3T8D A;  3P7W E;  4TMN E;  5FWQ A;  3B2P A;  4XND A;  1FJO A;  3FBO A;  1ESP A;  4H57 A;  4XO5 A;  1SQM A;  3FUN A;  4L2L A;  3FUM A;  3DO0 A;  4R5T A;  4MZN E;  4MWP E;  4ZX4 A;  3MSN A;  4K5N A;  3FH8 A;  3P7V E;  4MKT A;  4R5X A;  3N21 A;  1QF0 A;  2R59 A;  3EBI A;  4QIR A;  3FU5 A;  3T74 A;  3CHP A;  1FJV A;  3DO2 A; 
#chains in the Genus database with same CATH topology
 1L3F E;  3T8H A;  3FXS A;  4XO3 A;  4XMV A;  3FUK A;  5EV7 A;  5LIF E;  5AB0 A;  3ZI6 A;  1KTO A;  3U9W A;  5C97 A;  4K90 A;  4XMT A;  2TMN E;  1PE5 A;  1TRL A;  5JS3 E;  3FTV A;  4KX7 A;  3B7R L;  4D91 A;  3LS7 A;  1EZM A;  4XN4 A;  3FVP A;  3B7T A;  5LHD A;  3FLF A;  3NQZ B;  4K5M A;  4FYQ A;  4Q4E A;  4XMZ A;  1FJT A;  4FYS A;  3Q43 A;  5L8P E;  1KL6 A;  4N4E E;  1BQB A;  3MSF A;  5DLL A;  4K5P A;  5FSS A;  5DPF E;  3EBG A;  3Q44 A;  3P7P E;  3MSA A;  1U4G A;  3FH5 A;  4QME A;  3CHR A;  3FU0 A;  3NN7 A;  4N66 E;  4DPR A;  4OI5 E;  3B2X A;  3CHQ A;  5TLI A;  3FH7 A;  4TLI A;  3CHS A;  1TLI A;  3MDJ A;  3P7S E;  1Z5H A;  1KR6 A;  2WI0 A;  3DO1 A;  1Z9G E;  3P7U E;  4TMN E;  1ESP A;  4XO5 A;  4MWP E;  4K5N A;  4MKT A;  1LML A;  3T74 A;  3T87 A;  4OU3 A;  4TLN A;  3FUI A;  3FTX A;  4XN2 A;  3DNZ A;  4MXJ E;  4Q4I A;  4K5L A;  3QH5 A;  4ZX3 A;  4JBS A;  4PJ6 A;  3Q7J A;  4OW3 A;  3P7R E;  6TLI A;  4KX8 A;  1FJW A;  1QF2 A;  4M65 A;  5LWD E;  4XN9 A;  3FB0 A;  5FSP A;  1FJU A;  1HYT A;  3PUU A;  5LDS A;  3B37 A;  4XO4 A;  3QNF A;  2DQM A;  3FXP A;  4XN1 A;  3T8V A;  4FKK A;  1TLP E;  1LND E;  1KEI A;  1PE8 A;  4RSY A;  3NQX A;  2XPZ A;  4MS6 A;  4XMW A;  4ZW5 A;  2TLX A;  3FUL A;  3NQY B;  1FJ3 A;  1LNB E;  3SSB A;  1FJQ A;  3QJX A;  2TLI A;  3T2H E;  4P8Q A;  4D9W A;  5LG6 A;  3FTU A;  4E36 A;  4II7 A;  1NPC A;  1KRO A;  7TLI A;  4XNA A;  5TMN E;  2XQ0 A;  4ZQT A;  5L3U E;  3B3B A;  4QPE A;  4FYR A;  3T8D A;  2A7G E;  3P7W E;  1FJO A;  3FBO A;  4L2L A;  4MZN E;  3N21 A;  1QF0 A;  4AR1 A;  3FU5 A;  3DO2 A;  3FOR A;  8TLN E;  5AEN A;  2ZXG A;  4HOM A;  5HQD A;  1GW6 A;  4RVB A;  4XN7 A;  3FTY A;  4K5O A;  3QGO A;  4ZW3 A;  1ZDP E;  4XN5 A;  3FUJ A;  4AR8 A;  6TMN E;  5DYF A;  3T8C A;  3FV4 A;  1LNF E;  4AR9 A;  4QHP A;  1LNC E;  3T8F A;  1KKK A;  3B7S A;  3FTZ A;  4ZX6 A;  3QH1 A;  1KJO A;  4PW4 A;  1QF1 A;  4QUO A;  4X2U A;  5JXN E;  4XMU A;  2GTQ A;  4FKE A;  1THL A;  2XPY A;  2HPO A;  5FSJ A;  4ARF A;  4KX9 A;  7TLN A;  1OS0 A;  1H19 A;  5JSS E;  4XN8 A;  5K1V A;  1PE7 A;  3T2J E;  4B52 A;  3FU3 A;  1Z1W A;  5JVI E;  4WZ9 A;  1KJP A;  4ZX5 A;  1LNA E;  5A3Y A;  3CIA A;  1KS7 A;  5FWQ A;  3B2P A;  3FUN A;  3FUM A;  3DO0 A;  4R5T A;  4ZX4 A;  5AB2 A;  3MSN A;  4FGM A;  3P7V E;  2R59 A;  4QIR A;  5FXN A;  3T8G A;  3FUE A;  4MTW E;  3TLI A;  4KXD A;  3EIM A;  1TLX A;  2VJ8 A;  5DPE E;  1GXW A;  5L41 E;  4IHQ A;  4F5C A;  4NAQ A;  3FTS A;  4GER A;  2G4Z A;  3F28 A;  3FU6 A;  4NZ8 A;  2DQ6 A;  3T73 A;  3SE6 A;  4ZW8 A;  2YD0 A;  4XNB A;  1TMN E;  2VQX A;  4K89 A;  4ZW7 A;  3FUF A;  3P7Q E;  4R7L A;  4ZW6 A;  4J3B A;  2HPT A;  3FTW A;  4PU2 A;  5DLH A;  3FHE A;  4GAA A;  3DBK A;  2WHZ A;  3FGD A;  4KXA A;  5BPP A;  5TLN A;  4FCA A;  5JT9 E;  3F2P A;  4N5P E;  4FKH A;  4KXB A;  4TNL A;  5K7T A;  8TLI A;  1Y3G E;  4R5V A;  1HS6 A;  4PVB A;  3FUD A;  3T2I E;  5CU5 A;  4Z7I A;  5J6S A;  1LNE E;  3B7U X;  3MS3 A;  4KXC A;  3P7T E;  3B34 A;  3TMN E;  3FCQ A;  3EBH A;  3FUH A;  3CHO A;  4XMX A;  3KED A;  4FYT A;  4XND A;  4H57 A;  1SQM A;  4R5X A;  3FH8 A;  3EBI A;  3CHP A;  1FJV A; 
#chains in the Genus database with same CATH homology
 3FOR A;  3T87 A;  8TLN E;  4TLN A;  5AEN A;  3FUI A;  2ZXG A;  3FXS A;  1L3F E;  3T8H A;  3FTX A;  4XN2 A;  3DNZ A;  4MXJ E;  5HQD A;  4XO3 A;  1GW6 A;  5FXN A;  4XMV A;  3T8G A;  4RVB A;  3FUE A;  4MTW E;  3FUK A;  4Q4I A;  4XN7 A;  4K5L A;  3QH5 A;  3TLI A;  5LIF E;  4ZX3 A;  3EIM A;  3ZI6 A;  1KTO A;  3FTY A;  3U9W A;  1TLX A;  4K5O A;  4OW3 A;  3P7R E;  6TLI A;  3QGO A;  2VJ8 A;  4K90 A;  4ZW3 A;  5DPE E;  4XMT A;  1ZDP E;  2TMN E;  4XN5 A;  1GXW A;  1FJW A;  1PE5 A;  5L41 E;  1TRL A;  5JS3 E;  3FTV A;  3FUJ A;  3FTS A;  4GER A;  3B7R L;  4D91 A;  3LS7 A;  1QF2 A;  2G4Z A;  4M65 A;  5LWD E;  4XN9 A;  3F28 A;  3FU6 A;  6TMN E;  1EZM A;  2DQ6 A;  5DLH A;  3FB0 A;  5DYF A;  3T73 A;  5FSP A;  1FJU A;  4XN4 A;  3T8C A;  3FVP A;  3FV4 A;  1HYT A;  4ZW8 A;  3PUU A;  3B7T A;  4XNB A;  1TMN E;  2VQX A;  4K89 A;  4ZW7 A;  1LNF E;  3FUF A;  3P7Q E;  3FLF A;  3B37 A;  3NQZ B;  4K5M A;  4R7L A;  1LNC E;  4J3B A;  4Q4E A;  4QHP A;  3FTW A;  4XO4 A;  4PU2 A;  2DQM A;  2HPT A;  3T8F A;  1KKK A;  3B7S A;  3FHE A;  3DBK A;  3FXP A;  3FTZ A;  4GAA A;  4XMZ A;  4XN1 A;  2WHZ A;  3FGD A;  3T8V A;  1FJT A;  1TLP E;  1LND E;  5BPP A;  1KEI A;  4ZX6 A;  1PE8 A;  3QH1 A;  3Q43 A;  5TLN A;  1KJO A;  4PW4 A;  5L8P E;  4RSY A;  1QF1 A;  5JT9 E;  1KL6 A;  4N4E E;  4QUO A;  3F2P A;  1BQB A;  4N5P E;  3NQX A;  2XPZ A;  3MSF A;  4X2U A;  5DLL A;  4K5P A;  4MS6 A;  5FSS A;  4TNL A;  4XMU A;  4XMW A;  2GTQ A;  5DPF E;  4ZW5 A;  3EBG A;  8TLI A;  5K7T A;  2TLX A;  1THL A;  3FUL A;  3NQY B;  1FJ3 A;  1Y3G E;  4R5V A;  3Q44 A;  5JXN E;  3P7P E;  1HS6 A;  2XPY A;  1LNB E;  4ZW6 A;  3MSA A;  3SSB A;  1FJQ A;  2HPO A;  1U4G A;  3FH5 A;  3QJX A;  4QME A;  5FSJ A;  4PVB A;  3FUD A;  3T2I E;  3CHR A;  2TLI A;  3T2H E;  3FU0 A;  3NN7 A;  4N66 E;  4OI5 E;  3B2X A;  1LNE E;  4D9W A;  3B7U X;  4DPR A;  1OS0 A;  3MS3 A;  7TLN A;  1H19 A;  3FTU A;  3CHQ A;  5JSS E;  1NPC A;  4XN8 A;  1PE7 A;  1KRO A;  3P7T E;  3FH7 A;  4TLI A;  5TLI A;  3T2J E;  3CHS A;  4B52 A;  7TLI A;  3B34 A;  1TLI A;  3FU3 A;  4XNA A;  3TMN E;  5JVI E;  3P7S E;  1KR6 A;  5TMN E;  3FCQ A;  2XQ0 A;  3EBH A;  4ZQT A;  3FUH A;  5L3U E;  1KJP A;  2WI0 A;  1Z9G E;  3B3B A;  3CHO A;  3DO1 A;  4QPE A;  4XMX A;  4ZX5 A;  1LNA E;  3P7U E;  3KED A;  3CIA A;  5A3Y A;  1KS7 A;  2A7G E;  3T8D A;  3P7W E;  4TMN E;  5FWQ A;  3B2P A;  4XND A;  1FJO A;  3FBO A;  1ESP A;  4H57 A;  4XO5 A;  1SQM A;  3FUN A;  4L2L A;  3FUM A;  3DO0 A;  4R5T A;  4MZN E;  4MWP E;  4ZX4 A;  3MSN A;  4K5N A;  3FH8 A;  3P7V E;  4MKT A;  4R5X A;  3N21 A;  1LML A;  1QF0 A;  2R59 A;  3EBI A;  4QIR A;  3FU5 A;  3T74 A;  3CHP A;  1FJV A;  3DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...