2XQ0A

Structure of yeast lta4 hydrolase in complex with bestatin
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
632
structure length
625
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHNKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLLAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUKOTRIENE A-4 HYDROLASE
publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 221
structure length 625
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xq0A03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xq0A02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xq0A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xq0A01
4ZW8A 3MSAA 4FYTA 5K1VA 4N66E 3FULA 1Z5HA 4TNLA 5LHDA 1QF0A 3DO0A 1KKKA 2WI0A 3T8DA 1NPCA 4D9WA 4XO5A 3U9WA 1TMNE 2A7GE 3MDJA 4K90A 2DQ6A 1KL6A 1KTOA 3EIMA 4JBSA 3FTXA 3FUEA 3FU6A 1QF2A 4OU3A 3FU5A 4RSYA 3P7UE 1LNCE 1BQBA 4PW4A 3FUHA 4GAAA 4QPEA 3FTVA 4FYSA 3FH8A 1U4GA 6TLIA 1FJQA 5JS3E 3FTYA 4ZW5A 3ZI6A 4XMXA 1FJVA 4NAQA 1KJOA 3DBKA 4Q4IA 3EBHA 1Y3GE 4ZW7A 4R5VA 1GXWA 3T2HE 2TLIA 3FXPA 3FXSA 4QMEA 7TLNA 3QH1A 1HS6A 3B7TA 5DPEE 2TMNE 2HPTA 3B3BA 4XMUA 5TLIA 3QJXA 3T87A 1KJPA 4K5OA 3FGDA 5A3YA 1FJUA 1LNDE 4MS6A 5AB0A 4KX7A 4OW3A 4N5PE 4ZX4A 3Q7JA 5JVIE 2XQ0A 3P7SE 8TLIA 2G4ZA 5TLNA 5FSSA 8TLNE 4NZ8A 1Z1WA 3NQZB 3KEDA 3Q44A 1TLXA 5AENA 2YD0A 4XMWA 4QUOA 3B7UX 5K7TA 3DNZA 3B2PA 3FBOA 3QGOA 1LNEE 3F2PA 3NN7A 4R5TA 3PUUA 1KROA 4KXDA 5CU5A 4ZX5A 3P7PE 4MTWE 4XN2A 3F28A 4WZ9A 4KX8A 4MXJE 3B37A 3QH5A 3FUNA 3FUJA 3FUKA 2R59A 4F5CA 1KEIA 4QIRA 1ZDPE 3LS7A 3FU3A 5L8PE 3FUMA 5LIFE 3FH7A 4XN9A 4HOMA 5DYFA 3TMNE 4N4EE 3FB0A 3FTZA 5L3UE 1H19A 2ZXGA 4MZNE 4B52A 5J6SA 5LG6A 4XMVA 3FHEA 1LNBE 4ZQTA 3FTUA 3P7TE 3P7WE 4K5MA 3P7VE 1FJOA 4KXBA 3T2IE 4ZX3A 5DLHA 3T8HA 3FORA 3P7RE 3FUIA 5FSPA 1QF1A 4TMNE 4E36A 3B7RL 4P8QA 3SE6A 3T2JE 4X2UA 4XN8A 4XN5A 1FJ3A 3NQXA 4XNDA 4ZX6A 3T8FA 4KXAA 1OS0A 3EBGA 4L2LA 5FWQA 3CHQA 4XN4A 3CIAA 5JSSE 1PE8A 1SQMA 1ESPA 4XN1A 3FTSA 4K5PA 4MWPE 2XPYA 5HQDA 2TLXA 4XN7A 5JXNE 3T73A 3Q43A 4Q4EA 5LDSA 4XO3A 5TMNE 6TMNE 4Z7IA 3MSNA 1FJWA 1KS7A 3FU0A 4K5NA 4M65A 4XO4A 4PJ6A 1HYTA 3T8VA 2GTQA 4K89A 4MKTA 4H57A 3FV4A 3CHPA 4DPRA 1TLIA 3T74A 3CHSA 4FKHA 1L3FE 3FUDA 4PU2A 4J3BA 4TLNA 4XMTA 2VJ8A 4KXCA 5AB2A 5JT9E 1KR6A 3FCQA 3B34A 4TLIA 4GERA 1FJTA 3CHRA 5L41E 3CHOA 4FKEA 3DO1A 5BPPA 2XPZA 4R5XA 1PE7A 4XMZA 1THLA 3N21A 3DO2A 2DQMA 3FLFA 1GW6A 7TLIA 3TLIA 5DLLA 3MS3A 4R7LA 1Z9GE 5FSJA 3NQYB 1LNFE 4FKKA 3B2XA 4RVBA 4ZW6A 3FTWA 4XNAA 4ZW3A 3MSFA 3FH5A 3T8GA 3FUFA 5LWDE 4PVBA 5DPFE 3P7QE 4FYQA 4FYRA 2HPOA 1PE5A 1EZMA 3B7SA 1TRLA 4QHPA 4OI5E 4KX9A 5C97A 4XNBA 1TLPE 3EBIA 2VQXA 3FVPA 4K5LA 3SSBA 3T8CA 5FXNA 2WHZA 4D91A 3QNFA 1LNAE
chains in the Genus database with same CATH superfamily
3MLSL 1HTYA 1IARB 4XNUH 4NAJA 1J86A 3CFIC 1VZGA 2XUWA 1A8JH 1FFPB 3H54A 4UYPA 4FXTA 3U9UA 3WFEH 3T0YA 5K1VA 4N66E 1E9PB 4QTFA 1L7IL 3ABMB 1V7ML 2VW6A 2X1WL 5ECGA 3CQCB 2WI0A 1IKNC 4WFED 3HS0C 2QADB 1ZB1A 4ZUVA 3AG4E 2XPGB 3JQ1A 1SJXA 3AWGA 5K9OB 1LD8A 1CXEA 3MO1B 3HAEA 4APQB 4FP8H 4UQEA 1RHHA 2V8SE 3H3BC 5FCUH 4OQTH 3EJYD 4KQ4L 4DCQB 2V5TA 1Z9SA 2YKKA 4TSAH 1F3JB 3HHSB 4GAEA 1JNNL 1E2VA 1EX0A 4FZEH 1OCWL 1YDPB 2W38A 2XKNA 2IAMA 2FQDA 4IJ3B 3FU5A 4N3TA 3WOVA 4HFWB 5I9QC 2JJUA 2IAAC 2H6GA 4S0SD 3POHA 4V1DD 3CD4A 4YE0A 5T1LD 1CIDA 4M1CD 1HKFA 1C7TA 1ZV5A 2EYSA 2L04A 2LU3A 5CMWA 4OLWH 3K2MC 1D9KA 5FO7B 4OD3L 4KH9A 4HHGA 2ZE0A 3JWNE 1F18A 4M8RA 2AQ1A 2WXOA 1NCHA 1VACB 3CDGA 3Q13A 1VERA 3LY8A 3FFDA 1U8NA 2Y7OA 4DLOA 4G6JL 3N44F 2LTQC 3V6ZB 2IDFA 3RGVC 3VI4B 1ZLVK 2AMUA 1A1OB 5DVNA 5K59E 5CJXC 2BIHA 1FV1A 1LM8V 5IVXA 3D07A 4N0CC 4QXUH 1IC1A 1VLXA 1LO4H 3BOVA 1XCWA 1TTFA 1UOWA 4YDNA 1UA6L 2HMID 4MD4B 1WYJA 4R4FL 3PABA 1JVKA 3II3A 4W9CC 2FD6L 3EADA 2H6PB 4TNWF 2RACA 1FJVA 2CO2A 2EEDA 5DZ9A 4PBWD 1T5XA 1DVSA 4YLCA 1A6PA 2UY7B 3IJ8A 3KWUA 4PP2B 2OCCB 5IB5A 4GT0A 5GS1C 1XX9C 2IIJA 5IVXF 2DICA 4OH2A 3DRQB 4D9RE 2X4NB 2QHRH 3QFJE 1WBXA 2CSPA 1HAUA 4PJDB 1GXWA 2E5EA 4P5MA 3RVUD 1D5MA 1OB1A 3HR5B 3W9DA 2VR3A 4H2CA 3ZZLA 3CUPB 1TQBB 3T3MB 1P5QA 3MJGX 2GIXA 4UWFA 1ET7A 4U4BA 1BGXL 1BXXA 4WKXA 3BGMB 2MYOA 3IJYA 1ZLUH 4JG1L 4FHJA 4I0PD 3ZX1A 3ZSSA 5E24E 3ZEFA 2XCCA 1RUPL 2F54D 1TVBA 1KBVA 2VCOA 4FTVD 4HUUB 5DJXB 2FX9H 1E8XA 3T3PE 4N3CA 5FX3A 5CFAA 5I8KH 1VGEL 1ZEAL 4GS7C 3V0VA 3CZUB 4EE2A 2J55A 1P7QA 4DP7X 4TOYH 2IONA 5ENQD 3GZOA 2WBXA 1R6VA 3PEVB 3A4AA 3BVWA 4URKA 2ZWKA 3NCEB 4KDTC 4ENED 2EE2A 4ZJ9A 3CVHL 3FO9B 1RVFH 2OL3A 2DIAA 3MCXA 2W8CA 2ED8A 1LDPH 2P24A 2WLNA 3AVEA 2DQDL 4MB5A 3PY9A 5JW5B 1XGQA 5DULA 1NUDA 4ZXBC 3FN9A 4BK4A 4XCFL 4PRPD 1AQ8A 1CTOA 3ZT5A 3CIQA 2FRGP 2EIME 3IJEA 2EAEA 5F7WC 1IZJA 4ZNEA 1LTXA 2GK0B 1AACA 1OE3A 5HDLA 4X5LA 1J1PL 1ADQL 3O6MH 4UNIA 4WW2A 1KCSH 4Q89A 4NZ8A 2M83A 3F7KA 4FI7A 1MAKA 4HNAD 2NY7H 5E2UL 3CKBA 2VQTA 4NN5B 2ESVE 4E41D 4QNPF 5D1QD 1YNKL 3CFBB 1Z5SC 4G7QB 1GR7A 1UHVA 5KNGA 3VVLA 1QYGL 4PJ9C 5GIRB 2BSRA 3NGBC 1IMHC 3KLLA 2BRRH 3KYOB 4DAGL 3HBPA 4N3AA 5F7FA 3G6JE 1M6UA 1J8KA 5E5RB 2F53E 1KTDB 4Y6SA 1HG5A 1ZV2A 4WW2F 2L7JA 3FSVA 2DBJA 2Y1AA 3QHZH 2FIKA 2P42B 4FDWA 1J5CA 2YO3A 4OZFH 5F72S 2JCVA 5HI3C 3OKKB 3DX0A 5BUPA 2JB5L 5M95B 1EPUA 2W0FA 4CL7A 2VDMH 4YSPA 5CU5A 4GLRH 3P73B 2B6CA 1RKRA 5ANMA 2PKDA 5DJ0A 5E8EA 4GTMA 5GGRA 3VI3B 1QPKA 3P7PE 4CVXB 5IGXL 1SJHB 4GA2A 2R2BA 4LOEA 1GZHA 2B2XL 3NIGE 1GYCA 1CK0H 3ISWA 4N0UB 4XOEA 2NT1A 1UATA 1PX4A 3RB5A 1ICTA 5CEYB 3UAJC 3C2AL 4XO9A 5LGJA 1E3FA 5F8RC 3F5WA 5E6ID 2YK1L 3I3DA 4JFYB 4DN4H 3L08A 3MREA 3NA9L 3PWJA 3BAJA 5A6MA 1QSEE 4ARFA 3UYPA 1NEZB 1Q0YH 4POYA 5CP3A 3QDJE 4BRJA 3K2UH 4UM9B 3FH7A 1T2JA 2ORBH 1DQML 4FJYA 4J3WA 1J1XL 4IMLA 3NN8B 4ZSOE 3KXFD 1IC5L 5DJCA 5HDBE 3E7JA 5C92A 1O9WA 4P2QB 3Q6GL 4BETA 5HI5C 5BZDA 3Q9QA 1AHMA 2D7MA 1ES0B 1Q1PA 3MACH 3NFNB 3U6XA 1CDUA 3L4WA 5MHSE 2VYRE 3APFA 1TNMA 3C5JA 4NJ9L 1KT0A 2J1XA 4M6MH 3ABKB 5CLYA 3HN3A 1OSPL 1TTRA 3IU4H 3ULUL 1DCEA 2ALAA 2XZQH 2NUTA 3VYNA 5LUMA 1TYJA 3UTSD 1YYMH 2GRQB 1EVUA 3WGUB 3WE6A 3CHXA 4ZO7A 9PCYA 4NQUA 3S36L 1N10A 1MXDA 2G2NA 2VR4A 4GAJL 3WS6A 5HHME 1F4YL 1EAPA 5EBMB 2A1WL 1BZ9B 2K8MA 3BFWA 3RVXC 3L6FB 4Y1AA 1IT9H 4BT9A 4CJ1A 2ENPA 2PW2A 2ADIB 4DOHB 1TEYA 2VDNL 5EF3A 1U4EA 4OI8A 4PP1D 1O9ZA 1WFTA 2VLMD 2BZCA 3IKKA 5F8QC 1IJNA 4NJAL 5JMWA 3NABL 3PNRB 3H55A 4LDCA 2ED7A 4ES8A 3VD9A 1T04A 3L3OB 2DQEL 2GFBA 1MHEA 2Y2YA 2OCJA 1IIKA 3JZ7A 3HZVB 4DP8X 2Y4UA 5T8IA 1IGFL 1JUFB 5I6MA 1HWGB 3Q6FA 3TZVB 2H0JA 1QO3B 2HG0A 1X5JA 4GRLC 2EH7L 1ESPA 5K69A 2P48B 3HI5H 5EILA 1ECZA 1HCZA 2DQGH 3LVQE 4FERA 1CBVH 3B9AA 4OV5B 4PJGE 4AJ0A 3VU2A 1G6VK 1SHMA 3L5JA 4X6DA 3MV9B 3FO2A 4S1SH 4UILL 3NFPB 2WWNA 3SQBA 5IFAH 4B5EA 2X6JA 5KTEL 1U6AL 3LZRA 4TYUA 4XX1G 3ASHA 3T73A 2XN9B 3WIIH 5ITZF 5FHAH 1B0WA 1W0WA 5T5NF 4S1RH 1R5VB 3GKWL 3OXSB 2Q87A 2OTWA 5MENB 1N9AA 3KVDD 3RTQC 4XNXL 1ZJAA 1N59B 2DWEA 3MU3A 5JMPA 4X6DF 4D0BA 1SRDA 1UWEH 5EPMA 3SYCA 3BUYB 4DUXA 4PUBL 1IAIL 1SVZA 4PTUB 4XPTH 3TBCA 2EIBA 5F89A 3QXDB 3BEEA 2W60A 1LWJA 1XH3B 2A9NH 4K55A 1HYTA 4ZAKC 1AG0A 4L5FL 1IIIA 5GPRA 2F5BL 4EN3A 4ZFHA 3CQQA 3QCVH 2QHLA 3IXAB 3TFKC 3VXRA 2X7LA 3KR3H 1RK7A 5I6KA 4M03A 4EI6B 4JNXA 1TMQA 1NC2A 1VDYA 1PAZA 4PB0H 5J13B 4G26A 1R3KA 4F7TB 4XVUC 2DY2A 5D4QA 2HH0L 2Z0UA 4ILGA 4FKHA 5CMAA 1FAIL 4NHCH 4PGEB 1YECL 3ZL4H 1KXVA 3LQMA 1EYHA 1V8HA 4Z76A 5D7KD 5KS9E 3TURA 5I5JA 3QRGH 4MYPA 3VB9A 3O8XB 2DQHL 5KSAC 3UZQB 3IXEA 3A22A 3C60C 4PRBA 3MRNA 4IRSC 3H7LA 4GG6A 4UQ9A 4M3JA 3GYRA 5BZWA 2ENQA 4JDZA 4G7VL 1JPFA 1J7VR 1FORH 3MCLL 4N8PA 4B9GA 4AVIA 3G5XB 4P9ML 3TLRA 2WQRA 4DGIL 4AGLA 3SDAA 2BSED 2HFEB 2OS7A 5T1MA 4LF3B 3OAYH 1QRNE 3QUXB 5CINH 4GRWF 1ETZB 4AGPA 4RISL 1A0QL 4M43H 4FP7A 5HHNA 4OVVA 1CFQB 5GSRA 3V7AE 3WUWB 3H3PH 2J21A 3MLYL 5GQBA 2QPSA 4G6AD 4XBPB 4GG6F 1QTYT 5IG7B 2OAAA 1XVSA 4DKFH 5DRNA 3MYZA 5JIPA 1ZT4B 5AOKA 3STLB 4LNUD 1PCSA 5EIIB 3IU3A 4KYOB 2YN5A 3A21A 4AG4L 2IPTL 2IO5A 3KVQA 3NUKA 4CT0A 1RSFA 1WZLA 5G5DB 2NSXA 5JW4R 2XNAB 4RVBA 5EIVA 5DMKA 1IFHH 2J5LC 3HKZA 4ZQGA 3FN0L 1A6VL 4DVBA 4I6JA 4P5TA 5FYKD 3QDGB 4ZW3A 3GSWB 4JRYD 5KVEL 5CEXB 3CVHB 3FB6A 3T8GA 5ISZE 4L1LA 2O5NA 4M5ZL 2E27L 1A1NB 3IKOB 4GZDA 5F6IC 1Z5LA 2OX5A 1R46A 3DIVA 2KYIA 3KPPA 2VXUH 3MRJA 3IN0A 4H88H 4L3EB 1G6RL 3IAPA 3D9IA 2X4QA 4LLDA 2E86A 1XGUA 4DO5A 1KCVL 2HT3C 5LBSL 3DSVA 4Z0XA 4U3CA 4TS6A 3ULYA 2NY6C 2HPOA 3C8KA 5C0CE 5H8DA 5DRXA 4G8FA 3MOAL 4PY7B 4BFJA 4F15B 3H85A 2B1HH 1TRLA 3GXFA 4PJCA 5EOCH 4D8OA 2FWOA 5FM5O 1CXIA 5HS0A 1IM9B 5GRXG 3WFCL 5DLML 3RWCB 2JWYA 1NGWB 3TT3L 2BVQB 2DWDA 4GINA 3UERA 5FXNA 4FNLH 3ZE0E 1EO5A 3RWGA 1I3UA 2Z4QB 1BD8A 3IVKB 1HZ4A 3ZE2E 5HHOD 2I1JA 3AQXA 4FP8L 4MDIA 4Y4HD 1RZKH 1K8IB 3SKJL 1C1EH 2BJMH 1K9TA 4XMLH 4QOKA 2ZONA 2ZOWA 3I02B 4L29A 4ECNA 2YD7A 1ZVSB 3U2SB 4HHWA 3VFTB 4KNSA 1LP9B 2JJSC 4LDLB 4KKCD 3NEXA 5E4IA 3HC3H 1TFPA 2AJXH 5CZXD 5DCCA 4KTGA 1NDMB 2OVFA 3GBMH 4WF7A 2M63A 4TNLA 3E34A 1AE6H 4F53A 1KKKA 4OR1A 1IGIH 1NSNL 2C0MA 3VLFA 1E5BA 2H9GB 3KGSA 4PGBA 1O7DC 2KC0A 5HHPA 2PWGA 4BUQA 3LS4H 2I7OA 1RHFA 4KI5E 4BFGA 2NY2C 1E7UA 4O60A 4FFYH 4MXVE 5D71L 1VKXA 1GSMA 2V0PA 4KUCD 5DHMC 2BDNL 3JUEA 2A74A 2DQ6A 2YQ8A 4HUNB 2Y72A 5EN5D 3CC5B 4QXUL 3ZJAA 4W4NA 1LO4L 2IC2A 3QUHA 3VWKB 1I9EA 1HZLA 3M8OL 2CO4A 3HUJB 3BI9X 5B8CC 1LK2A 3FOLA 3QG7L 2Q1EA 3EBAA 5EFIA 4UTAH 4PJ8C 4AVJA 1CYWA 3F12B 3NJHA 3M17A 2WVVB 4GJTB 4V2BA 5KW9L 4QHKJ 2LAGB 3AY4A 3MGOB 4GYOA 5F1NA 2J1WA 4OCSL 4YSOA 1MCQA 3VFPB 3HE7B 3LB6C 2OVBA 3MKRA 1R0KA 3GMPA 4ODXA 4ZRGA 1JBJA 2QHRL 4UTBH 4L1SA 3VGHA 1BQLH 4K3DL 4JL2A 4TLKA 2DEXX 2AJVH 1EANA 4NOFA 4JRLA 3OJMB 1HXYA 3D05A 2D0GA 3ARGB 3TL5A 5MEOB 1E28B 2BSBA 5BO0D 4JHZA 5ITBH 4YH6A 2YPLE 4WTQA 5DQJB 4GH7B 4CJ0A 5HHVH 2JI3A 2VLJB 3LRLA 4XMXA 3MPCA 4ACLA 4Q6IC 1WD9A 4XTRD 3R06B 5ICZB 4NAQA 4IBWA 3LIZA 1L0PA 2P7TB 2ZOKB 4NDMA 2FX9L 2EDTA 5CERB 3QUZA 3UDWA 3VFOA 1TQTA 3L48A 2FWUA 3MCKB 3LS5H 5I8KL 4BWTA 1RK1A 1TZIA 4UV7H 1T0NA 3QDHA 4F20A 1NAKH 3VA6A 3LV3A 2D3JA 2VDNB 2VLAA 4R5VA 5G05J 2V9TA 4PWGA 4FQLH 3CLFL 5D72H 3TCLA 5AZ2H 4I9WD 1EXHA 2ZOTA 4GMRA 4I5BA 3VRLE 3OZ9H 2ZCKH 1MFVA 4D8PB 2A38A 3WQRA 1RVFL 1XSJA 2KH2B 4YHLL 3OHXB 4BEIA 1LDPL 1NCBL 3GMLA 3B3BA 5TLIA 4MCZA 3NJGA 4G7RB 1D6EB 2VDOH 1BYOA 3WN6A 3CK7A 5KN5A 4WI8A 3ASOB 2ZXEB 3T6XA 2BC4A 4LKXB 4BFFA 3QZNA 4L4TE 3ZKMC 1KJPA 1NGYA 4Y2OB 4K8RH 2EINB 1S7QB 2AW6A 2HM8A 2PXYB 4RESB 3SZ6A 2C7UA 1INDH 2JLPA 3WO3B 3PNLB 2ED6A 3L3JA 4XBGB 4Z1PA 3DI2B 5C2BH 3ASNE 5T1KA 4EJ1C 3VFSB 2X10A 2DPKA 4DSYA 1RP9A 4XRCB 2OXGB 4ABUA 2P5WE 4EDWH 5LWYH 4Z9KB 4M7LH 4KX7A 3UIYA 2FB4L 1OM3H 4FULA 3QNXA 2K45A 3BHBB 1LXMA 2W9DL 3PQYE 1TJIH 2XZDG 1U8CB 3EJYC 4I1RA 3FMGH 1A6UL 5AYUH 1KDIA 5JVIE 4N0YL 4A3VA 2V37A 2VITB 2NRDA 2ZKYA 4AJYV 4PGDB 5LP0A 3B9KD 4YR6B 4U6TA 2ED9A 1HO8A 2OMXB 1I1AD 4NI3A 2VDML 1RZ8A 1MLBB 1H2VC 4ETYA 3IWVA 2XQYA 2IBGA 1SOKA 1I9RL 3LKPB 3U4BL 4K2UH 1N6VA 4J1UB 1KJ2A 2ICWI 1Y6IA 4R8WH 3VGAC 3L5HA 5BQ7A 1W2KT 2OOEA 4QUOA 1AYOA 1S9VB 1DDHB 2PPFA 3GSQB 3TVMC 5K7TA 4BFBD 3U4TA 3OAZH 4RFEA 4WJG3 5JJTA 2AEQH 4FQQA 4AENB 2I60L 1MNUL 3WHE1 4HJ0C 4QRTA 2XV3A 4QHUA 2H1LM 5GSVB 4PGJA 5I1DB 4P4RB 4A39A 3IK2A 3LYAA 1NBQA 4DN4L 3LNDA 5IJVB 3HG4A 3O2WH 3TBVA 1UOVA 2HMIC 3JV4B 1UURA 2JIXB 4OFPA 3WGVB 4Z7QF 3AW5A 2YRBA 3IBEA 5BZZA 1UOKA 1MI5A 2VDQL 1ED3B 5ITFB 1JPSL 2PPAA 3NZSA 1TVDA 1DQDL 3T2NH 2BCKB 2QL1A 5JLZA 1N7ML 2CNZA 3QDMA 4U6VL 1D5XB 2VABB 2DYRB 1CFNB 2YFOA 3GF8A 4HDIA 1AYRA 2D03L 4L3CB 5C07E 4HAKA 5D5ME 5E6ZA 3SDDC 2PWEA 3RX5A 4GMLA 1HHJA 3KD4A 3MRRB 2Y25A 4E9XA 2YD2A 4LSPL 2AQTA 2JKLA 1NFKA 1CF8L 4PJIE 1ORSA 4UUJA 4ZBJA 1U3CA 5IZ7A 3LQAH 3N04A 2QSQA 4YHPA 2WXNA 1BJ8A 2WBWB 3HDXA 1S3KL 3IU4L 1FAKT 5KAQF 3H9ZA 2G0KA 4KJQC 1YYML 4XAWH 1UM6L 1MHPH 1CD9B 4WJ5A 3CQFA 4NQEE 3EFOB 3MYVA 1GHFL 1KLGB 4KPHH 2UWJG 2BHYA 1FCHA 2PUQT 4ELMA 2ITDB 3L5XH 5DHVH 2B77A 3AZUA 5TFSH 3QXAA 2UXVA 1S64A 1P2CA 5JIMA 3CZGA 4M93B 3REWA 3L5IA 3R4DA 5C7XH 3V2AR 5DXWA 3HG1B 1HN1A 2Z0BA 2PO6C 4A2HA 4LCCA 5T3ZE 1GRWA 3BWAA 4DJMA 1E4WH 1CT8A 3KM2A 2B0SH 4BY6A 3QEQD 3NIFF 3P3UA 3S3PA 1ZKAA 1A4JB 4H25B 1Q9KA 25C8H 4QWWC 4HCFA 4ZQTA 4WU5B 4ELMF 2CDEA 4ZMQA 1MUJA 1WEJH 1G6RB 3P7TE 1Y6KR 1CICD 3KGRA 1CUOA 2WLLB 2XFXB 3V4VA 1G9EA 2PW1A 35C8L 1AO7E 4MB1A 4CCAA 2DLHA 4NIKA 1PSKH 1WHPA 3K8KA 4IQHA 3LMJL 2X70A 4NPYB 2Z9TA 5JQIB 4HKZB 1ZLWH 1KYDA 4PI0A 3RU8L 1M7XA 4KVCL 1QYMA 2DQGL 4MZRA 1WICA 2EIJE 3QNZB 4U1IA 1CBVL 1OAXL 5D1ZI 2RGSA 3SGDI 5FB8A 2Q86B 5J56B 5A2CA 1U8OB 4XOAA 5DF0A 4LEBA 4E36A 2CHDA 1BMWA 1T1WB 2WKLA 3ARWA 4IGBC 3WJLC 3F58H 4WUUB 2WO2B 4YDVA 3TO4B 1CLOL 1B6UA 4BERA 7CGTA 1IC4H 2QGCA 1YNLH 1UXWB 3CSYA 5KBDA 3C87A 4S1RL 4GKZB 2GC4C 3CFJB 1X5YA 3FZUC 1DJYA 1JWMA 4M62H 3QI9B 1FT2A 4GG8B 3GINA 3A6CH 3Q05A 3SGHA 3UM0A 4OCXL 1PKQA 5EU6A 1ASQA 1JF1B 2NDGA 5D6CA 1PLGH 4YHML 5M7QA 3SPJA 1FA4A 3I6KB 2GSGB 3LTVA 3E9TA 2OZNA 1JK8A 4TKWA 3MUJA 3P2BA 1G9NH 3SHFA 4NEHB 4NM4L 3NJXA 5BOJA 3UO1H 3DHUA 2X5PA 2XG5A 2MSPA 2BO0A 4QTIL 2OP4H 4XCCH 2P45B 3KR3L 2WSPA 2YQBA 2WXQA 3AAAC 4TXRA 3OX8B 3EYQC 1PX8A 4TNFA 4PB0L 1RPKA 5L7XH 1WCBA 2DW5A 3QARA 3GSNL 4JDEB 4NQDD 3V5DA 1G1KA 4MXQD 5C6PB 1NAMH 4Z7VA 5D2NA 3D48R 2Q8AL 2WZPA 2DM4A 3KPLB 4Y4KB 3QWVA 3SGEI 2PYFB 3MV3B 2H6HA 5LXVA 1UD6A 1PD0A 2XC8A 3CE1A 4KTDH 4MA3A 4PJFA 4XNZB 4XB3A 2PCFB 5IMMA 3IYLW 4GW1B 2K6YA 1AR1D 1W72A 4RGNC 5GGUB 4DX6D 4NQCE 3D87B 3SKMB 2AZAA 4Z5RB 5IK3A 1NC4A 1KN2H 2YGVA 4HWZA 3QUYA 2H6IA 3KPSE 4Z7VF 4P3DA 1CLCA 1RD6A 2ZCZA 4HKBA 1ROWA 5KOMC 1HZKA 8PAZA 5D4HA 1L0YA 1KZQA 3LJNA 2QQQA 4PJFF 4X8JA 2MCPL 1CG9A 1KTLB 3H3PL 1RZIB 2ZXCA 3FB8B 4IIQB 2OSYA 4K9JA 1XIWB 4J0UA 1AY1L 3NAAL 2ADJA 5BMFH 3SKNA 2ZF8A 3GW4A 1PS3A 3QPKA 1PZBA 4OOFA 3RQ3A 2VWEE 5D6DA 2DBAA 4KMLB 4X4XB 2W95A 2WN3A 5CU9A 3KPTA 4JQXA 5JZ7D 2WNKA 4GI6A 3BSZL 3NP3A 3QJZA 5J12C 4WI9A 1D3CA 3U82B 1UD5A 2XCMC 4PR5B 1UWFA 3IJSA 3OQRA 4M6NH 4PP1C 4UUCA 4PBVC 5GGSA 3SOTA 2VXUL 2RAMA 5CCKL 4H88L 4U3HA 3W39A 2IWEA 4QRFA 4HCIA 1KGYE 5ACLA 5I0DA 1GW6A 4POUB 1HHIA 3WLWD 1NA0A 2BVEA 2NY1B 1SJVA 3DSXA 4A7VA 1FF5A 5GJTL 5DLLA 3BXNB 4C4BA 3MKKA 3ULQA 2FUQA 5C0AD 3X13A 2ICEB 3TJEH 3D33A 1SVCP 1SOSA 2B1HL 2MNWA 3QWNA 4PMEA 3RJOA 3U7WH 1H3UA 1RL1A 1I4FA 2PCXA 5ENNA 3DPYA 1DLFL 1A6WL 4QLWA 4WU7A 3O2DA 4KMTH 4QXGH 4KGLA 4KVMA 1Q9LA 1R3IL 3OTTA 3VFNB 1E65A 1RK0B 5IB2A 5F0LB 1PW3A 2WUCL 3A4FA 3RDTB 5LWDE 1C12B 2WO4A 4LNBA 3B1TA 4BA8A 3VI4F 5FOBB 4QT5A 1U8IA 4MD5B 4MJ2A 1OGAD 4LPUA 4MD0B 4RAHA 4XZUB 2BIIA 3QPXH 1CD8A 1UJTA 4N90E 3AU9A 2VAAB 1ZAGA 1CLYH 4OZFB 1WP6A 5G4MA 4HK3N 2VAJA 4JHBA 1GJWA 2P26A 1TN8A 2VDMB 4F1PA 3HC3L 3OB0K 2EH8H 4OBSA 4CAGA 1FN4A 5JW4N 2G5UA 2MAPA 3BP6A 1BOGB 1IBZA 3GBML 3I3NA 3KPNA 3QORA 1MKFA 3E6FB 2WQXA 3MAWA 4QGYA 2XOTA 3X3GH 2ZSWA 5F1IA 3UEQA 2GRNB 5DFVC 1JMXA 2BY3A 4MVBC 4G3YL 4XC1H 5GZOA 3ET9F 3HPLB 2A6JB 1ZIBA 4N4YB 4XGZB 2PWFA 4BWWA 4RQIA 1KPUA 2NZ1A 4LFHG 1TO5A 3SY0B 5DJYB 1WUNT 1NFDE 2BNQB 2XG4A 5CGMA 2Y7QA 4V1DB 4P0DA 2WC7A 3J2PA 4MA1B 1T5WA 1V55B 3RWIA 2QQNL 4JO2H 4MNGA 3UTTD 2R2HB 1GTNA 3STZA 2CDFA 3MQIA 1N4XH 3PAZA 4A63A 4AXWB 2XVGA 4Y5YA 5BRPA 1T2QH 5D0OD 1EHAA 4YMPA 3FULA 2O4EA 2P5ED 2FJFA 4HIXH 1UZ6F 4APQC 4MHHG 3FT0A 2YRLA 3WJMA 3I9GL 1DL7H 1P6FA 1U41A 2DMCA 3CVWA 1RXLA 3U9WA 1WLHA 2EUWA 3KDMA 1MCFA 4AEZC 3M46A 3OLIA 2JCCA 2AJVL 5D2MC 1KCKA 4Z7NF 3ZUNC 3AS8A 1QLFA 4P2OC 1G5AA 3S7DA 3W0WE 1JFQH 3IFPA 5EORH 5F3BA 1KL6A 1KTOA 2ERJC 2X9WA 4IEFB 4LFHD 4AYSA 3EIMA 3MJ9A 5D96B 5AW6B 5LKNA 1X7TA 3MODL 1HL4A 1QF2A 3MNZB 3NEOA 5F0MB 3ZYIA 5HHVL 5BRZB 3LKNA 3VSVA 2OQJA 4UDTA 1L9SA 3LRKA 5ANLA 1SZAA 2XACC 5BXOA 3B6SB 1NJ9B 5AQAA 2JCCF 1TEGA 3LS5L 3GBLA 1DUZB 1KLXA 2K3HA 4OF3A 1I1YB 1BQBA 1MPAL 1NAKL 1IGTA 3MRDB 3OAYK 5CHNA 5ALBH 3UC2A 5AWNH 2C9RA 3NJIA 4NFDA 3SGDH 2NNCA 5D72L 2R0LH 3VXMB 5CEZH 3LNHA 5F7EH 1JD7A 2J3SA 1FZOA 3FYEB 1YNTB 4KV5F 4U2ZA 1B4JH 4I0PB 3B43A 3DXKG 1MCKA 3FTVA 1XH1A 4ILDA 5HYJA 5I71B 2RH0A 5E2VL 2WLIA 3PS6A 1RPUA 2Z93A 1T7VA 3HBZA 5B39B 1RUKH 3AUWB 4OOEA 3VXSE 4PM1A 2MCAA 3ELQA 5IMLB 1J9TA 4YBLC 5G4OA 1TJHH 3LKSA 3ANLA 2GUOA 1QSFE 5FYKL 5FYJH 1EO8H 3RURA 5E4OA 3DTDA 4DUIA 3EBHA 2OMWA 4EOWL 1WWBX 1INDL 1D5BB 4OFKA 2KLSA 1RJZA 1QEXA 3BPLB 4YHNB 3BKCL 3BW9A 3ANNA 1W15A 4BRVA 4WEEA 1N0QA 1FFOB 2HAZA 5LCVA 2EVIA 4K9EH 2JK5A 4RFNB 2VGXB 3PUJA 4YOKA 3LKQB 3KCPA 2Z64C 3IDNA 3MV7D 5F2FA 4M4PA 4R2GD 4WO4C 3FMGL 1TFHA 3RY6A 1EXGA 5EYLA 2J57A 1IE5A 1J0ZA 4DGVL 4OZIE 4DRXE 2QVKA 4E41B 2ICES 1OP5K 4NWTH 5KSBA 3SGEH 2Q7AA 2QZ5A 3FB5B 4YFEA 5A3YA 3RKDD 4BSWB 5CZXC 1ZDQA 1JDCA 4UMGA 4WWKD 3TIEB 1A7NH 8FABB 2IDTA 3IDGB 5ETUB 2UYLB 3A6OA 3EOAA 5CXPA 4HIEA 3CX2A 4JN2B 1XGYL 1RV6X 2AJAA 4K2UL 4DESA 3A23A 3TEXA 1S7XA 3QH3A 1NPUA 2NUPB 5E08L 4RAUA 5EN3A 2WVUA 4H8HA 4BDVB 4BGDA 5KYYB 1DJSA 5GRYA 4HJSA 2K9FB 5CF3A 4XXDA 3SE3C 2WJ5A 4ZFFB 5KYWB 4HOUA 4X6BA 1ZTMA 3GSNB 3NCXA 3V0WH 2YD1A 3FB7B 5L2KB 3W5MA 4ZK8A 3KJ4B 3QZWA 4NRXA 4GUCA 4RMVA 3TP4A 5JHLA 4JFUA 4N22A 1M1SA 1JZGA 2HFGH 3S3JA 3P7SE 4MMZA 4BE5A 2G4ZA 5AUMA 1S5HB 4FZ8L 1ZHKA 3PGFL 3AT9A 4N2IA 5C09A 2R27A 5C0DA 4YDJA 3ES6A 3CQGB 3VLDA 1FNEA 3KW7A 4FOMA 4S1QL 4U0SA 1NGZA 2XRAH 5D93B 3VG9C 5J57B 4DTGH 4L3AA 5FA4A 2GIYA 5K5YA 1BQHB 2OJZL 1QFHA 4Y2DB 2UY1A 5E6IB 2YA1A 4WTZA 1L9QA 3EZ8A 3MRLB 5HGAA 4ODWA 2QKSA 1EHXA 1YEEL 3KHOA 2YC1B 2WYIA 4R0LA 3MRFB 4OFYA 3DV6B 4HPOH 4JO8A 4N5ED 4R9HA 3QEHB 5AJLA 3LQAL 3QG6B 1KT1A 2CAKA 2WB7A 4J8YA 2WZ6A 1RQ5A 2YUVA 1HEJC 1RMFH 1GC1L 1KY7A 3MV8A 5MEPA 1WGVA 1HKLH 1NBZB 4UOW1 3GI9L 2G4GA 1T2XA 1UB5B 1OWPA 3LQZB 4ZMWA 1IEAB 1G84A 1OTSD 4BKSC 4FJ6A 4YPJA 4LKCA 4NKOA 2AZUA 1SJEB 3L5XL 4U1JB 5CP7B 4HWBH 4LG6A 1FYTA 2BOBA 4PRAB 3T5VA 1J1OH 1N0XL 5JW3L 5JOPE 5LXGH 1QQDB 5DR5L 3UTSB 2MH4A 1BQRA 1EEZA 2ZJSL 2EDDA 3N1GC 5CN2A 3QQ3A 2KERA 4OF8A 1GYWA 3LRSB 1DP0A 3BP4A 2VXTH 5C6TL 3O45B 3TEUA 4E6HA 4ACTA 1KEIA 2AI0H 4Y16B 2NW2B 5LGKA 1BPOA 1Z32X 2WNXA 4RMUA 3FSAA 4JFXA 1QBML 1PSKL 4E9TA 2AWIA 5E9DD 4JANB 1F5WA 4YHZH 5BT1A 4PJBB 1RZGA 3ERXA 6FABH 3IFNH 4CC0A 4NC0B 2WMPA 4RDQG 3V0HA 4AY0A 4BESA 3GRWH 3L9BA 3L3GB 2B39A 2YPVH 3D25A 3FN3A 3C6SA 3MUHL 5AAPA 3Q8CA 2R39A 3DJ9A 2BOCA 3PWUB 4Y9CA 3VFWA 3VFGL 1A65A 1NLDH 5L4IA 3K6FA 3S5ZA 4X6EA 1HCVA 4YFLF 5DWPA 1KWKA 3IF1A 3N0PB 1YNLL 4P4KA 5D4IA 5CJXA 2FUTA 3ZYMA 3QDNA 1GZQA 1U8JA 2KMWA 4X5WA 3M86A 5CZVH 3ZR6A 2LVCA 4G80A 2AJZB 4JDVA 5EUOA 4N2NA 1I1FB 3FEYA 2YS4A 3VXUA 4QRRD 3BLKA 5JA4D 4Z6AT 2KBGA 3ESPA 2RQ8A 3D0VB 1JN6B 4QHLB 5DUBA 3B9KC 3LN5A 4XH2B 5E0QA 3CCHA 3MUGB 1I1AC 3O4OB 3FUIA 4HBCL 5GS1A 1RZJL 5D7LE 4JZOB 3QCUH 3DGCR 1ZWIA 1YSOA 2IH1A 2XWEA 2QPFA 3BYTA 2E3VA 1R17A 3CVYA 1T20B 4BSVA 2CKBL 5EUOF 4LASH 2RFXA 5DZJA 2OP4L 2FEDD 2CA4A 4XN8A 2B4CC 5C08D 4JHWH 4A7GA 1J88A 2C82A 1UEYA 2Z7WA 3SODB 1RY7B 5HGDB 4XVSL 2GBTA 4I9CA 5CCLA 1HIML 1QG3A 2QR0B 3K80A 1NI1A 2VSMB 3QNYB 2GI7A 3DHMA 3CK9A 5ESVB 5AW0B 2HO1A 1NAML 1F90H 1MVUB 1UD4A 4AI7A 3GO1H 5HVWA 5J7CC 3ILEA 1F4AA 1MF2L 1WBZA 3SQOH 4GEJA 3EOTL 4LIQL 4PD4J 3U30B 1L9OA 1P4LA 4UQCA 1IQDA 1M2OA 3F7RA 4JFZH 1KPSB 3OG6B 2Q5BA 3RJQB 4A7GF 4D0CA 2A9AA 4KMOA 1V3JA 5FOJA 3OAZK 4DP0X 2IVFC 4GAFB 4HRNA 1DEDA 2V5YA 1PFOA 3ASWA 2RG8A 1KGCE 4NUJB 5I76B 5IKCB 4ZS7L 1H15A 3TV8A 1QPXA 4KDTA 4GZ5A 1ADQA 4HLZH 3AWFA 3D3VA 1MNNA 4L1HA 2D7TL 5F7UA 4QNPE 1A4KA 3WXWH 1S78D 4J4PC 1Q9WA 2IOMA 2DM7A 3RJDA 2I24N 3FCSA 5F88A 3C5RA 4MJ6B 5EDSA 2F8IA 1FZKA 4A6YA 4HJJH 1R3JB 4U3XA 4YSRA 1CD0A 2XKSA 4NKIL 2YMXH 2VDLH 3QIBB 2CPCA 5AEAA 4L1BA 5J13C 3FV4A 3UPRA 5F6HI 5AW8B 1AD9A 5C0RH 3EGDB 4F58H 3HW7A 1QR1A 4DPRA 1BD2D 1RLWA 5E0FA 3Q7AA 3L3IA 4MA8L 4L8BB 1ZGLP 2BNRA 1G0DA 1P5VA 1DC2A 4PJ9A 3FO0L 4MJHA 5HGGS 4ELKB 1PF3A 5A2FA 1ODUA 4JFWA 5DC2A 3VNZA 4G1EA 4PU2A 2VDOB 3RRNB 4AM0A 1P1ZB 3NSYA 4OF5A 4OUUA 4UZGA 1OAYL 2QDVA 4NNPL 3WTUA 1FVHA 4MMXB 3S3BB 3BWUC 3NDZE 2IQCA 1SY6H 4WFHE 1N6QL 1MRDL 1T22A 1M7IA 4BQBA 5EIBE 3RIAK 4CADA 3U7WL 1JZ7A 5DMGD 4KKQA 1OAQH 2FO1A 2OSLB 3CHRA 3ZKQD 2OMUB 4YS4A 1KT2B 3IS1X 3OGCA 3QUKA 1CQKA 2DOCA 4LU5L 3FFLA 5H37A 5G04J 4J3OG 4J28A 4BFKA 4AGQA 1S7TA 3ILQC 4XP9L 4ZPTA 4TXVB 2Q7FA 3UOAB 4ZMPA 2IG2L 3UP6A 3G08B 1MW0A 4Q69A 1YC7A 2R1WA 4AV5A 2L7EA 2K7QA 1CLYL 2CIIB 3DLQR 5E1IA 1URLA 4JUTA 4C55A 5SWSA 5HHQB 5GZND 4M1DH 1U2CA 1I9JH 4AYFB 3MZLB 3IHYA 2FZ3B 4GRMA 1Z9GE 2EH8L 2XZTG 4L1TA 2C3VB 2PZIA 1VADA 5FA3B 3VVWA 1Z3GL 2NX5E 2VDKH 3B7BA 3DXAE 4Y4HB 4H0GA 3S37H 3T4AB 3ULSB 1J9QA 3RL1B 4PJ5E 4EEEA 4XNAA 3QAZC 2JKXA 2ICWJ 3IFOA 5HNHA 1N6UA 2ILRA 3MSFA 4KZCA 5IQMA 4QXTA 4NENB 3TWWA 1ZDSA 3PE3A 4BWRA 4LLQA 4J3OD 3ULUF 3PWNB 5GS0H 3B9VA 1TQUA 4F93B 4KKPA 5AB1A 2BVOB 4HOSA 3QJQB 4FI6A 1SZ9A 2CLVA 1BQKA 2V2XA 4WKZB 4MXQC 1X5AA 4U1MA 4HG4J 3P11H 1N4XL 3IETA 2FR4B 1TZAA 4IJTA 3VXOA 4HSCX 4G9FA 1MIML 1T2QL 3O6FB 5E76A 3UBXA 1C5DB 5JIKA 5HGBA 4F6RD 4HIXL 4HIJA 4XO8A 1K2DA 2ETBA 2VE6A 2HX8A 4H8WL 1J11A 1G9MH 4GA1A 3IDXL 2WBJD 4XEIG 4RRPG 1RZ4A 4ONFL 4UT6L 5D1XC 1RURH 4JZJC 1QNIA 2FX8H 5IW1B 4CW1A 1SN0A 4O2CB 2J8UA 3GJFA 3OPUA 4JREB 4TVPE 1Z3YA 5AZUA 4H5SA 3GB7A 5EORL 4UIMA 4LNGA 4KGJA 2VL5B 4JA7A 4DGYH 1E9QB 3MKGA 2YOCA 3OKDB 3RIFF 2YD8A 3PWPA 4N2MA 3SKOA 5C0BA 4DKDC 5A43C 4Y6PA 3Q3GB 5DHVB 3HAEG 2DB8A 3HA0A 4EI5A 2DCPA 5IVNA 2AVGA 3BN3B 2J8UF 1GAFL 4BZ2L 4N26A 4B96A 5D2LA 3H3KA 1TYQG 5JMRA 1FPTL 4NQWA 2AAVA 4ZSOB 1MRFH 1SQ2N 3A24A 1KEGL 1NPCA 4D9WA 1TN6A 4N39A 2VH5H 1RJCA 4QRAA 1TMNE 3VWKC 5JZ7C 1E4XL 3ABLE 5JQHC 1HDMA 2DIEA 3CSGA 1YY8A 1B4JL 1KNOB 4OM0H 2VXSL 2I07A 4L4VE 3RRUA 1XR8A 4XP1H 3BP7B 5D2LF 3RI5F 3OJVC 3V2XA 3UEZA 1EBAA 1U2HA 4HC1H 3UTZA 5FYJL 1HNGA 1LNCE 3UM2A 1EO8L 1NEUA 2PF6A 1A4CA 5DK2A 3DWLG 4GB9A 4M7ZB 1IBGH 1OD7A 4ZAKA 4L37A 2FSEA 4W9EC 5SWZE 3DIFB 2ENJA 1N8ZB 2AQQA 1ZSDA 4PYGA 2IQ9L 4FQ1H 3A47A 2VDPH 2P9PG 4F91B 1LQSR 3SE4C 2OULB 4QRPE 1X9LA 3PREA 2G2PA 4I48B 3U48A 3TNNA 2VSXE 3DVNA 3KEAA 1WK0A 4K9EL 1ZS8B 4N2OA 5LBGA 4NNXA 3U36A 1H6FA 4RX4D 1VEOA 2J1KA 2JTDA 2R1YB 3HNTL 3INOA 4Z78A 4JFEE 4EPSA 1UA7A 3BLPX 3FTYA 3EO0B 2O61A 1AD0A 5DEGA 2ZICA 1LO5A 2ZXBA 3GIVA 3MBXH 4PRHE 3DBKA 3KCWA 5KSAA 2R70A 5LNGA 2MIZA 3G9AB 1PL3A 1FLTX 3C60A 4QY8B 4IRSA 3IMUA 4KQ3H 4HUWA 4Q9QH 4UINH 1OGTB 3KM1A 3UL4A 1YG9A 2AQSA 3NAWA 2DLTA 4OCWH 1YN6A 3DRTB 4X6CA 3WQQA 5IEHB 5JJ7A 3T6WA 5DHYB 4G8GA 4JY6B 2KT6A 5E99L 3DSNA 5IJKC 4N2FA 3UX4A 4ZTEA 2NCEA 4JFFA 5B1BE 1CFTA 1Z6TA 3ONLA 1UB6A 1NAMB 4F3VA 4TUOB 4DK5A 5IQ7L 5IUCA 2EEXA 3EJRA 1PYWA 1IBYA 2HFGL 4OD2B 1BZOA 1GGCL 3DURA 1JNHA 4X6CF 3ZOAA 2I6HA 1A9BA 4YDIH 4ONGH 2VN5A 3F2LA 4P57B 1L7TH 1MIEH 4TQ8A 5I28A 2CHNA 5L6YH 3MRIA 5C9JA 4JO1H 4DTGL 2N01B 2EKSA 4BZ1A 3MRHB 5LBSA 4NHUB 1J8HB 1MFNA 2NY4B 3REVA 3D4GA 5DURD 1FT1A 1MEXH 1YEGH 3MLZH 4AGMA 4KXZI 4DPBX 2QV4A 2JCXA 4LLMA 4RSVA 4ODTH 4XPFH 1THAA 1S9KC 1X6NA 1FL5B 2WZAA 3GLAA 3NZUA 4HPOL 4O4YH 2X9ZA 1A5EA 1B9KA 5IESL 3CFKA 2BVPA 4Y19A 3X1GA 3L7FB 2A5EA 2TRYA 4JW1A 5FM8A 2IANB 3PXLA 2P8LA 2OEVA 1CURA 3L4ZA 1DEEA 2EXWC 3SY2A 1MCRA 3QT2A 4APFA 2V7HB 4K94C 2DS4A 3JWNG 3S5LG 4KZEH 1FYHB 2XHEA 2X3AA 5CD5C 5AIJA 3V4PL 5FSSA 1LEGB 5IR1A 1O9VA 2XYBA 1HXIA 2LAIA 1OCZB 4XX5A 1RIUL 1WAAA 3CZFB 3DUSB 3QKYA 3EJPA 3HNSH 4HPYH 4IS6B 2F7RA 2NXYC 4N87A 2A5UA 5KS9B 1J1OL 1UW4B 2N4IA 4AH2B 3PG2A 2EYRA 1R4XA 4WDIB 5F1SA 5TDNB 5AENA 4DNLA 5CM1A 5DSCB 5FPIA 3OD3A 1EMTH 2VLRE 5E94B 5LB1A 1XGTA 1JGLL 3WXVH 5J9PA 5IT2H 1G7IB 1LNUB 3GNMH 1BEYL 4DX5D 3V2OA 2FCBA 4P9HC 3B2PA 1AP2A 3LEVL 2MQ3A 3VX1A 1MCWM 1JDDA 2MHAA 4NACA 2H26A 1HHKA 2ZAIA 2VXTL 1WAAF 2WWMD 1JWFA 3INUH 2B3IA 2Z91B 1MWAL 3F6IA 3PUUA 4PY8J 1I3VA 1AZVA 4R6UA 1S0PA 5E1HB 2K4WA 4N86A 3RLSA 3QEQB 5E6YA 2Y1FA 4WK0B 4YPGA 2XTLA 4J2XA 3HFMH 2IDQA 3BC9A 3HFFA 1HHHA 3LRGA 5DFAA 4LLVB 4C56A 2WYHA 3VH8A 3F28A 3FPXA 3GRWL 3N55A 4FRWA 3VFRB 3S6CA 4IDJH 4F57H 1MHCB 3B5HA 1CR9H 4X4KA 5DEFB 5AD0B 4ES9A 2CLZA 4M6OH 5I17A 4R3SB 1KBGH 1NM9A 4KK5C 4K71C 4Q74A 1XQ4A 5FIOA 1YHPA 1NL4A 6CGTA 5C0FA 3QULB 4PCSA 1WC7B 3P77B 1QI5A 1LO0H 4Y4FD 3GUTB 3O6LH 4HFUL 3ULVE 5CZVL 5ISZB 4M93C 2DYPB 5AW1B 2B61A 4GOSA 4AJWA 1HH8A 3VDAA 1BVOA 5DC0A 4FMKA 2I9TB 4PJ8A 1OAZH 1HHGA 4R90H 3IWUA 3ECVA 2X6UA 1BZ7A 3VE0B 4DK3A 1GVIA 3LN4B 4JHRA 1TQWA 3UCRA 4ESKA 3QWOA 3FB0A 3GXNA 4ZO9A 4MJIE 3L8QA 1SUHA 3O3EB 3QFJD 2GCYB 3RKDC 4YGAB 5FAAA 3QCUL 2YUXA 4YWGL 2X1XR 3MKQA 5CWSA 1F8TL 4O6FA 4KKLD 3WLBB 5KUKA 1WT5C 3TA3B 5AVWB 3H9SA 3ILPA 4WHDA 4ELDA 2QQLL 2JMRA 3FTGB 1VFAA 1KB9J 3DGDA 3FOMB 4LEEA 1BBJB 4KK9D 2E9BA 2ZP8A 2ZPKH 4LAQH 3V0DA 5H4YA 3ZE2B 2O5ZL 4OZHA 3P7VE 2EDHA 1FJOA 4KXBA 1KB5A 4L8DB 3EO1B 3I2CL 3EZJB 4AUJA 2E76C 1QQEA 1F90L 3HRZB 3O4ZA 2IPKB 3VA2C 4G8EB 1TVHB 5ARGA 1I85C 3PNWB 4R96B 1JIBA 1HEHC 5CO1A 4G23A 4JY4A 1EGJL 4BFEA 3CDYA 1H0DA 3ZI0A 3TPUB 2DJSA 4DN3L 1A3RH 1E6OH 2GABA 1MFBL 5A3IC 4NQDB 1TTBA 1S5IH 4OZHF 1GKEA 4LAJH 3VCLA 5BZXA 2X2UA 2YBRA 3QI9C 1RUQH 3EH4B 2C26A 2Z7YA 1OCCE 4PJ7E 3ESMA 4N5EC 4WWPA 1HINL 3ARBB 3NPSB 5ID1A 1SFDA 5D8JH 1JZ4A 1RJLA 3UI2A 1AKJD 3WXWL 1N0LB 4Y1AD 1P4BH 2VNCA 2R15A 1XZ0A 4LBEA 1E42A 4NOBA 4P46A 4KKRA 5IW3A 3EGXB 2J88H 4XN1A 1URIA 3RY4A 1FNFA 1JHKH 4IOFD 1OTSC 2AK4E 4M5YL 1E4KA 2Z31D 2VM3A 1RCYA 2ESVD 2VDLL 2VDRL 1CTMA 4JGJA 1U8HB 5MERA 2J08A 4WEBL 1A1MA 3HG0A 1OSYA 2R0WL 3EOBB 1AVAA 4LEOA 2MKLC 4B7LA 5BUAA 5JXNE 1IBHA 5DZPA 1HILB 5CUSH 2C4FU 4Q4EA 5E7FA 1KJMA 1RI8A 2F53D 2CWRA 2NYYD 3DX6A 2Q7YA 1GOGA 5KANI 1FGNL 1JYWA 2QY7A 2NXZD 2RA1A 4HETA 4QO1A 4L8SB 5EO1B 2FVNA 1P6AB 3BKYL 1MFAL 4XNZC 3FAXA 5J1AA 1ZTXL 1CL7I 4U31A 5IY5B 3PL6C 3SIKA 2P8MB 5CLWA 3MRGB 3N42B 4MDJB 5DQ9B 2GHZA 1D6VH 1AGCB 1PBYA 1LHZA 4I88A 5IF0B 4AWJC 5IQNA 2GJ6E 1OM9A 3P4NB 5T1LA 4Q6YA 2Q20A 3WHXB 4CDNA 1A8ZA 1A47A 3D9AH 3C6LC 1CD1A 3TVMA 2XZCH 4PRIE 2C9XA 3N1PC 4YLQT 4DX1A 5TDOB 3FFCE 1J12A 2CUAA 2F9BT 5IQ9A 1U8MA 4GP4B 1UGKA 1H3TA 2HX7A 4F7PB 4F7EB 1COBA 1UFGA 3OLDA 5F9AC 2XU9A 2HUEA 3QDJD 2IQAB 1ZHNB 4QRSB 4TLNA 1Q0EA 1RIVH 2XGMA 3C5XA 4HV8B 4DF9A 5CN3A 2EDOA 2E75C 2FX7H 3FSWA 4ZD3H 1G7HA 3RPIA 5JPNC 2DI7A 4LMQI 4OAWA 4ADGA 3ARFD 3ZKND 1E6JL 2ZQKA 5AB2A 1YO4A 5IOPA 2QKIB 3MV2B 2VDKL 4HWNA 5I16B 3KMDA 3S37L 3E3QE 4G6KL 5MHSD 4F2EA 2GBAA 3SDDA 12E8L 4UIKH 5L41E 1JGDB 1IGCL 2L6JA 1AGEB 1KEMH 3PHSA 1M4KA 3QIWB 3SGJC 3MR9B 2WBKA 4I18B 1JGUH 3SBTB 4WHTA 4Q9CA 1YYHA 4KXZH 4PRDB 3Q78A 2NY1C 2FEDC 3SFZA 3CX5K 3MRKB 3K6SB 2HG5B 1Z9OA 4Y5VB 5GS0L 3SDCB 1YLBB 3MRMB 5DZNA 5IMKA 5LGHH 3W56A 1I9IL 5HHMD 3L4TA 5HJ3B 2CDGA 2NR6C 2XZAL 5BS0A 1ELRA 1VFMA 3PQYB 2G3XA 4R7LA 3CDCA 5L2JA 4RGNE 2ADGA 3A5VA 2F54A 3EYVB 4IRJD 4BFNA 4FTVA 1JXJA 4Y67A 5AKSA 3SZ7A 2GAZA 1MJ7L 4HS2A 4UBDD 4Y8AA 2PO6A 3PFUA 3JUYA 5IBLC 3MSPA 2GT9A 3SPVB 1KIPA 3LHAA 5LNEA 4X8QA 3ELAT 1BLNB 5L88L 4LVHC 3LHPL 3MHZA 5JMOC 2FX8L 2JKWA 3UTTB 1T1YB 3D9LA 2FNWA 4AIZA 1SLVA 5DD6A 4W9FC 5GGTL 3TGXA 4HLLA 3SPIA 2P5EB 1WTLA 4LK4A 4ISVA 4JM4L 5I6LA 3LKRB 4W6XB 1UJKA 4P2RB 2BSSB 1TZOA 3QQ4B 3RZWA 1ZGLA 3VW3L 2EDNA 4GIAA 3WDIA 4PRPA 4HXAH 4TUKH 2AV7B 2IGFL 3UGEA 3VRIB 5ICYB 4TXQA 4JPKH 5ACZB 5C97A 3HB3B 4YHKH 4JEHA 3DA0A 4PJAB 1UC6A 3HXCA 1QFWM 4F7CA 3F6LA 3FT9A 1GIGL 4HJUA 1EIBA 5B7FA 5LVEA 2YPKB 3VUAA 3ALPA 4FQCH 2R51A 4DP1X 1ZGLM 3J5QB 1XGPB 3QZPA 5AAWA 2XWTA 4C83A 1DFBL 3AS0A 1FG2A 3MNVB 2XGOA 4IGBA 4OLUL 3D9OA 4QF1B 3LVEA 3QWQB 5C07B 3WJLA 5D1QA 32C2B 1CGXA 2L8AA 5AL8A 4Z7WB 5KVMC 4OM0L 1AWCB 2LE9A 3KHQA 4PS8A 1K5NA 1FIGH 1WS8A 4Z3HA 3E2HB 1IAKA 1HF8A 4NKQB 4NUGH 2JFCA 4GEIA 4LBAA 3MNDA 4UOJA 3CK8A 1NCOA 1XB8A 1MWAB 1FDLL 1H9DA 2H0PA 4OJFH 3OR6A 3ARDC 4JPIA 4U6XA 5FKAA 2HJFA 3OXRB 4HS8H 4GYYA 1WFIA 4UZUA 5JTWA 1AS8A 2L0TB 1F56A 3D6GA 4FXKC 3SHSA 4FXGC 3FXIC 3L1FA 4TNVF 1DSFH 3EDFA 3PWVB 4LSRH 4E68A 1PCXA 5A40E 4KRPC 1NCWH 3DX7A 1Q1JL 5C3TA 4N2GA 3NB2A 3V7AG 5BNXD 3PUCA 4GO8A 3QZBA 4OIIL 5JR1L 5EKQD 3LVTA 3LPOA 4C54A 4EZLA 1CGYA 1JI1A 2Y0SA 2Q0ZX 5F7KC 3US0A 1UN8A 3BIKA 4JEGB 5GHWH 4C4UA 3QJUB 5GGVH 4HUMB 4I85A 3O11A 3FTXA 4U3SB 3JXAA 5I0VA 2XFGB 3S96B 5FCSH 4B9IA 5D2NE 3NTCL 3NYKA 3OR7B 1DBBH 4DETA 1GPOH 1RW2A 3R0NA 3MNWA 4PJFE 5CN1A 5GGRY 1XSIA 2Y07H 4UWQB 2AJUL 1NGQH 1XF3A 4WI4A 1W8OA 3ZYJA 2ZOLB 2BS8A 5AZEL 2EDKA 4FLRA 2W07A 4Q6KA 1O6TA 3R19A 5DWUH 3KXFA 5TQ0H 3T6VA 4BBWA 1QRND 1FNGA 1KYOK 3T0EC 2FJSA 3A67H 4R4ND 3O0LA 1DBKL 1FSKB 3LNGA 2B8OT 3CVVA 3BX7C 2K70A 3BVXA 4ZQHA 5ICXB 1Z66A 3ABME 4AEFA 5EBGA 4RDBA 4ZUUA 5JS3E 1SF3A 4IRZH 1HG2A 1EAJA 4TNEA 4NM8L 4K4KA 1I31A 3VGDA 3R0MA 2ZX7A 1DVPA 1SVXA 2UX6A 3O41A 4X0NA 1OB0A 1SW6A 1O5MA 2GEEA 3D69B 1TZHB 5AVTB 5JIDA 3QFDB 5ESAB 3CMOL 4GSDH 5AL0A 1AXTH 4TVUA 4ZFZB 4GUPA 3ROLA 3Q1SL 5JHDA 1NKOA 4GTRA 1O0VA 5DT1L 4HIHA 1FLRH 4GRWH 4JO1L 5LBVA 4RFNC 2DWTA 3HZMB 2FJUB 3FCTA 3MLZL 4KK8D 1YEGL 3QJHB 4U1KA 2Q6WB 3OVUB 3FWVA 1JPEA 3WKMH 6PCYA 3OPZL 1JK9A 3EJNA 2Z92B 1NUFA 3NF1A 2FECI 3LEXA 3ZDYF 4I3SH 4YNYB 5EZOH 2DYSE 1QTPA 3LY6A 5DPEE 1FNHA 5TE4H 1EJ6A 4JO4H 5I24A 1TTAA 4X4ME 3T87A 2V9UA 1ZHLB 3I6GB 5C0CD 2FJGB 2QFRA 5CECB 3S7JA 4PREA 4LSTH 2OXHB 1U33A 1J9CT 1UM4H 5GJSL 4KZEL 1QBLL 3VI4E 3V5KA 2R56L 2GC7C 4ZMZA 3U25A 2CFUA 2VDLB 2VDRB 4OBRA 3P9LA 5DC9B 3IFLH 3MUUA 4A37A 1TJMA 4RQQA 1SXAA 2ZF9A 2D7PA 2CLRA 5CIPA 4A1RA 4ODVH 2ZGDA 3V79C 3S35X 1R24B 3F7PC 1A6ZB 5F6HJ 3DX8B 5DJDB 1E5AA 3VG0L 4FX5A 1FO0A 2H32H 3UT8A 3GNML 4WEMB 3KW8A 1B4RA 3I4RB 4JCMA 3BT2H 4HOWA 4HRLA 4YHOH 4IU2A 5HI4D 2PTTA 4OZGA 3G2SA 3LSOB 4XNMA 2NY0D 3BZEA 5E5MA 2OCCE 4OD1L 3DMMC 5HJBA 3KPSB 4NS0A 4GT7A 1T89C 1FFNA 2XQ0A 2PETA 5AVVB 5JXEC 4NC1C 2P80D 4M5SA 1MFDH 2X4RA 4HQQH 3GI8H 4XPGH 3L17A 2IADA 1JVLA 4X7TA 3JTTA 1X7QB 2YQGA 4FS0A 3SCMD 3H4HA 3T3ME 4F2FA 5HVGB 1OGPA 1G0YR 1XWVA 4OZGF 3ZR5A 4D3CH 4ETQA 1UFUA 4O5LH 5GGVY 1M3IA 3CXDH 1J5OH 4ATTA 1JVSA 3B7UX 3WL9B 1CE6A 3UJIH 4F57L 1JV2A 1M9WA 4MNQB 3V0FA 1MY5A 4M6OL 1INQB 5BV1A 3DX9B 4R97C 1OARH 4UV4L 3FBOA 2IBZY 1KC5H 4XMKH 1F1AA 5FO9A 4OZ4A 4KDWA 2ITFA 1EEYB 3D2UB 3RA7L 4BZYA 5I0XA 2F6AA 1JL8A 2OMYB 3T2PA 3K4DA 2JV7A 1ZHBB 2EXTA 1KG0B 2UZXA 2X28A 3P3SA 4DKAA 4OTXH 3C8HA 3ZO9A 2PYEA 1YEWA 3JYSA 1M2VB 1OAZL 2JTYA 3GDCA 1AZBA 4R90L 4ZX5A 2VDKB 5E7BA 5AKVA 2JI1A 2XX0A 2R5SA 3P1VA 4TUJA 1GGBL 4PJEA 2VXVH 3LZFH 4E42B 3PP4H 1FBIH 3CDFA 1S70B 3QNKA 3WG7B 1AJ7H 2LGNA 2JD0A 2EDQA 1DCLA 4WHYH 3B37A 2W92A 4OJYA 4PJHB 4O58H 1FC1A 2BSEA 5JO0A 4EECA 1MI5D 4QRRB 2WQVA 4P2OA 4EAEA 5IMOB 4QTHA 3HE6C 3QDMD 4U04A 4R83A 3G5VB 3K71B 2KZWA 1JZEA 3GFUA 5L8PE 4IMKA 4NO2A 4KI1A 1MCIA 3G7TA 2WANA 3W9EA 3WS3A 3SDXA 2APXA 4DEUA 1AQKH 1CE1H 2D2CC 5DYFA 3TN0B 2F7QA 4G1MA 3FDWA 3M1BA 2ARJB 4XNYH 5HDQH 2NXPA 4FG4A 3T1FB 4IHQA 2W0LA 4ANXA 1RZKC 4KZDH 2NLJB 4EKJA 4LVNB 2JKTM 3Q4AB 3NA4A 3UTOA 1A3RL 3APCA 3VJ6B 4FNRA 1U3YA 5F7YC 5L9DL 1ZLSL 2HYMA 1TZGL 1SC5A 5KEZA 5EC1A 1RUQL 5JMND 4JRYA 1H5BC 5F3HB 4YHIA 2YD4A 3FCBA 4PWKA 4R7DA 4ZUWA 3SDXF 3VI3E 2QTEA 4M8VA 5EC2B 1KLUB 3D85A 3TONA 3OHMB 5K93A 3QPQC 3HHMA 3PXJA 4NRYB 1FL6A 4JPWL 5F9OH 5I23A 3S97C 2PP8A 5LO7A 4CNIB 1P4BL 1KJVA 4ATGA 2XTJD 3CN1A 4N0UE 1CI5A 4OLVH 5EU7C 5EO0A 5EIDA 3T8HA 3AU0A 2C5ZA 4XCEB 5CSZA 3TIDA 3F6QA 4OGYH 3U2IA 1IQWL 3JCKC 2KDYA 2EE0A 3AMLA 2DTML 2H2SC 3CQPA 3RX8A 1B90A 1I1RA 1F58H 1HQ4A 2P5WD 1PEZA 2IU1A 2ZP9A 3LKOB 3MROB 4ZYKA 5IP4A 3WNOA 3US9A 3OKLA 2X0UA 4WI3A 2CK0H 4AIFA 3UM1A 2I5YH 1U21A 1OO2A 3L4UA 5HHOA 3PWLB 1UKTA 2W65A 5DD0L 4LCUA 4P2QE 4PV9A 2BWQA 1H2UA 4WO4A 4W9DC 3HOGA 2ATPA 3O9WC 5KJRH 4X5QA 1CDYA 2VXQL 3L4YA 1A25A 3Q1EA 1Q9OB 5HYQB 2OL3L 2O6CA 4L8CA 3U0TB 4IBQA 3ABKE 1OCRB 3KPRB 2R1XA 1R19A 4BH7B 1A02N 4I3RL 2F8OA 1V10A 4RMQA 5JDSB 3JWNC 1T6VN 3VXTB 4M7CA 4AR8A 4K5PA 1T21A 4UNUA 3NCWA 1YEKL 4JG0H 4UDUA 1FVCA 1L9PA 1GJUA 2XZCL 3V52L 4KROB 4D7PA 5JPMC 4NNYA 1NPNA 2VERA 3JUIA 3HCVA 5E1GA 3SE3A 1R5IA 1LILA 2WLYA 2GSIA 2R2LA 1UUSA 2CBOA 1EPFA 1ZK5A 7FABL 4HMDA 1ILUA 1P9MA 4HT1L 4DOHE 3N40F 1EA9C 5AW4B 5E56A 5HBBA 1N67A 5SV3A 4K5NA 3TBTA 1YYLH 4G5ZH 3KS0H 3DO7A 2J25A 4Y5XB 2E0IA 4LB8A 4UU9A 2A73A 4NUMA 1O6SB 4I6GA 2QSCL 1F6FB 1VGKB 3WIFA 5I1JH 1ANUA 3WTTA 3HVEB 1Y8MA 4MKTA 3NEEA 2YNQA 4KUCF 1QSFB 2BP0A 4HEPG 4LPYA 3PIQA 2V4HC 1R1CA 3T0WA 1LE9A 4JKPH 1WA0X 4XI0A 3P9MB 1EERB 5I8CA 3GSRA 4MQ7B 1KJ2H 4MMXC 4K8RC 3TF4A 3OKKA 3FQWB 1P84K 3K8MA 1ID2A 4KK9C 3MV9E 3EJJX 4HBQA 1LEIA 2Z35B 3PYCA 4BYHA 4ANKA 1E5YA 3IJHA 4HJGB 1FPPA 1INEH 4AQEB 3HLAA 2UY6A 1IGYB 4TSBH 1JUQA 4CC4A 1KXQE 1OP3H 5T3ZD 2GTWB 4UM8A 1DVFD 3D18B 3Q06A 5F7LB 1SN2A 3ESLA 2CA3A 2DQFA 2SEBB 4XT1C 3FRPA 1XF2A 1HSAB 4G9DA 3DX4A 1HFAA 3IMVA 1J87A 2AQ2A 4TNWK 4HZLB 2BUGA 2CIKA 4Y2LA 1M57B 5E6UB 3VM7A 4JRWA 1YQVH 3EYOA 1K4CA 4YIQA 2DZEA 4QGTA 1V7NH 2DF3A 2OYLA 1G94A 3TTYA 3VFVA 2AXFB 1OXJA 4WNQB 5EEYA 1NPJA 5IEKA 5KJ7E 2HTKD 3ZDXB 3G5YB 1OW0C 4ZTOH 2MPVA 4MNHB 2ADYA 5C0IB 4BFIB 1CC3A 3T8XA 3O6KH 1KLFB 2B59B 4J6RH 4Q0XL 2F58H 3JXIA 4Y8DC 4Z77B 2Z7ZA 2KZKA 4X4ZA 2J73A 4LNRA 4KKBD 4DGUA 2YAHA 3QVAA 5DRZA 2Z31C 4Z7UA 4IBZA 4NQTA 5A16A 4LGRB 4DKEH 5C0ND 4CBPA 2NMSA 2PWDA 2GSMB 4ZFQA 4C0MA 1PKOA 1B88A 5JIQA 5DZVA 3Q9NC 1F4WL 2XV0A 4P2CG 2WMNA 5LAXB 4AEEA 1TXKA 3HC4L 1AOZA 2RALA 4JB9L 4AZ8B 2BNUB 3CVUA 1ZPLA 3FKUS 1M7DA 5JNYA 4NT6B 3JSZA 1KCUL 4JFDA 3FO1A 3FQUB 4HS8L 1OT8A 3E6HA 4GXFA 4B60A 4MZ2A 2CR6A 4EIZC 2APSA 3TTSA 3B9KA 5AN8A 3EJSA 2E2EA 1I1AA 2Y36L 3SSBA 3T8CA 1NCWL 4HJTA 3U9UB 1EHKB 4F8QA 3C75A 5F0JB 3CKCA 4L23A 1G4RA 5F9JA 4AQAA 2XV2A 5I1IH 1JCKA 4HX1A 4JFVA 5DUMH 4WI5A 5ETUA 3FRUA 3I75A 3ZIYA 5T3RA 2OCFD 2R4SL 2B9BA 1UENA 4ZUVB 1BFVH 4GU5A 2AXWA 3HAEB 4FQIL 1RHHB 1N52A 4DK6A 1WZKA 3RX9A 3QDGE 2AJ3A 1Z9SB 5GS2D 3KGUA 1SNRA 4XVJL 1DBBL 4KU1A 4NGHL 1BXUA 3B8YA 4NQCD 3NFSL 2WHVA 3FQRA 2XKNB 2IAMB 3NH7L 4CMHB 1NGQL 2WY3B 1JXGA 5I19L 3NQPA 2WUBH 3T8DA 2NPLX 2XN9A 3ARFC 3ZKNC 4L3EE 2A7BA 5T1JA 3CNKA 4F8LA 3VTYA 2L6BA 2BP8A 1HU8A 1NL0H 2EYSB 3QP3A 4MAZA 4WUYA 4F7AA 1D9KB 4PB9L 3RVTD 3W82A 2YEZA 4XI5C 5JQ6L 2LFEA 3PHOA 3MDJA 4LRNH 1QFPA 5FUZH 2DN7A 3CDGB 3GKZA 1S7WA 3FFDB 1U8NB 5JORA 2HB0A 3RY5A 3TBWA 2NYKA 4OF7A 3BAYA 4AM0Q 4AMKH 5K9KA 3DC0A 4FA6A 5EHFA 4J4PA 2X6HA 1H3WM 4M7ZC 2BHZA 1FV1B 5IVXB 4HCRL 4P59H 4UT7H 5IBUG 3MXVH 4PJXA 3G6DH 3KJ6L 1BIHA 1Z3RA 2PWHA 4TV3A 2APBA 3NMEA 3PABB 1BX2A 3QO1A 4JR9H 4XHJC 5D7IA 3EO9H 1NCCH 5ENWA 3ZE1F 4IRJC 4MJ5A 2ZT9C 1FLRL 5CRUA 3SBQA 3HI6L 1TEZA 4PW4A 1T5XB 3I50H 4M7JH 3GZ2A 3SEPA 3WY3A 5I66A 4F37F 5IB5B 1LP9E 2R0KL 2ZUYA 3GLEA 4KH2A 1G7QA 2MEJB 5BXFA 1S46A 1W72H 2BNRE 1ZBPA 4NX0A 5TH2A 5D7LB 4I3SL 4PJXF 1U4GA 6TLIA 2DM2A 1WBXB 2X6CA 1TYEB 5KJNA 4NI6A 4N25A 1BU9A 3DBXA 1V3KA 3EYSH 2F61A 4P5MB 1D5MB 1JHLL 1OB1B 5D7IF 3W9DB 4AVKA 2I7SA 5E8NA 1G9NC 1T5KA 1CICA 3Q9UC 4OM1H 3ZUCA 4LSTL 4OGZA 5DQDL 4BA0A 4Z18A 5E23A 3IJYB 3OZKA 4LSSL 2FBJH 4LXFA 1PG7H 2PMZA 2EEAA 4BK8A 3RUGA 5AVQB 5ADPH 2AQNA 3IFLL 4X6FA 1CIUA 3QYNA 1TVBB 2ENYA 5GISH 1YCSA 1JZJA 2CRYA 3V55A 3AS3A 5HYJD 1CJYA 4ODVL 5I8OH 4OKDA 3HUJE 2KZBA 3ZGIA 3V0VB 4A2MA 2YAQA 3DNKA 3FNKA 1ZS2A 3I4GA 1P7QB 5DUPH 2F19H 3BWUF 4ALAH 4O1OA 3N85L 3RUGF 1YRKA 3BGFB 3US1A 4M7KL 4K3JL 3P9WB 3W11D 1Q72H 1H6OA 3T5XA 2OL3B 4XP6L 3TYFA 1GYVA 5MI0B 2P24B 4NPJA 4X5RA 4HQQL 3B2VH 1Y0LA 1X5HA 4M3HA 1WPCA 3BH8A 4D3CL 1CVSC 3IJEB 3M45A 3APDA 3V31A 2I9LA 3JWOH 4MS6A 4O5LL 3IDIA 3OBAA 3CXDL 3MA9H 4YEFA 3WMSA 2FNBA 2VLJE 4WW2B 5DD1H 4OLEA 2WXMA 1NCAL 3EFDL 3ECUA 2IWKA 1ZVYA 4OW3A 4EF3A 3MLUH 3MLWH 1OARL 4FQXD 4KAQH 1KC5L 4EPZA 1GMEA 2IMMA 4JPVH 1EDHA 4LLWA 5JDJA 3C72A 3BQUD 2BSRB 3AACA 2WYZA 5E6RB 2E56A 1T4KA 5I1GH 3AB0B 4U8HA 2NQ3A 2J4WH 4OSUH 4U7KA 1AI1H 4HIQA 4CGVA 2FIKB 3SI5A 2Y06L 4YFLI 5CCHE 3KYAA 2EACA 3L1GA 2NT0A 3GEWB 1VEMA 1P5UC 4JGUA 1IEHA 3S3DB 3LZFL 2W0FB 3FQ4A 3PP4L 1FBIL 4XMWA 1T0MA 5ANMB 1KFAH 5DJ0B 5E8EB 5GGRB 1A7BA 1CDGA 4XIFA 1OALA 4MX7A 5D1XA 2DWYA 3W0WD 4HUXA 1FWXA 3FK3A 4JZJA 3TU6A 5T33L 15C8H 2R2BB 1JCRA 4R4NC 2EINE 4ZG1A 4OCNC 3RGHA 2BKGA 2BMKA 3N2JA 5JW4Q 2IBZX 2XA8L 2EVHA 5EEVA 3RVVC 3SBPA 5J08A 1LL1A 4AIOA 3PWPE 3FT4A 5LGJB 4KXDA 4P05A 3PWJB 3MREB 2NZ9C 3B8SA 2MWCA 1K3IA 3J27A 3UYPB 3MA7A 4FQHA 4XNYL 3T08A 2WOBA 2P49B 2XSKA 4XN2A 2XBTA 4KZDL 1X5IA 3I6SA 3UCQA 1CU4L 3O4LD 2YD3A 4OI9A 4IMLB 1J48A 5C71A 5DJCB 1U3HD 3MV8D 4ZMAT 1BXAA 1X5ZA 2YAFA 1YMMD 4KK8C 4F1ZA 5BZDB 5DK0A 1AIFA 3FUKA 2FF4A 2X3BA 2HKHH 3AMKA 2R59A 4HH9A 4J3UA 3ZZSA 3IMBA 3L6AA 1XT5A 3VD4A 4L5FE 3C5JB 5FKPA 4F2MA 3LJ3A 3DJTA 2W5PA 4M29A 2A2QT 1JFHA 3GT6A 3G2UA 1IKND 2NUTB 2G0LA 2NOYA 1R3LA 4PBXA 1IL1A 4XN9A 3MXWL 3WE6B 2HP4A 4HUVA 3L54A 2B3RA 4LGPB 5BVJA 2ILLA 3O81A 4OGYL 5C0AA 3TA3C 2IV8A 5DJZA 2PNNA 3DJRA 4ZPVA 4U96D 4AQ1C 1AS7A 1QTSA 1EAPB 1NIBA 1YYCA 3MFFA 4OB5L 1RERA 3LIZL 1SGKA 4KNQA 1EWHA 4JZNA 4XMVA 1N64H 3WIHL 1E5ZA 4Y1AB 1ZSHA 3SE4A 5B4MD 3B2MA 4F5CE 3UYOD 2PW2B 1G7MA 4U0ZA 3PDNA 2UUDK 3X2QB 3ZK0A 4UCFA 1FUNA 3TWVA 4LSVL 4HP5A 2W88A 2KCVA 1JS4A 1QUPA 3HKFA 5GGSY 5HI4C 4H1LG 2DYRE 1CZ8H 2YXFA 3U9PL 2WB1A 4ZX3A 3ZTEA 5DRWA 1OGAA 1RFDL 4IU3A 4ZMLA 3BCDA 4CVWA 4EDXA 4Q52A 2CJTA 1T04B 4FQJL 1SYVA 2GFBB 1MHEB 4JAMA 1IJ9A 4QXVA 3RGVD 4XAKE 2L9BA 4P5KA 5FSPA 4S2SA 3C98A 3SCMC 2LVEA 3Q6FB 4KJPC 3AJIA 2OMTA 1QF1A 3ISMC 2NXZB 2V2WA 4KI5C 2GJRA 4N0CD 3ZRFC 3APMA 4JG0L 3TX4A 3T2JE 2D73A 2WVSA 2X6FA 4F7KA 2AJSH 3S2CA 4X6DB 5I1EH 1WZ1H 3FO2B 3VXUD 3GPSA 3QE5A 5KYUA 3SQBB 4ABVA 3NQXA 4NP4L 4EQ3A 2WVTA 2FEEL 3TBSA 1KELL 4LT7A 3EH3B 3SO3B 1J5HA 3HG1E 3M88A 4LCVA 1OS0A 2MCMA 3D5OF 2VN4A 1ZA6A 3K3QA 3HJEA 1W0WB 3FYIB 3GSVA 3EJTA 1S7VA 5KVEE 5D1ZC 2OTWB 1X4YA 1YYLL 3JVGC 2J20A 4U2YA 3FTSA 5J6HA 1NGXA 2DWEB 1MX4A 5E1AA 4D0BB 5EPMB 1EZUA 1KOAA 4BQ9A 4N0FA 5F89B 1ORQA 3DPBA 2W60B 4AYID 4L8SC 3E8UH 3ME0A 2HCZX 4P04A 3V4PA 4YDKH 1Y1UA 2MRIA 5DYOA 4EN3B 4JKPL 5DU7A 4KY1H 1XB3A 4NBZB 1CN4A 4Q9QL 1BFOA 3N9GL 4XKBA 3J5PA 1KJ2L 3VXRB 2X7LB 4E5XG 1MQKL 5DMIH 2V8LA 1BIIA 1BQSA 4BT8A 1NC2B 1R3KB 3S88H 3V6OE 1AQDA 4WUUE 4ZMOA 3LPWA 5CMAB 5KBLA 2XRYA 1NCDH 2AV1A 2R23A 3FU8A 4OAVB 1QACA 4PJ6A 2OYKA 1DVTA 3TCTA 3TT1H 3TCXA 2BOLA 5GRUH 4Z76B 3MNMA 2HZHA 4YVQC 4GRWB 2C5DC 3D3VD 5F9WC 2NY3C 4PRBB 3MRNB 3QCTL 4GG6B 5BZWB 4JDZB 4ZXBD 1JPFB 1YQVL 1IVTA 2J2ZA 4UQAA 4JJHA 4EBQL 4GW5A 1Q38A 1SLXA 3MLSH 2OFQA 3SDAB 3PJSA 3QA3A 2ZX6A 4FU3A 5T1MB 4OKVA 1D5ZA 4MKMA 1N95A 4I1NB 1YAIA 4ZTOL 2QKIC 5EZJA 5HHNB 3B7YA 1L7IH 4FEMA 1TITA 1V7MH 4MGXA 5GSRB 4F80A 5HVFB 4KXCA 1EUUA 2CU9A 2OSXA 3J07A 4MMYA 4AEIH 3WNMA 3JWDL 3P69A 5JT9E 1SEQL 2OJEA 4FXLA 5DRNB 5F96H 2NW3A 1TNUA 2FH8A 2J09A 4TQEL 1EO7A 3OJDA 1L6XA 3IU3B 4KQ4H 3WUZA 3KL3A 4J27A 4AKOA 4Y5VC 3H56A 3SDCC 5C8JA 5EF1A 3P3RA 5BPPA 1JNNH 5DMKB 3U6XS 3F7VA 3KLAA 3TH4T 4P5TB 4DVBB 1JG9A 3QR2A 3DO2A 1UASA 2F74A 3SYQA 4UAOB 4CVUA 5AFAA 3FB6B 3MV7A 3QUML 1DJZA 1Z5LB 2OX5B 1DBAL 3KPPB 4I1OB 3MRJB 1CDCA 1CGSL 4LLDB 2X4QB 1XGUB 5EEZA 4TUUA 3DOSA 3V4VL 4Z0XB 2ADFL 2EEFA 1SEBA 4LEXL 3C8KB 3UAJD 1JNJA 5DRXB 5CMYA 3FTWA 4G8FB 4LOUC 3ZY7A 4YZFF 3C5ZC 4WWKA 4Z0BH 3CG8A 4JKLA 4XPHL 2FWOB 5AW9B 3ISYA 3QRBA 5DUML 1NFIA 1WT5A 2ZCHH 1EGJA 1D8EA 1N2RA 5SWSD 3D9MA 1IAII 2DWDB 3UBXG 4BIKA 2V2TA 2Y1DA 1PZ5A 1WAEA 2A9MH 2AFNA 2FD6H 1BFVL 4ANWA 1TLMA 4OZHE 3ZKXB 4MDIB 3L2NA 3HB3C 1TDQA 4ILIA 3ZL1A 2H8PA 2YLHA 1MLCA 4QOKB 2PGGA 2PR4L 3B7SA 4L29B 1KPRA 5ICUA 3I5PA 4EUPA 3TNMA 2MQCA 3K6IA 3TV3H 4UQ3A 3TO2A 1T3FA 4I4WA 3TGOA 5FGCB 2EDLA 1TYRA 2YAEA 1NOLA 3EAKA 3L9RA 3E2HC 3PZDA 4GTOA 5H94A 2FO4A 2XWDA 3AABA 3QNFA 1BGXH 2X12A 3MGTA 4GG8A 4PGBB 4LRNL 3MLRL 2P9SG 5HHPB 5TDPA 3WFBH 1S9WA 4G9FD 1RUPH 2KLTA 3GRBA 2B5IB 2QGBA 1SDDA 3VYOA 1F86A 5K9QG 1VKXB 4UI9C 2X05A 4AMKL 3RVXD 5I71C 4WNEA 4TULH 1Q0LA 4FHKA 1VGEH 4MZ3A 2FT7A 2A74B 3FQYA 3F7YA 3BRGC 1SXBA 1ZEAH 4P59L 5FQ6A 4PCTA 4UT7L 2ZU6B 1Z5HA 3MXVL 3UGUA 3D39A 2ZNXA 4TM9A 5HI7A 1LK2B 3FOLB 4X9HA 4ZUTA 4JR9L 1HT6A 5EFIB 2XQYK 3M17B 4J8SA 4JQVC 4XO5A 3APNA 1YPZA 4M7JL 3VD5A 4ZT1A 4TLUA 1CCZA 4JHAL 4WFEE 2CBPA 4MQXC 2VZVA 5F1NB 1SXCA 2DQDH 2FLBT 4FHBD 1W72L 2GKIA 2VR7A 3Q8AA 2N1TE 2C9AA 2ZX9A 1KTCA 4MAYC 2CK2A 4RA3A 3E30A 4O2EA 4XCFH 5C0BD 5BV7L 1TQCB 3GMPB 4ODXB 2JB6A 1QA9A 1QNFA 5D70H 4GRLD 4PW3A 3FUEA 4PLJC 3FBQA 2B7DT 2XWJA 4C57C 1F1GA 2HTKC 3Q5MA 1N8OE 2UWEA 3BIBX 3CBKB 1ADQH 3G2WA 3PL6A 1OP3K 1HXYB 1QSZA 5DJ2A 1WIOA 5DO2C 1YPZF 1JXKA 5E2UH 4XXWC 5IWLA 2DLEA 4A68A 2YEVB 2VO5A 3SGKC 2FBJL 5E9DA 1FSKC 2BNQE 1YNKH 1MW1A 4V1DE 5J6GA 1UWYA 1HWWA 4DZ8A 1V55E 1QYGH 1ID5I 4NDMB 3VFOB 3ECQA 3QUZB 5SX5H 2L0IA 3Q75A 4LSUL 4DAGH 4YVOA 3C6LA 1HYRC 2FJHA 1RK1B 1TZIB 1T0NB 2UWEF 3RTQD 4FABH 5L2KA 4EIUA 4WFGE 1HAWA 3LV3B 2EABA 3WEXA 1KZPA 5C0EB 3TCLB 3N1MC 2FIRT 2HJKA 3LH2H 4I5BB 4BK5C 4AIXA 3GM8A 2JB5H 3HZ3A 3HPJA 4KUZH 2BW4A 4ZAKD 2COVD 2VR6A 1Q72L 4Y88A 5IV2A 5IGXH 1TNNA 4Z7OF 2CD0A 3GMLB 1WWWX 2CUHA 4MCZB 4A2FA 5JPNA 4PJ5D 4C59B 5CJBA 2BC4B 2J1YA 3ARSA 2NY0B 5D7JC 1I7UA 4FG0A 4AL8L 1NGYB 1XHHA 2ITCA 1T1SA 2J7LA 3C2AH 4XVUD 3GMNA 4ZTPL 5BRZE 1XSOA 1ROCA 2BS9A 2C7UB 3GMQA 2TLIA 2YK1H 1BFSA 4EUPG 1YJDL 3NA9H 3L3JB 3ZHNA 3E32A 5ILTL 4HK0A 5T1KB 4FA8A 3MLUL 3O2DL 4CGTA 4NO3A 3ZDZF 4XP4L 5KSAD 4KAQL 2JCWA 5AYQA 5C08A 3U7AA 2BFVH 3MLTA 4JPVL 1TKWA 3L95A 4B9JA 3B13A 4WI7A 3QNXB 4J8RA 4N9GA 3VXME 2A6KA 3RNKA 1WWAX 3SOBL 5I1GL 3Q2WA 2PL5A 3Q6GH 3H6AA 2DWXA