2XQ0A

Structure of yeast lta4 hydrolase in complex with bestatin
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
632
structure length
625
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHNKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLLAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords LEUKOTRIENE A-4 HYDROLASE
total genus 221
structure length 625
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xq0A03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xq0A02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xq0A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xq0A01
4ZX6A 3B34A 1Y3GE 3CHPA 5AB2A 1QF2A 1KS7A 1TLPE 2XPZA 3FUDA 3FGDA 1H19A 3T8HA 3NQYB 3CHSA 3FTSA 2R59A 3FUHA 1LNBE 3EBGA 3CIAA 3DO2A 1LNEE 4OI5E 4GAAA 5FXNA 3FH5A 3N21A 3B7UX 3FUEA 3P7PE 4Q4IA 5TLNA 3FUMA 3T8VA 3Q7JA 4KXAA 3FH8A 4NZ8A 3T8CA 4TNLA 2TLXA 3MDJA 3T87A 3P7VE 4MKTA 3FV4A 3EIMA 4XO3A 3T73A 1Z5HA 4PU2A 5TMNE 1Z9GE 4TLNA 1QF1A 3F2PA 4DPRA 4XN1A 3QH5A 3FTXA 4RVBA 4N4EE 1QF0A 5HQDA 4NAQA 4QUOA 4H57A 1TLXA 4FYSA 3U9WA 4KX7A 1LNFE 3FTYA 3QGOA 4KXCA 3CHQA 3CHRA 4QPEA 5FSPA 4KX9A 4K5OA 3FU6A 4ZQTA 2VJ8A 3FB0A 3DO1A 3P7SE 4XN7A 3DNZA 3FXPA 3FUJA 2WHZA 3NQZB 1FJVA 4XN8A 3T2HE 3T8DA 1Z1WA 3F28A 1ESPA 4R5XA 3FBOA 7TLNA 1NPCA 3FU3A 4QMEA 4K89A 3T8GA 4D91A 1OS0A 4ZX5A 3SSBA 1L3FE 4XMTA 3TMNE 5K7TA 2XQ0A 5LIFE 4ZX4A 1FJTA 5DLLA 4XMXA 1TRLA 1FJ3A 4OU3A 4K90A 1GW6A 1KR6A 3ZI6A 4FYQA 4HOMA 3B7SA 3CHOA 4MWPE 4M65A 4N66E 4X2UA 8TLNE 4ZW5A 2YD0A 3NQXA 3DBKA 1FJOA 3QJXA 4B52A 4TMNE 1ZDPE 1KJOA 3FXSA 4ZW8A 1FJWA 5LDSA 3SE6A 5A3YA 4XO4A 4FKHA 4R7LA 3MS3A 3FU5A 4WZ9A 1LNAE 4MXJE 4QHPA 1BQBA 5JS3E 2HPTA 4XNAA 3FU0A 3FTUA 3MSAA 3QH1A 1LNDE 4K5LA 4F5CA 5AB0A 4P8QA 2TMNE 3NN7A 5DPEE 4GERA 1KKKA 1HS6A 2GTQA 4RSYA 3T2IE 4XNDA 7TLIA 5FSSA 2DQ6A 5L3UE 1FJQA 5DPFE 3MSFA 2VQXA 4ZW7A 4KX8A 4PW4A 3FTWA 4FKEA 4XO5A 4D9WA 2TLIA 6TLIA 1THLA 2A7GE 3MSNA 3Q44A 4FYTA 3FUIA 4L2LA 5FWQA 2ZXGA 1KROA 3DO0A 3FVPA 4J3BA 4XN2A 4XMVA 5AENA 3FTVA 4QIRA 4KXDA 2HPOA 4JBSA 1KTOA 4MS6A 3T2JE 1PE8A 2DQMA 3FH7A 4XN5A 3TLIA 3PUUA 3LS7A 5FSJA 4OW3A 1GXWA 3Q43A 4XMUA 3B2PA 4XMWA 4XN9A 3FUNA 5TLIA 4FYRA 3FORA 3FTZA 1TMNE 1FJUA 5L41E 5JT9E 3FUKA 4XMZA 5K1VA 5JSSE 4Q4EA 3FULA 4PVBA 3FLFA 3P7RE 5DLHA 1PE7A 3T8FA 4K5PA 3FCQA 2XPYA 1PE5A 1HYTA 1LNCE 3P7WE 5CU5A 8TLIA 3QNFA 5LHDA 4N5PE 1TLIA 1EZMA 3P7TE 5L8PE 4K5NA 3EBHA 3P7UE 5JXNE 3B2XA 5LG6A 4XNBA 4KXBA 4TLIA 1KEIA 4ZX3A 4FKKA 1U4GA 5C97A 5LWDE 5DYFA 5J6SA 4XN4A 4ZW6A 1KL6A 3FHEA 3FUFA 3P7QE 3B3BA 4R5VA 3T74A 5JVIE 3B7RL 3EBIA 6TMNE 4MZNE 4Z7IA 1SQMA 2G4ZA 3B7TA 3B37A 4PJ6A 2WI0A 4R5TA 4ZW3A 5BPPA 4K5MA 1KJPA 4E36A 3KEDA 4MTWE
chains in the Genus database with same CATH superfamily
2WMNA 4MAUL 4BEPA 2FH6A 2JMRA 3IMWA 4HIIA 1UVQB 4PRIB 1U2VG 1RLWA 5DZOA 5F96L 5IJDC 1O0VA 2A6KB 2FGWL 4XVJL 3TG4A 3DX7B 3NJVA 3WFHB 5K9QG 5FYKD 1QWNA 3CZKA 3JWDL 1IHGA 2BHFA 5I23A 3ZR5A 2DYSB 2W9EL 4UQBA 3MMEA 1TTCA 3GS0A 3OXGA 4GAGL 3MLZH 3RX5A 2PM7A 1ZJAA 2WQAA 1I8MA 2PYEB 4DN3H 1QVOA 2HJLB 4N90D 1ZD6A 2IAND 2AJAA 9PCYA 4BTAA 3KMDA 2E7LC 4OT1H 2X89A 3SBPA 4UQDA 5DA0B 4UANA 4UDTA 1W0VB 2X40A 3IAPA 2X6KA 1K6QL 3FU7A 4O1OA 3LKQB 5ICUA 2KHAA 2R29A 4ADJA 4XMXA 4M43H 1KCLA 2A4EA 2LXMA 4E85A 3FMGL 4M8QB 1C5BH 4JFFA 3H2PA 1IGJA 1U41A 2BXYA 2A4ZA 1LEIA 4FTVE 1J5OH 3VDCA 4OBRA 3SE6A 2JTDA 4PR5B 1XSKA 1BQLL 1T0OA 2WIMA 4XPHL 2DBJA 4KMTH 1BZ7B 4ZFZB 1UADC 1CICD 4WW2A 4O2EA 5I0ZA 1HESA 1ZVSB 2A74B 2X9ZA 3KPSE 4YHYB 2W5PA 3T65A 2ZZUT 1ZRUA 2BY1A 3MODL 4DGIL 3T2PA 3ARTA 2C0LA 3KYMB 2NDGA 1YMPA 4H7XA 1S7RB 1MI5A 5C2YA 2XGOA 4DP9X 4R97B 5C0EB 1U91A 4UIKH 4UI9C 3K2UH 4D9WA 1H3WM 1IKFL 2WLIB 3ZYIA 4A2FA 1P1VA 3C6LA 3O8XA 4AQ8A 4O51B 1KYOJ 2BRRH 4A38A 4DIXA 4F27A 2MCPH 3RWIA 1MF2L 1DUYB 2SEBB 2XQYK 4H44C 1M4KA 1WAAF 2HPOA 3VACA 2Y1ZA 2JB6A 4XMUA 1DVQA 2FHBA 3PWNB 3QHZH 3IS1X 1R5VB 2X09A 5HHNB 3A4FA 4S1RH 3BOVA 2ICEC 4KVOA 1G6RL 3NPSB 5SWZD 3US0A 4BINA 3AQZA 1HKLL 2V6HA 1OF2A 1S7UB 3KBEA 1WA1X 1CFBA 3GMPB 4PRHA 4KUZL 5FA3B 3T71A 1HX8A 3MYVA 1W0VA 4F3FB 1OAYL 2O5YH 2F8YA 2ZAGA 1BJMA 1HSAB 5HNHA 2PR4L 3PQYB 4ZSOE 3UMNA 2FEEL 5E6ID 3C6EA 5E9DB 1YN6B 3D48R 3JT2A 1YZZA 1WVZA 2ZUSA 5HI3D 4WI7A 5IHUL 2LAHA 4UI9K 5J13C 3P02A 4R4BB 1NCBH 5JTWA 2WLZA 2CBPA 1GS7A 1YMHA 4GINA 4OJAA 3TBYA 1GJIA 1BZ7A 3MVSA 3NH7L 4JY5L 3NPSC 5KYXB 2LLNA 4PJDA 4PWIA 4HPOL 4QR7A 1CI5A 2DJ4A 3VTXA 1UB6B 1AOHA 3HE7B 4ZODA 1RK7A 2DL2A 5I8CB 3HI6H 4HC1A 3FRPA 4RQIA 3RC8A 4OB5L 5DURB 2VR7A 3RLSA 4GP8B 3TN0B 1UJ3C 3BAKA 4HUVA 1EEUA 4HIHA 4L8DA 4Q97A 3PNRB 4N6QA 3ZDZB 1DQLL 4GG8B 1Y6NR 5DR5L 5TMNE 3KR3L 5F7HA 4NEHB 2QADD 5JYMA 2O1AA 3A67H 4U07A 4BCYA 3TGXA 2DDQL 1H5BB 6FABH 1H6EA 1LWHA 4W4NA 4TXQA 2B4CC 1AI1H 2J4WL 3P0VL 4UMSA 4AEFA 4CU8A 3I02B 3LZQA 4P59H 2KBGA 1SJHA 3GSRA 3IJ8A 3G08A 3LEVL 5IVXB 2P8MB 4WRLA 3ZE2F 3QH3B 1MG3C 3CHXA 3EH4B 4RRPG 3BUQA 3Q47B 1LO3H 1U33A 1N8ZB 3NCJH 3OKDB 2NXPA 4XODA 2ADJA 3KPOB 5DMJB 3VYNA 1DANU 5IB1A 2R7EA 1JPSL 1T03H 1Z0MA 4RIRA 5CSBA 1M9SA 5F7UA 3TBYB 4FABL 4R6UA 1TNBA 1LGVA 1PYWB 1W72L 2JH2A 2NY7L 4HJIA 2EC8A 3MUZ1 5IUCA 1T5XB 4LDEB 4PJEE 4KZDH 2MKWA 3A4DA 4GSUA 1A4KA 2A9NH 3IPBA 3L9RA 2BUGA 3M8OH 5HDBF 3UTQB 1SA5A 2IO2C 1NSNH 3G6DH 2AVFA 2V8LA 3LKQA 2GRPB 4OCWL 5D7LA 5IM7A 4CVXA 5T3XE 1FN4A 1XSIA 5T3RA 3ZKXB 4ABNA 3MXVL 2P49B 2RACA 4DP8X 2FULA 1A4BA 4PTUA 2VUOA 5IG7B 4LGRB 5BVPH 1NOFA 4M7JH 4PJAE 3I75A 2J73A 3S6CA 1WAEA 3IJHB 2MYOA 3IFNH 5GS2H 2APFA 4NRZA 2FBNA 2D7TL 2IQ9L 4HA1A 4LGSB 1OE2A 3MRBA 2V2TA 1MI5D 5BQDA 2Z93A 4LLQB 2JJSC 1T4KB 3MOAL 5K9KB 1AXIB 1PIFA 4OCLC 2N56A 1ADWA 3TOPA 2YKLL 3ARYA 3DSFH 3D9IA 4B5ZA 1X7QB 5IBTH 2IBGA 1NA3A 2VERN 4I1OB 1UACH 3O3BB 3QHTC 2BC4A 3OR6B 5DUBA 1KT1A 3MU3A 2VDQL 1KL6A 4IRZA 1S0PA 4QI3A 4UILL 3IBOA 1QPXA 2OKMA 4XMKH 4X6CE 1ZK9A 1ZA6A 4IOIA 3TXNA 4XPGL 5ESAB 3DO4A 3VI4A 2EUWA 3TWVA 3ZKXC 2NZIA 1QW9A 1M05B 2JKTM 5ICYB 4NKIL 5J7CC 1MCPL 3QWNA 1D5BB 2BOBB 2VTFA 3SO3C 1EQWA 3LVQE 5FXNA 5MHSD 2A77L 1N4PA 1ZANH 2I25N 4NXSA 4BWWA 4PJ9D 1WIUA 4Q94A 2HZHA 4PRPE 4XI5C 4EPSA 4PJ7B 3SPCA 4NQXB 4C55A 3FQXA 1PNCA 5DRWB 4X4YA 2QQLL 2J25A 1VSCA 3U30B 2HFFA 3QGOA 3I2CH 4BWRA 1MRFL 3MLVH 3HZVA 4XNMB 4J3WA 5IT2H 1Y07A 1RY7B 3GLZA 4IOFD 4PJDF 2DQIH 1R6VA 4YDMA 3HC2A 5AKSA 4MZIA 1JUQA 3BGMB 4PJ7F 2Y6SC 1NGXA 1LVEA 4YBHA 1Z9LA 2GBVA 3Q49B 1QSVA 4KH2A 2OW7A 4Q9RH 3F7VB 4TUOB 5KN5A 3FY4A 1AO7E 2WOYA 5D4IA 3VA6A 4AKPA 4DGWC 3OR6A 4ADGA 1JF5A 1Q0XL 2BNQE 3PAVA 4XCNB 3ZKMD 3CFEB 2XWXA 1F3DH 3CX2A 2A38A 2LTQC 4DO4A 3ZMRA 4J4PA 4GXUM 3QUYD 2K78A 3C5SB 3V4VH 3FT2B 4YDIL 1URIA 2XIDA 1UC6A 1M9WA 3L4VA 1Z3RA 4HQQL 4JQIA 5BV7L 3C98A 3SYPA 5DJ2A 1Y0LB 4B9PA 4HKJA 5LBSL 3G5XA 3IDYB 1NCHA 1G1OA 4MD0B 1E9OA 3O0RH 4GRLB 3MSNA 1Y1DA 2EIJB 2W65A 4OCNC 3QUZA 3WDHA 5KYNA 2GROB 3KCPA 3GI8H 1O6SB 2W80C 4JRXE 4MAUH 5F7FA 1AG0A 4LBEB 3B3IA 4NERA 2X1XR 3FQXB 5F3BA 3FFOA 4XN9A 1X5BA 3BD3A 1C12B 4ZD3L 2YPKA 3EO9L 3N43F 3V0JA 4KKRA 2EH8L 1IBGL 2HAZA 2WNXA 3FF7A 4M7ZB 5HHOA 5C0GA 2L0IA 3SQOH 3WFDL 5BUAA 2VSYA 3QI9B 1PE5A 1U30A 2W9EH 2X6JA 4Z7VB 2R0WL 1NMAL 1RJYA 1UZ8A 3P7TE 1LD9A 1A2YB 3WUZA 4Y5YA 4OZHA 1YNKH 4OZHF 5AQ9A 4UM8A 3AMKA 3B2UD 3QFJA 3GMQB 3QFJD 1CO1A 5JW3L 43CAB 2MOGA 5B7MA 5ICZA 3P4LA 1ZT1B 1IARB 2Y7QB 3G2TA 3MREB 1ZHNB 4PJ6A 2XV3A 1TQVA 3ETBF 3VFMA 4RGMC 3H0TA 1UXMA 32C2B 3CG8A 4M43L 4QRPB 1RQ5A 2H1PL 4TVPE 3W56A 4CKQA 3X3GL 4NS0A 2WLMA 2ZG3A 4Q9QL 5HYEA 4TUJA 2W1NA 3WG7E 1T4KA 3FB8B 3STZB 5CSZA 4AR8A 3Q7JA 1HCVA 2HLAB 3CFNA 3UIOC 4JN1H 5FCSH 3FTGB 4XXCC 3TYGL 3FV4A 4HDIA 3Q2CA 3O81A 4YDVB 1AD9A 4GQ9H 4H8QA 3DO7A 2WYIA 3MOBH 3Q9PA 2WN3A 5DMYA 1ZB1A 3GM0A 3PABA 4K23H 3VFPA 1Z9NA 3ZE1F 3QFDA 2YKKA 4LCWE 5DD1L 1ES0B 1ZGLP 1MF2H 2WTOA 3SCMA 3F28A 2BDNH 1B2YA 4TS6A 2BNRB 1IGMH 3QJVB 3PWUA 3AS8A 4HWEH 3DX3A 4U0SA 2A6IA 3QHZL 4A7GA 1LNUA 2FT8A 4JM2C 4YHZL 4S1RL 3IU4L 4M3KB 4QJ3B 2P8PA 5DRNB 1JCVA 4GTMA 1FYTE 2F2HA 3GSQB 3HBQA 2UUDK 1HQ4B 1NICA 1FVCA 5KSAD 4APOA 3UBXB 3U1SL 4B97A 2ITCA 3WNMA 5IW6A 3FOMB 4G8GD 3PYCA 1NGZB 3NAAL 4XAKD 5ADPH 4OCRL 4XP4H 4WK0B 3E3QE 4YR6B 3W11C 4A7QA 4KMQA 2CRYA 4U6VH 1BW8A 3GK8H 3SE8L 3MZTA 1RKRA 4NKMB 4L8CA 3KYNB 4BEIA 3T2QA 1OEZW 2G3ZA 5ARFA 1AANA 4NQDA 4JFDE 4W4OA 1MSPA 4B8AA 5CEAA 3DSTA 1QX1A 4G59C 2BVTA 3EH5B 4J3BA 1IAIL 4LOVA 2Z1KA 2CBQA 3DX4A 5F72S 5KYWA 1EAQA 2Q20A 4F7KA 1DBBH 3WXWH 5LGJA 3VXMD 1U8QB 2JCXA 3VI4F 4HJGA 4FQXC 1NANI 4QRTB 3T6WA 5GS1A 4ZDHA 3UT4A 5DMKA 2JQMA 5JHLH 4U6XB 1A7RH 2OK0H 5GHWH 3HN8A 3NZ8B 1KY7A 1GY1A 3EG9A 2BNRA 4RCVA 3KNBA 2VXTH 1AXSA 1FNHA 4MD0A 5D93C 2EKSA 1CUOA 1M3IA 2UWEF 5AAPA 1G7LA 2EO7A 2IEJA 3QQ3A 3RB7A 4UWLA 4MJIA 1JE6A 4DEUA 2VSNA 3C87A 4F6RD 2Y1VA 1UWGH 2X6CA 3IFOB 3ECWA 3JWNC 1TEGA 2E0PA 2C3XA 1JCSA 1BJ1H 2IH3A 3BVNA 3REWA 3T3PB 1A9EA 1K72A 2XS1A 2NYJA 1LO3L 4NM4L 3MKGA 5JUEH 2X4TA 1UB5A 3KVQA 1P9MA 2FT6A 1ZS8A 4HEME 2OEVA 4CN4A 5IESL 4GMJA 3I50L 3MV7A 3DBXA 4RFOH 3RL2A 5L4MA 1BD2D 5CEZE 1IAKB 5CILL 3L9TA 2ZD0A 4WO4A 4R7NB 2NTFB 1AHMA 1NGYA 1X5AA 5I1GL 2EABA 3KPNB 4AL8H 2CJ3A 4EXKA 5E99H 3T2LA 1KCBA 3ESVF 3MLTB 2ZAIA 1E0OB 3K7UA 4TVPD 5D7SL 5F9JA 3OX8B 3JXIA 1SPDA 1OAKH 5HHOE 5CCKL 4LERA 1E67A 4HJGB 5F88A 5ID0B 1A4JB 1DUYA 2SEBA 4PGDB 4ZDHB 1V54B 4CC1A 4MAZA 4TSAL 1QHOA 1HCZA 3OJMB 3HBPA 4PJIB 3G5YB 3NQZB 1ACYH 4WUUD 3MV7D 1OW0A 3NZ8A 4NUJA 4X83A 4I43A 5D7KE 4JO1H 1WISA 3SBWA 3SYQA 2VMEA 1MNUL 3MGAA 2O61A 4B9CA 5EUOF 1JXGA 4FQQA 1OCCE 4NIKB 5GS0H 1XEUA 2XV2A 2FX8H 2NXZD 3CCHB 3G5VB 3D30A 1ITCA 5DJ8A 4HK0B 2R1WA 3CN4A 4Y2LA 2VXSH 3HZKA 1N0RA 3V6OE 1OTUD 4ANXA 1K9TA 3EJNA 2P5EB 1NINA 4OLXL 5KOMC 4AQAA 3HE6B 2MH4A 1KBBA 4N0FB 1NCGA 1K4DA 2B9BA 3BKCL 1FAKT 1CXFA 2XWBA 3DSFL 3W2DH 3IHVA 1XD1A 2X38A 1AC0A 4RQQB 4WHCA 3TEZA 4KVNH 2GJ6D 3TURA 2NW3B 1HX0A 4FJ6A 5DK2B 1VFBA 3ISRA 3D06A 5FGBA 2A6IB 1R0LA 2XRAH 4L2LA 4LRZA 3ASNE 1WTLA 2YN3A 5HHVL 3C5JB 2NY5H 3RX9A 3WIIL 1U3YA 1XCTB 2E6QA 3VXME 4HC1H 3HXEA 2IH9A 2XA8L 2A77H 1O9VA 1D7DA 2J20A 4Y7MA 3TZVB 1S9YA 1GGIL 5JSSE 3DECA 3FLFA 4BT9A 2V17L 3QR0A 1PE7A 4MDIA 5DFVC 4APQA 5C8JB 3ARBA 4XVOA 1IM3B 1QR1B 4URKA 5AVZB 1JVKA 2VLRE 4G25A 1AP2A 4Y1TA 5TPWH 2VLLB 2LU4A 3PWVA 1QKZH 2ERJC 3CSPA 1GGUA 4J1UA 3CKCA 2XZTG 4J8RB 1MRFH 5IT2L 2FATH 2QJDA 1USQA 2HE0A 4EECA 4EKXA 4LHUD 2DQIL 3T3MB 1Z3YA 3SNXA 2NY3D 1HZHL 5HGHB 2FUTA 3QO1A 2H0PA 3TA3A 3WY1A 1DDHA 5ENTD 2PKDA 3FFCE 1TJGL 4KI5D 5AKTA 2WSPA 1IC1A 4JGMA 3PUCA 1NMCB 4KV5F 2IALB 5J90A 2JQAA 1SXCA 3HCVB 3FGDA 3ETBJ 2H8PA 3DJSA 5DURD 5BUZA 3OAYH 1RJZA 4XXWC 4MVBD 1BSIA 3EHBD 3HG0D 1HWWA 1EX0A 1RJCA 3LNHA 5J12C 3T8KA 5I71C 3IKCA 3BRFA 1RFDH 1JNLL 3KBHE 3WXVH 4F57L 2D3LA 4NNPH 1MCIA 4POUB 5ITFA 2NW2A 3UKRG 3W11D 1NBQA 1I7ZA 2GHZA 4X0NA 5B3SE 2WY3B 5FK9A 1CGUA 1TPXC 3I6SA 1Z1WA 2DLHA 1DVFA 3P30H 2X4RA 2RJMA 1LO5A 3ABME 2B4CL 2VZTA 1MPAL 3OTTA 3Q1EA 1NDMA 1OQXA 4GRWB 5FYKE 1QR1A 1TF4A 5KG9A 1T1ZA 3RKDD 3NBNA 2EE0A 3Q3GB 3WS3A 3MCLH 3EJYD 3NN8A 1A6WL 3W39B 4U1KB 3KPNA 3N2JA 4TNVK 1N59A 2IJGX 2OQJB 2YINA 4M4RA 2DD8L 4X6EA 4PJ8A 1NL4A 1RCYA 4UMGA 3V8OA 4DW2H 3QO1B 3GRGA 3HPJB 3BO8B 3CFTA 3V4PH 2K3HA 3L8QA 4FQCH 5DYOB 3CV5A 1DNPA 2BLFA 4KY1H 5IHZB 5D1QE 5FCUL 5D8JL 4KP7A 3IRZA 3W38A 3BEVB 2FWSA 3V0IA 5JW3H 4QRRA 4G8LA 1B4TA 1PC2A 2YA2A 5H35B 1GOHA 4U7KA 2FO8A 1BG9A 3TV3L 4ZW7A 1LD8A 5D1XE 3VXNB 1MW3A 5IEHB 5FLUA 4YSRA 2A3TA 3QAZC 1F4YL 3HN3A 3WS6C 3HXFA 4H25B 5K39B 3L48A 3L9EA 1MVFA 1WBZB 2EDYA 1NA8A 2XWZA 4OVUA 3Q2VA 4P2OC 4X5WA 1AKJD 4AW4A 4MNQB 3FS9A 3WFBH 3QIWB 4TXRA 4R83A 3X3GH 3W37A 4RGNB 3S8FB 4J8YA 4Z3HA 1OT2A 3FFLA 1WCBA 3D85B 2WLHA 3ARFC 1XD0A 2QBWA 4ZTOH 1RD6A 2APWA 4C0EA 1OSZA 1MW1A 2H6GA 5CJBA 4JFQB 5EO0A 3TVMB 3WJLA 4JJHA 1ODAA 4MJ4A 4NQXA 2ZKHH 3TYGH 1JTOA 3MX0B 3MMEB 1EFQA 4A67A 3I9GH 3TWTA 1FZJB 4TUUA 2Y22A 4XVSL 1RP8A 5DJYA 4JK0D 2JLBA 1KYUA 3BEWB 2I9CA 4JHJA 2YPLE 2ATKA 3SDAD 5ITBH 3CU7A 4J4PD 4ODVL 4FXLA 3MBXH 4X6DE 5B7EA 2DYRE 2GJZA 2EC9T 1CFMA 2NY6B 1RAMA 3NEOA 4FA7B 3LJ3A 5C3TA 5TFSL 5B38B 3G04B 2NX5A 3WHXB 4HIJA 5EULV 1P4BH 1AXTL 2Q3ZA 4YDYA 2Y36L 2WXRA 1SW6A 2WCGA 3AT9A 2NTSP 4IBLT 4RGND 3S4SA 2W94A 4OF8A 5KBPA 4B89A 2ICWJ 3A14A 2EIZB 2Q3XA 2EIDA 4LVHB 4UI2A 3FUMA 4Y1AA 4TQPA 1ZVSA 1OK8A 5J6HA 3L1GA 1NCWH 2H47C 3RGVB 3NFSH 1Z5HA 5FIOA 3D50A 2K9FB 1IYGA 2QDVA 3SE8H 5F6IC 1NBZA 4ODSH 5CKGA 3MAWA 2W65B 4KRLB 3V4UL 2PYFA 3VXQB 4H0GA 5AD0A 5SWZA 5KJKA 4PJXE 4HIEB 5JR1L 1XGPA 4I1NB 5D5MB 3Q8BA 3IDIB 2D7QA 5DLMH 4N0RA 2IAMD 2L6JA 2CMRL 2OMTA 3O9WB 3ZKMC 1TQUA 5A6LA 1A0QL 1OIOA 4TLTA 1F8TL 2XCBA 4YMPA 5BMFL 5FUOH 1DBBL 2EDNA 4HOWA 1FZOB 3WXWL 4PPTA 3EJUA 1JCRA 2PP7A 3TWCL 2C9XA 2XCCA 4K90A 3QWRD 2X89D 4ZS6C 4FQPA 1IEBB 4JZOA 1MVYA 3UYPB 5DDHB 2H3KA 4PGBB 3TBTB 3QXUA 1XR9B 1BPOA 3H7LA 3L08A 1UENA 4MXJE 1CDCA 2C9QA 5CBOA 2Y7SA 1SOSA 2XOTA 2V9TA 3MV9B 1FIEA 5JOPD 5D7IA 4K3JH 5C07A 5BNXD 3PP4L 4GFTB 2X7LB 3TO2A 2X4RB 3U9PH 4L3FA 1RLBA 2MAPA 4ELKA 1NCOA 4J7RA 2BIOA 4BSWB 3LS8A 3BESR 4MQTB 1T0PB 2FJUB 2F5AL 4BFFA 4FYTA 4S10A 4UBDD 1LEGA 1GAFL 3VXMB 3PGFL 1EHAA 2JD1A 4M48H 1EXUB 2HH0H 4KXDA 4NM4H 1TCRA 4RGMB 2MIZA 3L4YA 1R3JB 1EMTH 4ALAC 2HT2D 2P45B 2WK2A 1J9QA 3HI5L 4XC3H 3STLB 1TJMA 3OG6B 4GAJL 5LNGA 1D9KC 4ZAKC 5ALCH 5EU5B 3RIAK 3X1BA 2CDEB 4EBQH 1PMYA 3QDAA 1K3ZD 1R5IA 3FULA 4EI0A 3FCSB 2BS71 5FGCE 1MWAB 3FB5B 2PPDA 3HW7A 4KUCF 4HWBA 5HHPA 2F1AA 1BFOA 1T7WA 3SFXA 3FQTB 3P54A 1CI3M 5CZKA 5G4NA 4AM0A 5KAQF 2UZYB 3S88H 1WV7T 1N8OE 3O6ML 4F15B 1ETZA 4NZFA 3ATFA 4YZFE 5LG1A 5K1NA 4L1BA 2DI7A 1OHZA 1ACYL 4WHTA 5L6YH 5DD5H 1U92A 4KBQA 1NCAH 3V5DA 3T9WA 4RFNC 3QZWB 4ODXA 1B90A 4X7TA 3BWZA 3DSUA 4P2AA 1AMYA 1R3KA 2HT3C 5GS0L 2TRYA 1EJ6A 2PZIA 2ITCB 3TYFB 5IHBA 3R9AB 3RVWC 5JLZB 2YAPA 1G5GA 4IRUA 4G23A 2IAAC 3OGCB 4OLXH 1OB1B 4C59B 2DQTL 3HE6C 1LO2L 3IYLW 5C0BD 1IQUA 3BKCH 5EBMA 4R7VA 1TNYA 3BE1L 4KROC 1JK9A 1SLXA 1HFAA 1MFUA 2IV9A 1OAZL 3H9SA 3F6QA 2XX1A 1TCRB 3EYFB 4KVNL 5AYUL 4FP7A 3K2KA 2DYSE 1OAJA 3ZYMA 1SZAA 3D3MA 2EH7L 2J8HA 3UTQA 5I1JH 3ILQD 1XF4B 1BVNT 2ZYRA 2EECA 2J8UA 3CHRA 4QOKD 3VI3E 5KEZA 1J9TA 2CO3A 2CA3A 3B9EA 1T7VA 2QQKH 1S7VA 3FB0A 2HXAA 4M1GH 2CG3A 4AVJA 5HP5A 4E9XA 1U4FA 3JUYA 4OF7A 2O30A 2GVYA 4FI7A 5LCVA 4WWID 3O6FC 1BFOB 2NY5L 2XIBA 1T6BX 2AVGA 2YD6A 3H85A 1ZK5A 1PZAA 3HNVL 3HUJB 4LK4A 2P4AB 4X98A 3SJVD 1ESOA 3VXSD 4CDRA 2XACC 5FM5M 1NJ9A 4OF0A 2XA8H 3MRLA 4QF1A 2R02A 5E9DE 5KSAB 4RX4A 1X9LA 5GGSA 4M65A 3QIBA 1BJ1J 4NQDE 3VLDA 2P9SG 1E5AA 1KLUA 2UY7B 2V17H 2WPVA 4R90L 4H20L 3RGHA 3A06A 2HN7A 4F7TB 5K59E 1FNSH 3Q13A 1SVZA 4R7LA 1BZ9A 4NENB 4FP8H 2V5FA 4YXKH 2ZSVA 1L9RA 3C5ZB 2GEQA 3FTUA 4WCYH 5IGXL 2NQDA 3MXWL 1A02N 3GSXA 5CRUA 3ESMA 4EDXB 4M6OL 5C0AB 4D94A 2X6UA 3KPRB 4ONHA 5ECGA 2Y7OA 3FO0H 4OUUB 3FO1B 3MRJA 4P5MA 4P2RA 4LBAA 3N5AA 2BCKB 4TQEH 3KDMB 5L7XL 3V79C 1A8JH 3KZ8A 4P3CH 4DKFH 1TJGH 2UY1B 1A5FH 2D7MA 4GZ5A 3MI6A 5DEFB 5MENE 4G8IA 3RDTD 1Z32X 3CN3A 5HYQA 4MAYB 5AW3B 1OF0A 3ZDZE 5L8LB 3CSBA 1ZGLM 4PRNB 1HHGB 3S7FA 3CC5A 5BO0D 1DVFD 2OR9L 4WJ5B 4ZXBD 5FGRA 4U3SB 4NCDA 3DSWA 3RZCC 1ROWA 4QKTA 1VESA 2J8UB 5EIVA 3MRNB 4PCSA 2J3SA 5C07B 2B8OT 5JORA 3ZDYB 3ABLE 4PP1D 5BJTA 1YVLA 1RFDL 1S5HA 2NC9A 5LLIC 4GTQA 1GMIA 2QT6A 1EA9C 2ZOTA 4AEHH 1N3NB 5C09B 4O60A 4HD5A 1T22B 3FU9A 2WWMC 3MACL 3ARZA 1A4JA 3D3VE 3PJLA 3AXIA 3LNFA 5I6XB 4U31A 1NCDH 2DQCL 3KPRD 2XBZA 1L7TL 3CFDB 1MFAH 2G75B 1EO8H 3F7YA 3FPXA 2QPSA 3EO1B 4TSBH 4Y19B 2R1XA 3DTXB 3WNOA 1GR7A 1QBML 5D1ZD 1RHHA 3MRGA 4NIKA 5E9DA 1A66A 5A6MA 1U6AH 1CFSA 2G2RB 4PREB 4K5MA 4B60A 4ODUB 2BSTA 4KZCA 5E76A 4JFPB 5CCJA 1KTRL 4PRIE 1XNFA 3FSAA 2NNAB 4CGVA 4OZIA 2A6KA 3W9FA 1IM9A 1SHMA 3VXSB 1H19A 1MNNA 2BCKA 3EDEA 3UJIH 4KKQA 4PB9H 1W8OA 2VJXA 3RUGE 3QCTL 2MCMA 4GI9A 4RQQA 3PDOA 1EUTA 3BPCA 3TNMB 3VU2A 1U3ZA 3UQ3A 1MFNA 4IIQA 4PU2A 1FFTB 5D4HA 3WFCL 1RZ8B 5CBEA 1MVUA 1JPFB 2N3JA 1K5NB 4APQD 5E95B 4JM2B 4LMQE 1WM5A 1NFAA 2ZX5A 2WXGA 1ASPA 1NKGA 3TCLB 1EF1C 1E9OB 2KZKA 4QPEA 3EADA 3KBFA 1JP5A 3LKOB 3ZXPA 1T1XA 1F1AA 3SHSA 3PV6B 5AEAA 3IXTB 3UGXA 4ZSOB 4N85A 1QASA 3EOAA 3BZEB 2CGRL 5SWSA 4Y6SA 2ZUQB 4IRJD 4JMNA 3ZSSA 4EBAG 4K7FA 3ML8A 3CXDL 3NZSA 4G6ML 3FQ1A 4PJXA 1E6JH 1MHCB 2PPFA 2RMNA 3GZKA 5HI4C 1VADB 1A1NB 1KIPA 1F45A 3ARGD 3QJXA 1N67A 2E8YA 1YA5A 4PYGA 5T1LA 4U1JB 3PWVB 4HALA 4FKHA 1FL3B 3J7HA 3ASHA 5FF6B 2A74A 4D0DB 4JAMB 2F18A 4QHLB 4UU9B 4XVTL 4CA4A 3PJSA 2AJYL 4KNTA 4AP2A 2WBJD 4H0HB 2OL3A 3NRQA 4ODUA 4MMXC 5CZXD 5C3IA 1KTDB 2FSDA 5HGHA 1HS6A 2X4NA 3UPAA 2MHKA 5CZVH 4TNEA 4O2CB 3L45A 1F3JB 5A2BA 4I1AA 3QA3A 1JMZA 1BBDH 4UQZA 5KW9H 1MKFA 2IEPA 2XICA 3EOBB 4KJWD 4AQ1C 5FOBB 4ENED 5E8PA 1BOGB 2XN9D 2Z91A 2ADGB 3FB8A 1E28A 5C0NC 2G0LA 2YPLB 3TCLA 1TZAA 1RZPA 1TMNE 1XVSA 4KOBA 4QGTA 1EZUA 2ZCLL 3P73A 4OZIE 1KGCD 1FNEA 2C9AA 4IN3B 2YD5A 2R69H 2FBJL 3EO0A 4L1TA 4ZMZA 5HYJD 1QWHA 4GG6F 1KOAA 1BAGA 3S34H 4OZFB 1DUZA 3V4UH 1GGCH 1N70A 3GMOA 5KVFH 1IGTA 4NO3A 4LVNC 5KCMA 3QULA 4HOSA 4C8XA 2P24B 2YQ8A 1MHCA 5FUZL 3SDXA 4CW1A 3R0IA 4QKXB 4R5VA 2EIKE 3ZXSA 1MRCH 4UNUA 1E5BA 1BVNP 2CMRH 2IJ0C 2PWEA 3VFTA 3WIHA 1J5IA 3QDMB 4GRLC 1BGXL 2X2UA 3B7TA 1A6PA 1KGJA 4UU9A 5JIKA 1JSYA 2X3CA 4RGOH 1NTDA 4AGQA 4NQCE 1KCSH 3ROLA 2PCPA 5ENNA 2DWDB 2Z3FA 1OW0C 3BQUD 2B59B 5AQ0A 5B1AE 3WKYA 3ZZ1A 3FOMA 3L5WB 5K33A 4OI5E 4H8WC 3U9UA 2AJXH 4LPYA 4YQXL 1J11A 5E9NA 1R46A 3TH3T 2C1PA 3K6FA 4ELMA 5IVZB 5LQBL 3QAZB 5FFOA 1XGQA 4FQHB 3PDGA 1MLCB 1JGEA 1QZ2A 3VXNA 3DTXA 1ROCA 3BWAB 2YMTA 1RSFA 4UNVA 2D03H 1DQQB 3QQ9D 4WEBH 2Z31B 2H2SD 1U21A 2M8XA 3P73B 2VDKH 4NGHL 4CZ2D 3T2HE 1FJVA 2HH0L 2XI9A 1IAIM 1IBHA 1WCBB 4QMEA 4YHML 4MMZA 2IF4A 1U93A 3ARWA 1XZ0B 3GMRB 4N87A 4R9HA 4IULA 2XWTB 5JMPA 5EIIA 1PF3A 3BCDA 1YPZA 2PO6D 2VO5A 3T77B 3KXFE 3EGSA 5DEJA 2ESVB 3MJ6A 4LNRB 3K6DA 3DBKA 4B52A 1I53A 5BXFB 1G84A 1ULVA 5LDSA 2I9LA 1B4JL 1PYWA 2YUZA 4IRJC 1QAWA 4C54A 4EE2A 4QHKI 4OCSL 3U1PA 2A9MH 3QH1A 1N6VA 1JZ4A 3CDZA 3UYOD 4ZMNA 5KSUA 4N68A 5MENB 2R29H 4Y6RA 5LOZA 3V7AG 5GS3A 2B59A 5IBUB 1AMXA 3FO2A 3MLWL 1T1YB 1QSZA 3Q5OA 1YN6A 4K7FB 4EZLA 1TXKA 4F7MB 3MLXH 1S78D 3H9SE 4WY7L 2EYSB 2F37A 2QLVB 1CK0L 4LRNH 1C16A 2EIZA 4GSRA 5JIMA 2VSOE 2OOEA 3LPPA 4HF5H 3LPGA 3QQNA 1EH9A 3IEAA 4LCTA 1KJ2B 4UWQB 2Q7YA 4G6FD 4F15C 4U63A 2EYRB 5F9JB 2P8LA 3RWGA 3QRGL 3QA3B 3C2AH 3W9DA 1L5GA 1WUNT 3VJ6B 1WS8A 1PD6A 4JFXA 3BN9C 4X9IA 4OKDA 4WW1B 2WLLB 4ZPTA 4XN4A 2VW7A 1DR9A 1XX9C 3UTPD 5AN8A 5LXGH 4NOFA 3IN0A 1L9QA 4KJQD 3K74B 3BSGA 4R0LA 5CSGA 5E4IA 2OTUB 4OJFL 4RRPA 1MFBH 2L7JA 2NY4D 3CDZB 4FMKA 4UQ2B 1J1XH 1DVUA 4YGAB 5TJWK 5T5FA 4DTGL 4EIGB 1NKRA 4PGBA 1NCUA 4EQFA 2NT0A 3S96A 2P9RA 4UV4L 4ACPA 5E7FA 5CS7A 5E23A 1AHWC 2XTJC 1CDHA 3ZTJH 4JHRA 2XNAB 3LY8A 1GC1C 3OHXC 3ZPJA 1D5ZB 3QEGL 4ANUA 1MG2C 4YXKL 3ZDXE 2ETBA 5B1JC 5B22A 2R0LH 4NQQA 1X5KA 2PO6B 3QRBA 1Z9OA 3ZFWA 3KGUA 4ODWA 3FO0L 5AOKA 3S5LA 4RVBA 5I17A 3P9MB 4NQCD 2X0UA 1VB9A 3KHQA 3WJMB 1LNFE 1OCCB 5L7XH 4DX2A 1L6ZA 2AXHA 4P3CL 4DKFL 3Q7FA 4Z9KB 1E96B 3IPEA 1BCIA 3MBEA 4P5RA 1R3JA 1NEPA 3DURA 3DX8B 3OWEA 1TZGH 5FR3A 2YQBA 1N6QH 1NGXB 1CIDA 3QUZD 1JXDA 2IFUA 4EHMA 1FJ3A 1PZCA 4NZUH 2MEJB 4ELMB 1BVOA 3BGFC 4WW1A 2EE3A 4E9RA 5C3LD 4TULL 1MCBA 4ZRGA 2WSDA 2WZ5A 3Q9QA 2DWEA 3BP6B 3OSKA 5EORL 3MACH 4WFEE 2OSLB 5HYSA 3QUYA 2BIHA 3E9UA 3EH3B 4OLZL 3OXLA 4ZQHA 1TNUA 3ISWA 4HU8A 2CWRA 4AEEA 4FD0A 4C57C 1XMEB 2UWJG 3HXDA 4U0QB 1E3FA 4F9PA 4OQTL 1U6AL 1EEZB 1YQVH 4Z8FL 3JUZA 3B6SB 1JZ8A 2GRQB 4Z0BH 3LYAA 4AMXA 1VHPA 5JHAA 1PU0A 4QT5B 4WEMB 1G9ML 1E5UI 2RH0A 4QXUL 1OB1A 4Y5YC 2CFZA 2EVIA 5D1QD 2VL4A 3P9MA 5EBWB 3RYMA 5FA4A 3LZOA 2G9KA 4Y9FA 3QUML 4PB9L 1C8PA 4PWHA 3BXNB 4QXTA 3IXAB 4I85A 1CXLA 2NUPA 5E2TH 5JW5B 4CDHA 2YXMA 1REIA 1ZWIB 5BS0A 1X81A 1OK0A 1JFHA 4WTZA 4XX1G 3WJJC 3VFOB 1TN6A 1JPTH 1IFGA 1WZ1L 1MX6A 4M3HA 3RRUA 5BV7B 5JHBA 4KNSA 4Y1AE 1I7TA 4O58H 3S36L 3OKKB 2F8XK 4W81A 1T1WA 2BIIA 2L0DA 3VFWA 2N59A 3P4MB 2CJTA 1CGSH 5IHWA 3VFMB 3QEUB 1RIHL 3B5GA 25C8L 1ELKA 3OZ9H 1MFEL 4E41B 1I7UA 1FBIL 2GAZB 4MS8D 3QEQD 4NN5C 3DUSA 3UDWC 1Z2KA 5AYTA 3NRPA 1FYTD 3ZVVA 4V2BA 5GISL 4J3OG 1S3KH 2WXOA 5IB3B 5JMOC 2ZOUA 3F7VA 1IEHA 3RP1A 1KJMA 2DWSA 4JHAL 3DVGB 2J8OA 4X8JB 5BW7C 4BZ2L 2WLKA 2JNZA 5FO8B 3V4VA 4JFXB 4FFWD 3OXRA 4LP4A 3LX9A 3CFEA 4BXSV 3W0WD 5CZVL 4V3IA 1G7IB 4OGXH 4OD2A 1QMUA 4I1RA 1TU2A 3BN9D 4ORGB 5D7IF 5EZLA 1YPZE 2EJ1A 3CHQA 4H2CA 4J3UA 2HMIC 1H8LA 5ISZB 1QA9A 2EDMA 5D1QA 4CMHB 1MHEB 3SJVB 3L3JA 3C8HA 3X14A 1OS0A 3BH8A 4XP6L 3RVUC 3K91A 4Y9GA 5GSVB 2HUHA 4MDRA 2NY5C 1HQ4A 4WNDA 2EDEA 3LXUX 4FF9A 1KT2B 4QCIA 3B7YA 5C0CD 5F3BB 1KB5L 3DHJA 3STBA 3DSNB 3GEWB 3NIFF 2P3YA 4LPTA 2R23A 4J3XA 1GGCL 5KVFL 2Z31C 1J8HE 3ZHKA 1TYRA 4Y19A 1ZE3C 2XIIA 1QSFD 1KKKA 3KYNA 1TJCA 4OCYH 5CEZL 2V7HA 5FUZH 4G7QB 4XZUB 1CD1A 7TLIA 1RHHB 3MRGB 3L2LA 3T8XB 3R0NA 5IB3A 3ANNA 2DIAA 4GSXA 3DSSA 3C72A 1CFSB 1E27A 3HXBA 4KRMB 2ZXWB 3V52L 4AL8C 2VXQH 1FFNB 4OYSA 1BZOA 5FYJL 3VGFA 2W95A 3PDNA 5DEZA 3MRDB 1WS7A 3AAZB 4AK2A 1A7PH 1Z5LB 2LU7A 4LCIL 4U7SA 5H2BA 4ABWA 1MFCL 3FUNA 3L13A 3NEEA 2XVBA 1H0DA 2QGBA 5D7JB 1AZCA 4MASA 5F21B 4WV1B 5J6HB 1BVLB 5CBEB 4JNDA 5LQBH 1H6KA 4NQCA 3VLFA 2DF3A 3GD1C 4O1PA 1DHKA 4L8SC 3C08H 3SKOB 1INEH 1EHKB 2Z6FA 2ERJB 3CVYA 4RISL 1IT9H 5IR1B 3U0WH 5B1CA 3CZFB 2OEWA 3BDYH 4FFVC 1IBZA 4XEIG 4LEOB 4H8VA 4PJHF 5I5RA 4WEBL 1LE5A 1EJ8A 4I0PA 1RUKL 3GS4A 3WYRA 1I9JL 1K8DB 2ZOLB 4DPCX 2OSYA 4XOCA 1N64L 5SWSB 1JZ7A 1FVDA 1JGIA 2R2HA 4X9YA 5B3NA 3EYSH 4KTYA 4CVZA 2ZXBA 3EYVB 2EYTA 3O2VL 5ESVA 4R8WL 5CLZA 2F8OA 1BHGA 4MTWE 2FWLB 4FOMA 2YSSB 5D1QC 2CU9A 5I82A 5BS0E 4U1JA 5LCVL 3UYPA 2V7HB 1NQBA 2VAAA 2VDPB 1DL7L 2R4RL 4BSZB 2JSFA 2NZ9C 4FFYH 2BJMH 1B4JH 2OMZA 5FPIA 2ZX9A 4HJ1A 2PWHA 4LSQH 3NG5A 1JI1A 3MV9A 3SYCA 4FFZL 1B0RB 1SOXA 5FZSA 3DV4A 3MLTA 3T4YA 4EN3B 3FQ2A 3GBNH 1KELL 1NGPL 1GPOL 3AMLA 1IGYA 3DJTA 3H7BA 3KBPA 3KW8A 1U4EA 1JZEA 3SZ7A 3QG7H 3NSXA 4GUCA 4JRXB 4JY6A 4Y2OB 1GTFA 2WWKO 5F88B 1YEKL 4TKWA 1D6VH 1S7RA 5EU6E 3R0MA 4FQXD 4RLYA 4JL0A 2A6DB 4ZOEA 5BNWA 5E2JA 3OWRA 1HT6A 2VXQA 5ABDE 3BUYA 5JO0A 2FZ3A 2R15A 2EAEA 4XH2A 2YD4A 3FT9A 5IR1A 1P0SE 1W0YT 1R3HA 2XY1A 1KZQA 1G1KA 3IDMB 5C08B 4XX5A 3B5TA 2EIBA 5F9DC 4A2GA 1UKTA 4GQPH 4MWPE 1OCZE 1S9XA 2CUMA 4ZUVA 1ED3A 3MLRL 2C34A 3OJ2C 4WHDA 4JRXD 3F7LA 4F3FA 1QFWM 1UFUA 5KSVB 2P58C 1CICA 1DEEA 4TVSa 5F96H 4BK8A 5D1QB 4JEUA 1XWVA 1ZLUH 5DHXB 1U92B 3GYZA 3JWDH 3FRPG 1PAZA 4QTHA 1THLA 3VGHA 1OZTG 1R3KB 4HWUA 3WO4B 1KENH 3G5WA 3UPRB 3IJ9A 3D2UD 4QCIB 1ZPUA 3U9UB 1E43A 3V6OC 3CK7A 5E94A 1Q4NX 1E4XH 1U8OB 2ZXQA 2IOSA 1D5XA 4ZTPH 3NQIA 1YEFL 4IRSA 3D3VB 3VD7A 3GHBL 1PZSA 1K6QH 2BWIA 1JGEB 2WHVA 2HFGH 4L8DB 3R1GH 3SQRA 1KWGA 5EC2B 1RJLB 1TO5A 3E2HB 2NCMA 3F85A 4FQJL 3ZKNC 4ZUWA 1AQMA 3FMGH 2Z9TA 2JQZA 4FXGC 4FN0A 2FQGA 3MUHL 1E5YA 2MPAH 3NACH 4CC0A 4J3SA 1CDYA 2VXUH 4HUXA 4XWGL 4LKCB 1J5OL 2BNQB 4AYEC 5EA0L 4MB5A 4XPHH 4ZUVB 1AGFB 1DDHB 2E9BA 1AS6A 5E1HB 2VGYA 3WNLA 4PRPD 2P8MA 2WAHA 3ARFD 3FN3A 1CFTB 3KEZA 4A2HA 3Q2LA 2H4EA 5B8CB 4NQUA 2BVUA 2YQ3A 4TTDC 1BVLA 4XBMA 4ZFOL 5BXFA 3FC8A 3A4AA 3CMGA 5AB2A 4UIKL 4NQCB 4WUKL 4LCWD 5AUMB 3BH9B 3ZHEB 4ZPVB 4ABVA 1LNBE 3RJQB 2JK5A 3OAZK 4E0RB 4D8PB 3B7UX 3V0FA 1I9RH 1WPCA 5KNHD 1M71A 5GRVK 5D9SA 1UEMA 2HRLA 4WFGE 3UFIA 3MGTA 4NWUH 3R9MA 2C3GA 5AW8B 4JE4B 3DXAE 2VDPH 3LB6C 3L9RB 4RZKA 5DF0A 2EE6A 3EF4A 4KX9A 3QUZC 3VXOA 1TQSA 2K6ZA 4KUZH 5DEFA 2VN6A 3Q05A 2NW3A 3MTRA 4E9YA 3BKYL 4MAYA 4NN6C 1GCYA 4FHKA 3NBNB 3WKPA 4YS4A 5KG9B 5AZUA 5HQ8A 4WJ5A 1RIUL 3VE0B 1A6UL 1YEIH 2W9DH 2AHIA 2OMZB 3ESOA 1KULA 5B38G 2VC2H 5IHHA 5CCGE 3P40A 1NCBL 3KAEA 2M83A 1IGIH 3IFLH 4AUYA 1LMKA 4JHZA 2NXYB 3DXAA 1QO3A 3TT1L 4BH7A 2CDGA 4MX7B 5L2JA 2CJSA 1HHHA 1KJVA 3RWGB 4X7FC 2N0KA 5D72L 3VQMA 4PGCA 4FNLH 4N28A 4M8VA 4LIQL 4IOSA 2VMJA 5JMWA 2RG8A 1OM3H 4LU5L 4ZPTB 3BZFB 3KD4A 2FT7A 3HI6L 5DJDA 4K8RD 4U0RC 4AEIL 1GZHA 2IPUG 1MUJB 3DNKA 2LFGA 1DQJB 3O3UN 4AGLA 3CGHA 1BECA 3M17B 4J1UB 4K71B 3VGGA 1L3WA 25C8H 1CT8A 4MJ2A 1H8NA 4PS4L 5AOMA 4I5BA 2ZWNA 5DHDA 4BK5A 4ZZFA 1C5DB 4IOIB 5IV2A 4FU3A 2AQ2A 1Q9KB 1S7WB 3MV2B 1WBXB 1RXLA 3CVCA 4RGNE 1LP9F 1OGAA 3D5OF 3FB6B 2IMMA 3QEHB 3D85A 5GISH 3AG4E 1MX4A 35C8H 4XMWA 3HE7C 3RURA 1ZTMA 3GSUA 4I2XB 5JO5B 2E46A 4P29A 2ZE0A 2IALA 2XZAL 3DRQA 4ODWB 2PYED 3S5LB 2F1EA 1XBDA 2J55A 2KDYA 4DEPC 3QJZA 1RZ8A 3OJVC 5I1DB 1NAKL 1T6VN 4LSRL 1KN4L 5J13B 1MCKA 4BWUA 2CJUH 4QTHB 5JNLA 4ZQKA 4HW6A 1JPSH 1T03L 3PEVB 1NMBL 4UF7C 4M6NL 1F6FB 1HINH 2BIPA 4UOQA 3F6LA 1WC7B 5C0FB 2CDFA 3EFOA 1CG9B 2NY7H 4WU7B 3VFRA 5L0QC 5KBDA 4HIJB 4LSZE 1JXKA 4LG6A 3BGMA 1SRDA 3QUKA 1AAJA 2ORBL 4XP6H 2QKSA 5ACMA 4W6YB 4RMUA 4KVCH 4CBZA 1B4LA 4K03A 3M8OL 2IF7A 4NIYE 5KBLA 1A1NA 1KIPB 1NSNL 2P47B 1QUPA 4H8UA 5AQ7A 3A4EA 3PDDA 4JW1A 4L9DA 1RZ7L 4Y16A 3Q3GA 5DHVH 3WS3B 4ZFOB 4F92B 1U8IA 4HBCL 4G6JL 4JAMA 1IAII 4O5LL 3REVB 3DVNB 4LKCA 5AKRA 4PSRA 1C5DA 2WKLA 4RSVA 1BU9A 3LY9A 2OXGB 2WCPA 3ARGC 5BVPL 1WBXA 1MCNA 3HPJA 2YNQA 2V5RA 2VLJE 3D0AA 3L5HA 4WU5A 1GMEA 2MNJB 3IRPX 4ZHBA 4N2IA 4PLJC 1Z0NA 4AQEB 4K2UH 4NI6A 3V52H 1Q9OB 5E24E 2BOCB 4BGDA 5ILTL 1QLFA 5A7EA 5C07E 3RAUA 1WCQA 1ZTXE 4CUCA 3LQAL 3RTQB 4LCIH 3WKMH 1IZJA 1BMWA 4N2QA 2AQQA 3B3IB 4QXTB 3RJVA 3WN6A 4GKNA 3RE0A 4DWHA 2ZX6A 5AW7B 3QORA 4YHLL 3LXBA 1QW8A 3IDJB 3QEQA 4W6WB 5DBKA 5IEKA 1RUMH 4PH8A 3DJ9A 5DA4A 3X1EA 3V5KB 5CR8A 4F9PC 1U8JB 3O4OC 1AQKH 5CO1A 1DLFL 1P69B 3VD2A 4B5EA 3WELA 3QEUA 4F1PA 1ZT4B 2ZX8A 1ET5A 4LNGA 2GAZA 1KIQB 3OKYA 3MRPA 3Q44A 3DUSB 3TH2T 2MTAA 1SYVA 2O5ZH 4P5SA 1P5VB 2AW2A 4FLBA 1AKPA 4ETYA 1OAUH 3GXFA 2XWCA 3PNWA 5LCVH 2VUKA 1AGBB 3IE4A 1GXWA 4X6DA 5ICXA 1GOFA 3GO1H 5DJCB 3ZT7A 2PN5A 2YRLA 4FFYL 1SG7A 4U1NB 3ULUE 1XB8A 4DP7X 3UBXI 2WPGA 3FQNA 4AYMC 2DJMA 2H0JA 4HYTB 1FC1A 5DJDB 4EIZC 3FTGA 3ABMB 5G05C 1JIBA 4EJ1C 4HDIB 1YNTA 5ENOD 4A7VA 2Z8WC 3F8UB 2XA3A 4B41A 4YXLL 5ISZA 3RGVA 4TLIA 2X44D 4JR9H 2BVQB 3GMNB 1KPUA 1BYOA 3GZOA 5D5ME 1PEWA 4GTOA 1VKXB 4LL1A 4F53A 3EU9A 1TETH 3BP4B 5CMWA 5GGVY 1CQYA 1RZIA 2YARA 2BF0X 4YDIH 2VB5A 2OMVB 3WFZA 5E4EC 4X9GA 2FO7A 3MYJA 3P2TA 5I19H 1U8MA 2P26A 1GVIA 4LPWA 4Z7NB 4RFEA 1L0QA 4OLEA 3QW9A 3GKWH 3LH9A 2DOCA 2XTLA 2VQ4A 2BS9A 4LL9A 4WFHE 1BQLH 2UY6B 1W9XA 4G9FB 2VQTA 3SKMA 4KMTL 1KNOB 3ZE2B 4TPRH 3W5NA 1XFPA 1ZCRA 1HAWA 1N12A 2IFFL 2UXTA 3IJYA 4DP6X 4XN1A 5H8DA 1TTUA 4JRYE 3T0EB 1QLRA 2WJ7A 4YNYB 4P2QB 4NOBA 4BFJA 5DJCA 3WFDH 4M61B 3KAAA 2GFBA 3H9HA 1I82A 2XXFA 4J6IA 1CC3A 3D69B 4YJZL 1Z5LA 3P7SE 2H2PC 5JZ7C 1NMAH 1JAEA 5KSAC 2NNXA 3O2WH 2RALA 1YNKL 2X2IA 3VXUD 1L3FE 1H0DB 2ENSA 3LRLA 3SHFA 4ZX4A 3BAJA 2MCG1 4U1SB 5PCYA 1HHJB 1D7FA 2GRNB 1NUFA 1YEFH 3VO0A 4GW5A 4RDQG 3UM3A 4F9LA 3GHBH 2YO3A 2ZP8A 1HKLH 3CSGA 4JRYA 4Z7VE 2A1WH 5LN4A 3TO4C 3OMIB 1H5BC 1AIFA 3CZFA 4XWOD 5L9DH 3CN1A 5JA8B 3Q1SL 2O5YL 2DYPA 2IV8A 4M7LL 1OPGH 5DO2D 3MLSH 5I6NA 4MQ7B 5HLTA 2Y1DA 5FB8B 5DPEE 5JPNB 3CK8A 1BQHB 1OHQA 3VRJA 4AZ8A 3RY6C 3KSQA 1OPOA 2VDLB 4Y5XC 2E9WA 4WDIB 4JN1L 4LB8A 1M6OB 3FTWA 1NFDE 3MKQB 4ILGA 5GIRA 1JK8A 4TL4A 1E4XI 1A9BA 1KV7A 4GQ9L 1F11B 2JE8A 3AS0A 5KJNA 3MN8A 4JB8P 2IBZY 4P07A 4WI6A 3IAGC 4TVPL 3PE3A 2C7FA 3PPEA 3T0EA 4R0LC 2QZ5A 3WIFB 4AM0Q 3L1OH 5EIDA 3GIVA 3H9HB 3VI3A 4EN3A 2FSEB 4X80L 4MA1B 3KGTA 3EJPA 2V2WA 4BSVB 4OV5A 3ZRFC 4Y2OA 5C2UB 5DHYB 3SE4A 4YHZH 1RK1B 3EYOB 3BRGC 5LHDA 3I6LD 2OMWA 1EZMA 2MNWA 4JFDD 4L9LC 1KT0A 2DDQH 1Q94A 2EE2A 4IJTA 5MP6H 4QDGA 3U1SH 1E9QB 1S70B 2Z7ZA 5PAZA 1UJKA 5CGYD 3T3ME 4AQ1B 5GRYA 4ZZKA 3TWRA 1U3HC 3G6JA 3LEWA 1A3QA 1OXYA 1WIOA 3WGVB 2C3WA 5FDYA 1EHXA 4JVWA 2UYLB 4AGPA 3LVRE 3K71B 4W9RA 4NRXA 4IU3B 1PAMA 4JHVA 3MGOB 2XQYA 1P4IH 2EEDA 5B3JE 3C6SB 1QRNA 2EXTA 1DBAL 1MZZA 1IGIL 2F61A 5F70A 4U7EB 3D1MC 2VITB 3HUJA 3T8HA 2FJGB 3RWFB 3HHSA 4FNLL 4LSVH 1F97A 4OI9A 3WIHL 1ADQH 3N1GC 1X3ZA 3EHRA 2FO1E 3NCYP 5A2LH 1SVXA 1KGXA 4AI7A 4D8OA 2P1YA 4Y6WA 4WI2A 2HVJB 3OKLA 4KZDL 4PRHE 3GS7A 4JRWA 3NFPB 3HMXA 2OK0L 5IW3A 3TAXA 4NQEA 2CLZA 2GEEA 1GRWA 4H8PA 5TQ0L 3I3DA 4P2RB 1ORSB 3KLQA 2AJUH 4FG0A 5TF1H 1KTCA 3EZ8A 1UD3A 4GT7A 5AL0A 3C5JA 1JZIA 2ZF8A 3R19A 5F44A 1FSKB 3MBED 2UY1A 1IO4C 3RVTC 3BZ4B 4U6YA 6PCYA 3BQUA 4PWFA 5HBBA 1VADA 1JGLL 2NUPB 2V37A 2Y5TB 2G60H 4JFFE 1GJUA 3WHE0 4ECNA 4YPGA 3NQXA 1TR4A 3V9CA 5I1KL 1UEYA 2IQ9H 4U3SA 5E6ZA 2RJIA 3FXSA 5DUPL 1SHWA 2C5ZA 1H3LA 1UT1A 2G5RA 1WBYB 3PZ2A 4U1MA 4CCAA 2CJUL 3ISYA 4QWWD 1AGFA 3I50H 4O2EB 1TFPA 4RFOL 3F3HA 4Y5VA 3R8BB 3KL5A 4M6NH 4Y2DB 5C0DB 4Z7UE 2F6AA 3PWPA 4NLHA 2BSSB 3D0VB 5EZOL 3V6ZA 1KPRA 4A2EA 2KUTA 4ZMQA 4AMKL 1EO7A 1KF9B 3OQRA 3NJMA 3QQ4B 4ZMWA 5IY5E 1I4FB 3KJ4B 3DMMB 4GAYA 4II7A 3B9AA 5HJDA 1MCPH 4TSAH 2FWOB 3HC4L 5E1QA 2W60B 4H5SB 1N4SA 1T6WA 1A3LH 2NXYD 5CHEE 2CLZB 4GMTH 3RU0A 3V4VB 4K55A 1M1SA 5FB8A 1IM9B 1O7VA 2R2LA 1ZVHA 2Z92B 3QK0A 3E30A 1OAXH 2P9NG 2ZYIA 5L0QB 1JS4A 2AAAA 8TLIA 5DO2C 1OCRE 4MZ3A 2XQBL 4HIXH 3BPCB 3TNMA 2GY7B 2QQLH 4R96A 1F90L 1EDHA 2YGOA 2NW2B 5EEXA 2DKMA 2Y3NA 3HG0A 1DJYA 4DCQA 1F6AB 1BFVH 2NY6C 4ZMLA 4UZSA 4PIRF 3L7EA 3G5ZA 4YVOA 3LS4L 1OAQL 4H0LC 4NSKA 5LAPA 4LCCC 5E9AA 3BFWA 3M1BA 4OV6F 5GGVH 3AAAC 2Y4UA 3QDGD 4KMLB 4FQXB 4WI0A 4EVNB 4WEEA 5AVQB 4EI6B 3NUKA 1N59B 2CK0H 3BJ91 2AEPH 3DHUA 2XRAL 4O6FA 1U8PB 5H94A 3NOIA 4X6EB 5F89A 4KTGA 4FLRA 1QPKA 4LOFA 3D9PA 5DC9B 3DIVA 4POZC 1E9QA 2A0LD 2NR6C 2OL3H 2WQ7A 2XLLA 3LNEA 5T1LB 2KC7A 1N5AB 3BP7A 1AGDA 5DS8A 4A6YB 1GTNA 1DLFH 1YG9A 3P2BA 4LLWB 3TIDB 4TQ8A 4H57A 1U3CA 1OL0A 2HX9A 2IDQA 4P2OB 5D1XA 2Z31A 3DIDA 4Q6KA 2GIMA 1HN1A 3AUAA 1A4CA 2W60A 3TIEB 2AZUA 3LKRA 5FQ8A 5D66A 1EAJA 1G7QA 4JG0L 3MGOA 1OGAB 3QEHA 4XN7A 3AACA 4B0MB 4EF3A 4ZMVA 1GKOA 3GI8L 3UBGA 5BXOA 1F58L 1U2HA 4OTXH 1ZGLB 3QR1A 4Y4FD 4RBPH 2FJGA 1SJHB 3GSRB 4HLZH 2RB8A 3TMNE 3QJSB 1JVSA 1Y6MR 3HHSB 2V5TA 5E2UL 4NUMA 3U4BL 3QNKA 3ORJA 4BYHA 4EXPX 2EH8H 3KYKH 3NIDE 3TT3L 5EIBE 3SQOL 4TMNE 5IKCA 4OKVA 2Z1PA 1BZDA 3NT0A 4HKXB 2YHCA 2FNBA 4GTTA 2DIJA 3H4FA 5INDA 4BT8A 4Z0XB 3UZQA 4IRSC 4JFEA 4I0PB 2C1OB 5I71B 2HA1A 3FCUB 4BQCA 1QUNB 2P9LG 5ES4B 3RNKA 2LV4A 5HXMA 4CT4A 3OL2A 4U3CA 2QJ1A 3FF8A 1CLVA 4QRQB 4BHUI 4HT1H 2NUTB 1F3DJ 3SCMC 2QR0B 3PWJB 3AJIA 4FKEA 1A6ZA 4RFNB 1QNIA 2A83B 3ARSA 3BZ4A 4U6YB 2QSCL 1KYFA 4UWFA 1OV8A 1OZUA 3WXVL 2Y5TA 2G2PA 1V7NH 4XMVA 2B14A 4KRPB 4F57H 1YECH 4YUEH 2NRDA 2UVFA 4FEIA 5HGAB 1OT4A 3JWOC 1FLRL 3TIDA 3II3A 1P7KB 1J05A 3GSNB 4M3OA 5JT9E 2B4CH 5EOTA 5K1VA 4V1DD 1ECZA 4DSYA 4ZFFB 4HUUA 3CLJA 3VUAA 3P2DA 4FQLH 3KWWA 3SFYA 1X7TA 4JMXA 4KGJA 1S8DB 2IFFH 3ANLA 3CU1A 3D18B 4HGWB 4U49A 4BFBD 2Z93B 3MHZA 1NBZB 1QATA 4NRYA 3AABA 4YDKL 3MOBL 4ZNCD 4LQ1A 4XNBA 3UPCA 4JEGB 4QY8A 4LMQI 4FKKA 2IAMB 2X9YA 4DW2L 2DB8A 3SDXE 3QFJE 3KYAA 5C0JA 2MPVA 3O6FA 3DMMA 3E2HC 3O2WL 5L8JB 2QSVA 5DQ9B 1MJUH 2OTUA 3QUXD 5D8JH 3NJGA 4HWEL 4YSQA 1JGVL 4Q6YA 4I17A 1GS8A 1Z9MA 3RPBA 3IU4H 5DC0A 4JFEB 5EBGA 1J18A 1YY9D 3SBQA 4BUHA 4OGQC 4HEPG 2PNNA 3SYOA 1Q90A 2C2LA 2VW4A 4L1DA 2OPCA 2D73A 4JKWA 3DVIA 5A2FA 3ARDC 3ONLA 4J3OD 4CGWA 1GYWA 3A23A 1DVTA 4OCXL 2WW8A 4U6HA 5L9DL 3K6SA 2YOCA 3N21A 5IVXF 4Q4IA 3P7PE 4AE0A 3UX9B 2WVVA 2WINA 3MUY1 5ANMB 3WUWA 1MCFA 5DZJA 2BMKA 3M7OA 4LQFL 3NAWA 3GK8L 4JPVL 5K9OB 5JDSA 3O3AA 5D2LF 4ZTOL 3NIGF 1SLUA 4X6FB 1CICC 1MJJA 1NCCL 3RI5F 4G2VA 3GSNA 5A40E 2WMPB 1IKND 5LCWJ 4ZXBC 5SWQB 4IRJA 1SN5A 3I9GL 4ZUSB 2E6JA 1UM6L 2LU3A 2W88A 4U1HB 2NY0B 2GIXA 4XVSH 3UT8A 2CIKB 2YAOA 4GUPB 3QDHA 4MNGB 5JHMA 3RX7A 3TESA 1JD9A 3H56A 1A6AA 2L7UA 1HEJC 2GI0A 3OM3B 5DD0H 4F2EA 4ODVH 5TF0A 2A7OA 4JGNA 4UCFA 4YDNA 4AIOA 1OB0A 4J8DA 3GSOB 5MERB 4NQDD 3DOHA 1DBJH 4HBDA 1AO7A 2EQDA 2NY1D 3A6OA 3QB7C 2VR4A 2ESVD 4LLWA 3GI9H 1NFDB 3EJZD 1P2CA 2A0LC 5SWSE 4PRPA 3ULUC 1CB4A 5AALA 2VXTL 2UZYA 1C08A 4XP9L 3RUGA 4P8QA 4U8HA 2EZ0D 4XI0A 3BP4A 4MDJA 2AXGA 4ZMYA 2YBRB 4PCKA 2WUCL 5EX0A 2LAAA 4U2YA 5AVRB 1NCWL 1X44A 4GQRA 1ZLSH 5EOQL 1LE9B 3JSSA 3LD8B 4FERA 1WP6A 2V33A 5DMGC 3JWOL 1BFTA 5DC4B 4ODSL 5TDOB 1NCNA 4TF4A 1JNHA 5GS2D 5K9OA 2O26U 2DM4A 1DBAH 5D0QD 3E32A 3RQ3A 5IESH 4NURA 4X6FA 3BH9A 4KQ0A 3FB7A 1LYQA 4MXQC 1N54A 5L41E 4QXWA 2WTRA 2X0WA 5T3ZD 2KQMA 1F3RB 3D2UA 3VWKA 3ZL4L 1A0QH 4LIQE 3BU8A 3ARDD 4G42B 5E99L 3AM8A 4K4KA 3EDFA 4YNYA 4QHUA 4Z7NF 4PS3A 3AS3A 3FFDA 3GJFH 4QRQA 2GTWB 1MEXH 5I8KL 4PEEA 3RBGA 4B9ZA 5K69A 3D51A 1EDQA 2WBXA 2OSWA 3UAJD 2R56L 2Y23A 4QRRE 4BZYA 3MUGB 1PJWA 1F5WA 2OXHB 2QMKA 3L4CA 1R9FA 1FRGH 4UM8B 4Y19E 2D9QB 3HG4A 2X3MA 4MGXA 2AJUL 1MH5B 4UZUA 3UT7A 1FAIL 3T0VA 1SVCP 4RG9A 2IWKA 4PJGF 4QFVA 4UI9J 3U9PL 3MREA 4WV1C 3DURB 5D93B 3E1ZA 3T2OA 1H6TA 4BBWA 2R2CA 4NB7A 4JKKA 2G60L 5JYLA 5IOPB 2KZTB 3FUDA 3DXAB 4TTGA 3RRMB 1N95A 4M3JA 4L9LA 1TEFA 4IK7A 4BX9A 4N1EA 4K71C 4Z7WF 4JZJC 1KIRA 1W8NA 2HRPL 4M48L 4NENA 3RWJA 1EMTL 3HI5H 2H3NA 3P3TA 2XFXA 5SX4I 4I9CA 5JPNC 2I7OA 4NQVB 3WSQL 4KKPA 5DJZA 4MKMA 1OCOB 2WO3B 2G3MA 4HCFA 2YGNA 4UUJA 1G7PB 3PFQA 4Q2ZB 4EBQL 3DGGA 3RJDA 3V0EA 3GDBA 4BELD 3M6DA 5ALBL 1NANH 4FJYA 1EVUA 3AU0A 2XKNA 4WIQA 4Z1PA 2FO4A 4Z18A 3MJ9L 2VSXE 4LSDA 2BRQA 5KVEL 4PRNA 2ZPKH 3PG2A 2DS4A 3TPKA 4HC1L 1PY1A 1F4XH 4AXWB 4A3TA 3B6SA 3P9WB 4J3OC 3VXRB 3INUL 4JVPA 2CALA 2FLMA 4GMTL 2ITDB 4PJCF 3OLDA 3AADB 4B93B 2ZWKA 3HE7A 5I74B 2RFXA 3VTAA 5I5IA 2DWZA 2J1WA 3H9SD 3WKNA 2JTYA 1JGUL 1RZJC 5K9JL 4YSDA 1N3NA 2EXYC 1OQOA 2XQBH 5DRZA 3VWKC 5AB0A 1F90H 5LXVA 4S1QH 4J8FA 4DVBB 1BFVL 2YC1A 3U36A 2UYLA 4TMPA 2E74C 3QZBA 1UYWH 3BE1H 4JX0A 2CHNA 3ABKE 3FJTA 3GZSA 4Z3JA 4OGAC 5INCB 2C7UB 2Y1LE 5HGBA 1MLBA 5DO8A 2HG5B 3J5PA 4MCYB 4NDMA 2AEPL 3SE4C 3SY0A 3SDCA 2CAKA 4O2FB 1BI7B 1U8IB 3L7FB 1W6LA 2AXFA 3CVXA 1NPUA 2NLJA 4M02A 3HNVH 2OL3L 2A6JA 3H6JA 5KVDH 1C9SA 4IHBA 1N4QA 4IYPA 3ES6B 3QNFA 3C60D 4KC3B 4FTVB 3VX1A 8FABA 5DUJA 4JY4B 1O1TA 2J72A 3HS0A 3I3BA 3QXDB 5KJ7E 2FBRA 1G9NL 4X9HA 3WY2A 4BUGA 1DSYA 4YL9A 1FNSL 4ZUTB 4JG0H 4DN4H 4N5CA 4Z7OE 1JNHB 2X70B 4YSAA 3QQ3B 4FNTA 4CVZB 4UAHA 5FECA 2I6HA 5ABAA 3ESLA 5IGXH 3BRDA 3MXWH 1L7IL 4DPBX 1BLNA 1QABA 3B37A 5GZND 5I6MA 3QC1A 2ICEA 1CVRA 4DO6A 5L2KD 2CLRA 1BFSA 3B1TA 3LD8C 3OPZL 4P04A 3VM5A 5EZPA 2YC1B 1K3ZA 3ZE2E 4NKDA 3KYKL 3DXMG 1IEAA 4GTPA 2BSRA 1IQRA 1E4KA 1RZKC 1A5FL 2GIYA 3SIKA 4BESA 4GYBA 4K3DH 4PFEA 5GSVA 3X1GA 5IMOA 1U8LA 3FH5A 2ZX7A 3V4PL 5BRZA 4F3VA 1MIEH 1U8JA 3KS0J 3L3HA 4NRZB 5CCHE 2HWZL 2E9GA 3PJSB 5F1OB 4DZ8B 1VFAA 1S9WA 4WNEA 3JWNH 3DSNA 5BOPA 4K7PY 1X5IA 2X42A 1JZDC 2YHGA 4PJEF 4CXFA 2ZUTA 2LVCA 2YD9A 3L7FA 4HISA 3VA2C 2CKBL 3ZE0E 5ANRA 1DCEA 2E7BA 3MCKA 3BVXA 5EF2A 3NMEA 2P42B 3HEIB 1YECL 2QHLA 4TV3A 4LVEA 3T09A 4DETA 1T7XA 3T8GA 5BRZD 2JIXD 4HS6A 2JB5H 1DJXA 4G1MA 1JGDB 1PNDA 2PNDA 1NC4D 1GW6A 5D7LD 1JPEA 5I2IA 4XI5D 1M05A 1H3PL 5CEDB 3FU8A 3OHXA 5DJ8B 1VZGA 3D8MA 4HI9A 2YSTA 1CICB 4Y8DC 4GB9A 5DD6A 3QCUL 4OZFA 2F08A 4KUCD 1VGEH 2NCEA 2BVQA 1N7MH 3GMNA 1ND0A 2WP3O 2CR3A 3N55A 2JCCF 3I5PA 2NNCA 1ASOA 1IEAB 1H8SA 2BSRB 5ECJE 4LEOA 1A3RH 1EFXD 3QIBD 2F8IA 5TFSH 1LE5B 5CLWA 4F80A 4EVNA 1JGVH 5EN3A 4I1PA 5F7EL 6CGTA 4IBVA 1ZLVK 4I3SL 4A1RA 4HP5A 4KH9A 1D5XB 3FRUA 2JCCB 1TSRA 3Q43A 3NZHH 2PQRA 1CE6B 1KBGH 5D7LB 4ZQGA 1YEDB 1S63A 3CN2A 3IE9A 3C9NA 1XL4A 5ID1A 2D2CC 1K5WA 2AABL 4IW4C 4KHXH 2GT9A 2DM2A 1PBYA 1SY6H 1BXVA 1G4RA 2F8VA 1MIMH 4DFHA 4JPVH 3MNWB 1QZNA 5IG7A 3CXDH 2EXWC 4X6CA 5DGQA 4AIFA 1NCCH 4P5TB 3I75B 2EDJA 1BMZA 5IVOA 3O41B 2J12B 1IE4A 3OMAB 3VGBA 3NQKA 1PY4A 4Z78A 2HJKA 4PBXA 3SKUD 4QTIL 5D7JC 3R4DA 1UVQA 4DI3A 1U58A 3FOLB 4HV8B 1EPUA 5FQ4A 3IMRA 1OY3B 4D3CH 1SQMA 1KTBA 5BMFH 3NSDA 2XEEA 2VDOH 4PV1C 3TWCH 1QSED 1MW2A 3I6LE 4L4JA 1RZKL 4KKBC 5JJ6A 3DYPA 4CILA 4XO8A 1RUPL 2Y1FA 2IMNA 4JRYB 3TJPA 4PJAA 2VQ1A 3ES6A 2OMUB 1URLA 3HCVA 4K8RL 1TNNA 5EEWA 2YPKB 1I9IH 4NZRH 5GZNC 2C1OA 5E6IA 4CADA 3DPBB 3SPJA 4GRWF 1T21A 4K3JL 3ZY7A 4Y4HD 3UBHA 3PP4H 3UJTL 5C9JB 1C7SA 2VGXA 3O45B 1ERNA 3RVXD 4Z7VA 1L3NA 1D5BA 2BOBA 2BP8B 1TSHA 1TLXA 1FORH 5KJRH 5J1SC 4UYPA 2Y72A 2CRMA 1ZLSL 1TLKA 5E4AA 3CFUA 5EOQH 2WB7A 1A9BB 3DBSA 3JTSB 4GMLA 2Q2LA 2Z35B 3E9TA 3I4RB 5GJTL 5I1EH 5JAZA 4P4KD 2WZPA 1QG3A 3CVHB 4KPHL 4WO4D 4YVQC 2AVPA 2ZP0T 4GAJH 2O6EA 4XNMA 1AFVH 2AXVA 2DLIA 1WF5A 4BFOA 3UPRA 7PAZA 4OFVA 1MRCL 2FSEA 3CDCA 3L3HB 3U1QA 1SDDB 3BUPA 1FJOA 5AARA 1PCXA 4I6EA 2OQJA 2IC2A 4F2MA 2KPNA 4GKZA 1E7UA 5DHVA 4RGOL 5L6YL 4FI6A 3MC0A 4JFSA 1MEXL 3AY2A 2Q9OA 5MEQA 4RA3A 4JA7A 1KBKA 2KLRA 4Y4KC 3O6FB 1UJ3B 1W16A 2BFGA 4HOZA 4XCNA 2WLLA 4MYPA 2FDBP 4YQXH 1DQML 2XEHA 4M62H 3MNZA 1FAIH 1O9WA 3H2QA 3S35L 3LY7A 1LMIA 4IJ3B 3FVPA 2P5WD 2X4SA 3O3EB 1HILB 3Q6FB 2RKKA 1HHIB 3FB6A 5D7JD 5DU7A 2E47A 5K39A 1OF2B 3V9EA 1W72A 4A04A 1OY3D 3GMPA 4O02L 2RD0A 2GSMB 4ETQA 2YD8A 3EHMA 5MHSE 3LKNB 2Y1EA 1R33A 4LCCA 5AOZA 3LHPH 3Q75A 1MAJA 1T0MA 3I3EA 4HFWB 2HRPH 1ZHLA 4HH8A 4N6RA 4Q4EA 4DX6D 3D6GA 3GRWA 2GABA 1YHPA 1J1PL 4NT6A 2J6EH 4U1HA 4XKCA 2D2OA 1KEIA 3SY6A 4K0RA 1GZPA 4YGVA 5EIQA 5IJKA 2IGLA 2FEZA 2EICA 4Y4HC 4A63B 5EZJA 2ILLA 2E27L 5JVIE 3MO1B 3PL6B 1UGKA 1YMMA 2A9ML 3QWPA 4IHQA 1ZJBA 3MJ9H 5KVEH 4Y5YB 3WMQA 3OF6A 2WI0A 3G04A 1F4XL 4FJZA 4HOTA 3M7FB 4YDOA 1XGRB 1JZ6A 3CHPA 3RIFK 2W92A 4KI5F 4XOBA 43CAA 4TRQA 3THML 5ITZF 2WM0A 4R90H 4GCNA 1NCJA 4FFTA 1FNFA 2G5BA 4XNXH 3GFUA 3T8VA 1OR7A 2IWFA 2ROYA 3FUEA 4N2AA 1A21A 4FP8L 3RHWF 5I16B 2BP0B 3IV0A 4LRNL 2WXJA 2OXGA 2Z8RA 3HR6A 4AUUA 3O3EA 1HNYA 5D2NC 3ZTJG 2CDGB 4XO3A 3QDJB 1DN2A 4L3CA 1CBVH 3QC6X 1HO8A 5IROA 5F1KC 4N24A 2AV1A 4ETQB 2VTBA 3L4TA 3FTYA 4YDLC 4ZO8A 4XRCA 2PCFB 4BFGA 2APBA 4E9QA 3BP5B 2AERT 5C0RL 4HOQA 3D39E 3GJEB 1YLBB 3RSEG 3T0YA 2CR0A 3VXRD 3HLKA 3TWSA 1N0LA 2ZKWA 3O9WA 1CT8B 2G5UA 2H5UA 5T5NG 2JKRM 4QYAA 5DLLA 2JKXA 3V6OA 4G7RB 3K9IA 2WQSA 3QFDB 4J3OH 2QSQA 4TL5A 5DUMH 3BXNA 4IBZA 3B7SA 5IB5B 4B95C 1UZ6E 3QDGB 3JZYA 2J2ZB 1CR9L 2Q7FA 3CZUB 5I74C 5KVDL 4AE1A 2R27A 4EQ2A 1S7QA 3IS0X 3WTYA 2A9BA 3RTLA 3V5KA 3GSVA 1D7BA 5CJ5A 4PJ9B 4JREB 3DRAA 2D0HA 4CVXB 3ULVF 1F0LA 3SODB 4OJYA 3BAXA 4D9QE 1B0WA 5A16A 1VENA 1MFAL 1UASA 5FQ6A 2H9GB 4LAQH 3UAAA 2OR7A 4DN4L 1TTGA 4HUKB 4M7LT 1NLBL 1DQKA 4OAWA 4OZ4A 4ZQKB 1FVEB 3TJEL 4GG6B 3U82B 2JKSA 3CKBA 3BAEH 4GPKA 2E59A 4YR6A 3KEAA 1QHPA 1QYGL 3V5HA 3GHEL 3GPEA 3OPZH 3AS4A 3FH7A 3RWDA 1JDCA 2DIEA 1J0IA 3OKOA 3ZDXB 4FLHA 2VR8A 5JPMB 3NJXA 3RILA 2I60L 4HAKA 3QCTH 2K3TA 3O3BA 4ZFGL 3QI9D 2EEBA 4KO7A 1OGPA 3II1A 3R06A 1UJ3A 3M1OA 3OXRB 1UGNA 1EEQA 3V95A 2BP5M 3IJSB 3N1MC 4WW2C 5C08E 3T6QC 3REVA 1TLIA 5AYQA 1VERA 1YJDC 3DVNA 3B2XA 2VMFA 2VE6B 4LPXA 1VEOA 4MJIE 5ESAA 3VI4B 4MHHI 5B1BE 3FEYA 4FMVA 4GA2A 1G1CA 2C4FU 2J2ZA 4UOW0 2KH2B 4QOKB 4GBXD 4DEPB 2W0KA 4AM9A 3GSVB 5DK0B 5DT1L 3V5DB 2JB5L 2AV7B 3RWEB 5HPMA 4AV7A 3G2WA 4KROD 5D6DC 1GSKA 3AXLB 3RC3A 3IFOA 1JERA 2GJ6E 2KS0A 5DRZB 2Q7AA 3DYMA 1K5HA 2IH3B 2HFFB 5LKNA 3SBSA 1NIAA 1M1XB 3CDGA 4XGZA 1LDSA 2AJYH 4R84A 2FR4B 5FYJD 1NAMB 4NN7B 4S1SL 4ILDA 5HHME 3TX4A 3TU6A 1HQRB 5C8JA 3U64A 4P2QA 1HH8A 1NGWB 4C83B 4R2GB 3CQGB 3RDTC 3IWVA 2VYRE 3T8XA 2O6FA 3VD5A 4JD2G 2FWUA 2WB1A 3WL9B 2QVWA 4XN8A 3QE5A 3ZU8A 5F7EH 3ARQA 4HX1B 4Z7QB 1ESPA 4I3SH 5KBMA 4JEHA 3SDCB 1OSYA 2CM6A 3LH2L 1CVSC 4W9CC 3H3PH 1QI4A 4WWPA 1U8NA 5KS9A 3ZI6A 3K4AA 2ARJA 2GK0A 4HCIA 2ZKXA 4Z77A 3ZKJA 1UD6A 5KSAA 3ZIMA 1SY6L 3QIBB 4YVNA 5DJXB 3BWUC 1MFEH 4OQTA 1FBIH 2XT1B 1J48A 4Y16C 2HN7B 5EO1A 2WZFA 4AKOA 4F7TA 2QVMA 5FYKH 1KXTB 1ZSDB 4K5LA 4F8QA 3QUZB 2R17C 3MRFA 3SCMD 5CIPB 2ED8A 4OD1L 1IC7H 4X5QA 1XB6A 4HUMB 5D7HA 5AIJA 3KPRA 4ONHB 3QDJD 2ZGGA 1Y6KR 3CH8A 5DJ6A 3UP6A 2OZNA 1JN6A 1Q9WA 1PX3A 3W82A 1ONQB 2VR3A 2EIJE 4QRSB 1FO0A 4W68A 4A1SA 2Z34A 2FH8A 2NNRA 1RZKH 4LLVB 2QDWA 4NC1C 3LPZA 1RZIB 3QI9A 4JHWH 5BQ7B 5HYQB 1F4AA 3C75A 4WUUA 2XXCB 1KEGL 2XQYG 1E7VA 2DH3A 4KV5E 2OCCE 1OARH 1N26A 1I8MB 5T4YA 5AJLA 2AJXL 2ADYA 1FYTB 4O9HL 4E42B 1QSFE 3P7RE 1K1BA 2CCWA 3B2VL 2QFRA 4DRXE 1UWEL 3CPUA 5DULA 4K7PX 3UJTH 1T89C 1YRKA 3BO8A 5C9KA 2DI8A 1I8AA 2DW5A 4GH7B 1NEZB 1S7SB 4ZAKB 3N44F 1SGKA 5EU6B 2D03L 4KKLD 3E8UH 1S9YB 5GSRA 1D9SA 2YRPA 1NUGA 4FS0A 2QPEB 3G6JB 3BEVA 3QIUA 2V5MA 4QHMA 5I1EL 1WT5C 4HPHA 4TUJB 5DFAA 1AP2B 4K94C 1YY9C 3T4AB 2VN3A 1JJUA 4FFVD 4U6TA 1YY8A 3LQMA 2IPTL 5ANME 5FW6A 4HU2A 4DOHB 4LP5A 3ESKA 3J2PA 1LWRA 1V05A 2I32A 2VITA 1JWMB 4WTXA 3TZVD 4HEPA 3R06B 3SDYL 2EEAA 1S9XB 4ZFQA 4DKAA 3ARBC 3DUUB 3IJSA 3ZZSA 1AD9B 3D9NA 1HKFA 2YXVA 1D3CA 4MS8C 4X7DC 3MV3B 3MV8D 1X4ZA 2WWKT 4X99B 5EUKB 3D39A 1N0XL 1SBSL 4M7KH 4FQ2L 3US9A 1LTXA 1AH1A 4FTVD 2R29L 4OIFA 1PL3A 2B5IC 3RWCA 2CE6A 4NJ9H 1TEZA 1RJZB 1RERA 2D7PA 4LARL 1JPFA 1XZWA 2EILB 4M62L 4IS6A 3V6BR 3CQQA 3ZPDA 2WTPA 4I77L 1SUJA 1Z3GL 3I4GA 2GC4C 3HNTH 3LKOA 1U0QA 1ZLDA 3CXHJ 1MQSA 1EVTC 3QISA 3PV6A 5KS9F 1BV8A 1DE4B 3RY6A 3MKQA 3SSBA 2UZIL 4KKAD 4DHLA 2IU1A 1UTDA 1Z5YD 2CLVA 5J3HD 3CHOA 4NYLB 2BERA 2L9BA 4JG1L 3O2VH 4X6CB 3IIEA 1WDYA 4K5AB 3ZUVB 4ZS6D 4FFYA 5AW6B 3FU5A 5JNYA 3DETD 1TCMA 3WHE1 5GRJH 2J6EL 1FL3A 1YY8B 4N5ED 5FHAH 4PGEB 2BHZA 2FB4L 4PP1C 4PDXA 4HV8A 2Y2WA 1BZQK 5CP3A 3GMMA 4NM8L 5C6PB 3M07A 3T2IE 5I8CA 4G7VL 2CPUA 2R5SA 3UAJC 2C3VB 1KBPA 5AD0B 3FSZA 3GEFA 1EHLH 5CHNA 5K1JA 3CFKA 4L5FL 4XCCL 2JD0A 4LVHC 4PW9A 4QIRA 1J1XL 2WCSA 2OMTB</