2XQ0A

Structure of yeast lta4 hydrolase in complex with bestatin
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
632
structure length
625
Chain Sequence
b'MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHNKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLLAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUKOTRIENE A-4 HYDROLASE
publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 221
structure length 625
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xq0A03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xq0A02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xq0A04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xq0A01
3FU5A 3P7RE 4XO5A 1HYTA 1FJUA 4B52A 4J3BA 1KR6A 5J6SA 4XN1A 2VQXA 1FJQA 7TLNA 5AB0A 4QUOA 1KS7A 8TLNE 4XNBA 4XNDA 3PUUA 4KX9A 1QF0A 4TLIA 3FU6A 5JS3E 4L2LA 5A3YA 3ZI6A 4RVBA 4XN4A 4FYRA 3F28A 4KX7A 4R5VA 3SE6A 4K5LA 3NQYB 1Z1WA 3FUNA 2HPOA 1EZMA 4FYTA 3P7SE 2XPZA 5CU5A 3B3BA 1GXWA 3B7SA 3FH8A 4FKKA 2WI0A 3T8VA 3FORA 4K5NA 3FLFA 3FTXA 4TNLA 3T74A 3FBOA 4QPEA 3FU3A 1ESPA 4ZQTA 3DNZA 2YD0A 1FJVA 4XMUA 1KEIA 3FUJA 3P7VE 4GAAA 6TLIA 4N66E 4ZW7A 3QH1A 4KXCA 5LIFE 4GERA 3T8FA 1TLIA 1L3FE 1Z9GE 3EBHA 3P7WE 3MDJA 2G4ZA 3FHEA 4XN5A 4MWPE 3FXPA 3T8CA 4FKHA 1QF1A 4KXAA 4Z7IA 4FYQA 4PJ6A 3T2IE 3FUIA 4PW4A 4K5OA 4D9WA 4ZX3A 1LNDE 3DBKA 4N4EE 1LNBE 1KL6A 3B7UX 3FXSA 5LDSA 5FWQA 5K1VA 3Q44A 2ZXGA 4KXBA 1FJOA 1H19A 4OI5E 2GTQA 3B7TA 1TLPE 4QIRA 5K7TA 3CIAA 3DO1A 4K5PA 7TLIA 4XN2A 3MSFA 5TLIA 4MZNE 4KX8A 1KROA 4PU2A 4ZW8A 5AENA 3QH5A 4R5TA 5L41E 4M65A 4ZX5A 1FJWA 3FTUA 3Q7JA 4OW3A 1LNEE 1HS6A 3FV4A 4F5CA 3QNFA 3T8HA 2DQ6A 3T8GA 4XMWA 4ZX6A 2XQ0A 3FULA 5FSSA 4XO3A 4XN9A 3EBIA 3N21A 2R59A 3EBGA 2VJ8A 4XN7A 3MS3A 5C97A 4Q4EA 1KJPA 4QMEA 4NAQA 1OS0A 4XMTA 2XPYA 3FTWA 3FCQA 4OU3A 4E36A 1PE5A 2DQMA 4X2UA 1QF2A 3CHPA 4RSYA 4Q4IA 3FUDA 3FTSA 1PE7A 1Y3GE 3NQXA 3TLIA 3FVPA 4ZW5A 5JT9E 2WHZA 4P8QA 1GW6A 1BQBA 1FJTA 4FKEA 5AB2A 8TLIA 3DO2A 3LS7A 4K90A 3FB0A 3FGDA 3T2JE 1LNCE 1TMNE 1KJOA 3TMNE 4MKTA 4MXJE 1U4GA 5LHDA 4ZW3A 3U9WA 1ZDPE 4HOMA 3FTYA 3MSAA 4XO4A 5LG6A 2TMNE 1THLA 1SQMA 5DLLA 3B34A 5TMNE 5BPPA 4H57A 2A7GE 4K89A 5FSPA 3T87A 4DPRA 3NQZB 1Z5HA 4KXDA 2TLIA 3MSNA 4JBSA 3QJXA 4ZX4A 2HPTA 4D91A 4K5MA 5FXNA 1TLXA 3FU0A 3T73A 3B37A 5DPFE 4MS6A 3FH7A 4QHPA 3FUMA 4NZ8A 5TLNA 5L8PE 4R5XA 6TMNE 4TLNA 4WZ9A 4N5PE 3FUFA 3T8DA 3Q43A 3KEDA 1FJ3A 4ZW6A 3FUKA 3QGOA 5LWDE 3P7PE 4XNAA 3FTVA 4MTWE 5JVIE 3B2XA 5JXNE 1LNFE 3DO0A 3FUHA 4FYSA 2TLXA 3P7UE 3CHSA 3CHQA 4PVBA 5DYFA 5L3UE 3P7QE 4XMXA 3FH5A 3CHRA 5FSJA 5DLHA 3NN7A 3SSBA 3CHOA 4TMNE 4XMZA 4XN8A 3FUEA 3B2PA 3B7RL 1KTOA 1PE8A 5HQDA 1NPCA 3EIMA 5DPEE 1TRLA 4XMVA 1LNAE 4R7LA 3FTZA 1KKKA 5JSSE 3T2HE 3F2PA 3P7TE
chains in the Genus database with same CATH superfamily
3UINC 4GMSL 3F8UB 5GHWL 1JZ8A 2O5YH 4Z76B 2ADFL 2CKBH 3GJFA 3MRKA 1N9PA 4JGMA 5CLYA 1UT9A 4FQHB 5DQDL 4X6CF 2HKHH 2PTUA 4DO4A 4Y4FB 3HNTH 3CQCB 2JNZA 4I9WE 4LFHD 4XMKL 2OJ1A 3TBVA 1PW3A 4PJBE 2W59A 3O0LA 3WBDA 3HG0A 5KANI 1UC6A 4U6HB 4FFVC 1E4WL 1RI8A 1P2CA 5DO8A 4AV0A 5IGXH 1F5WA 1BJ1H 3CLEL 2N0KA 3ULUH 1AOHA 2WC7A 4EI5A 3WMSA 1LGVA 4L4TE 5L4FA 4XCFH 4XP6H 1IKFL 2VDLL 5BRZD 1QTSA 5DZJA 4L3CA 4QCIA 3AXIA 1NOAA 4UQYA 4J8SA 2ICEA 4L2LA 3AQDA 4DVRL 4PTTA 4YHZH 3D69A 1AZRA 4PM1A 2KZKA 1MHQA 4GEJA 4KK6D 4G25A 3K2UH 2CK2A 4N2AA 3GYRA 4KX7A 3EXLA 1YQVH 4RZCB 5BW7C 1P4IH 3W2DH 3OHMB 3DX2A 1NH6A 2KLSA 2V2WA 3IU4H 2BIHA 1E28B 1Y0LA 1KJ3H 4HRNA 1QQEA 3L3IA 3RWEA 3NSXA 3VFVB 1CLCA 1I9EA 3HBQA 1G9MC 3MGTA 4GRWF 1S7UA 3TCXA 1T7XA 3KYAA 3PWUB 4JPVH 3TWWA 1WAAA 1S3KL 2GW5A 1NM9A 4LCWA 4XCNA 2DY2A 1H9VA 3OKDB 3IDXL 1QAWA 3O8XA 4JHBA 3ASHA 4ZBJA 3TVMC 2O5XH 3LRMA 1VZGA 3RURA 3HI5L 3FU9A 4XODA 4X6EA 4OBSA 3Q6GL 5FYKE 1CR9L 3QZLA 4TOYH 1AS6A 3CDZA 3HE6A 3I84A 1WD8A 3FQXB 4OCSH 2H6FA 1OPGL 4PB0H 2E5EA 3WFHA 4PVMA 1OGTA 2QHRL 4IMKC 4LRNL 2X89A 3W9FA 5T3XL 4RMTA 5TF0A 1IIKA 1V8HA 1EZLA 5A7DB 3IDIA 1UOVA 1T5WA 1YRKA 2A9NL 2R2CA 5JIHA 5KVEL 5TFSL 3OB0H 3VFPB 1LO0L 3A14A 1I9JH 3I3EA 3LZPA 2WLLB 3N44B 3QORD 1P7QB 5E4AA 3WIHA 1G7PA 1KNOB 1MCQA 2VDNB 3NA4A 2NXZB 3P7WE 2DMKA 2ITEA 4HISA 4ZNEA 1DDHA 1FNEA 5DLML 3EH2A 3CSBA 2J09A 3BAEL 5EZOH 3EUVA 4QRFA 4YVOA 2VDOH 3D50A 4DGUA 4IJ3B 3MA9H 5FTPA 3ET9F 1T0MB 1LP9A 2A9AA 3DROB 3Q5YA 4LSPL 1IM9D 4LPWA 4DW2H 4YHLL 4IW4C 2VMDA 4XC1H 2WYIA 1M2OA 1O5MA 3O6ML 2HN7A 1DJZA 3H0TA 4MAUL 1DE4B 2IMNA 2LV4A 4HS6B 3AACA 5DSCB 1A3QA 2BS71 4BERA 1SXCA 1KBBA 2AJSH 4OFPA 1ZVSB 5KAQF 4OZ4A 4J2XA 1K4DA 4OD3H 2ADJA 4J3VA 5D1XD 5DZOA 2F1AA 4D7PA 3ABMB 3HZKA 3DXAE 4NO2A 1XSKA 3EO1A 3RWIB 3O3EB 5JOPD 1NCJA 1HH6B 4GCOA 3HI1B 1JXDA 5E7BA 3PZ2A 1I3RB 3CN1A 3HFML 3MGOA 1L0PA 1JGEA 3ANNA 1F8TL 2HM8A 1PZ5A 2A74A 5MEND 2MPVA 3F58L 4W9ZA 3F65A 3DXKG 2E7LC 3UFIA 4FEIA 1U9KA 5AYUL 2QJDA 4UV7L 2EO1A 3DX3A 1TJGH 1T89A 1CU4H 2ZUQB 2IDTA 4XNMB 1M56B 3ISYA 1AGFA 5IVOA 5E03A 2OA9A 3KXFA 4G42A 4Y16A 5F7YC 3UPAA 1F86A 1TFPA 4A6YL 2WCGA 4RG9A 4C56B 2CCVA 5SX5H 2IU1A 1UJJA 2GT9A 2HXAA 3QEQE 3BIKB 4L9LC 35C8L 4MJJA 1SZAA 3MRIA 5MEPA 1VADB 1GOHA 4I0PD 3O4LD 3SGEI 2VERN 4MZNE 3ZHYA 3PV6B 3UKUG 2VITB 4X8JB 3IJEA 3FT4A 3WKNA 2DH2A 1VSCA 1YEEL 2WQWA 1KMGA 5IQ7H 4OQTH 5IF0B 4ZW8A 2AGJL 4XMPL 5AENA 1YJDC 5FM5M 3PAZA 3S34L 3GSWA 3F7KA 5L41E 1WFUA 4N0CD 3C60D 4E9RA 5B38B 1R5IA 4HJUA 4WW1A 5ENWB 4U1HA 2VZUA 2F37A 3QJTB 2HT4C 4PP2B 1IC7H 3M7OA 4CSTA 2XG4B 3BFWA 1HQRA 2UZIL 4NGHH 5F3BA 3C3OA 1CLZL 4J3SA 2XXMB 4YBQC 2ZOTA 3UM0A 1TNZA 1TVHA 1BIIA 2YWZA 4JQVC 4F57L 4S1DC 1HKLL 2D4DA 3DHPA 4D7BA 3W1ZA 4OLWH 5AL0A 3TJEL 5JJ6A 2BP0A 4UTAA 1A7OL 1O0VA 2DYSB 2O4EA 5SWZD 5AW4B 4M7KH 5DZAA 1DVFA 5BRPA 1KEMH 4HWZA 2VDQL 2OYMA 5E6ID 1TEFA 4H0LC 2F7PA 4LASL 3ARRA 2JCCE 1NWPA 4W68A 4C59B 2ORBH 3JTTB 5GJTL 2HFFA 1MAKA 2OXHA 2Y7QB 1S7TB 3O2VH 3QDMD 4AKOA 4EE2A 2LQRA 3VG0H 4RIRA 5HHOA 1PLGL 3LXUX 3HOGA 2I1KA 1X9QA 4QAWA 1E6OL 3KD4A 5EOTA 2C9RA 5L88L 2PPDA 4IRZA 5DEFA 4NHCH 3FOMA 3V6OC 5E2VH 5EDXA 3AQYA 3EH5B 3GMQB 2C3GA 1T83C 2H7WA 4RFNC 4ES9A 4R2GD 1ZANH 2V5TA 5I8KH 3DSFL 4X2UA 3O2DH 1T1WA 4FFWC 4PBWD 4J1UB 3WN5A 4BKLA 3UZVA 4BWTA 2R23B 3N1QC 4P2RE 5FGBC 3FUDA 4UQXA 2H6PA 3SO8A 4U95D 4JQIH 3ABKE 1GMEA 4GQ9L 4OM0H 2BNUB 1QQDA 3HC4H 3FVPA 3SNXA 2FIKB 4PR5B 5EOCH 1IZJA 2B4CC 3SDAD 3WTUA 4I9WD 5TPWH 4G70B 4IU2B 5FYJE 4OCWL 4X4YA 4NT6B 1NEUA 1CTMA 4WO4A 1H15B 5B1JC 4ZMTA 2D9CA 4A2GA 5CGMA 1MFAL 2OXGB 1MVUA 3V0AC 1WAO1 2R5SA 4ZK8A 4YK4B 1DQDL 1GVIA 5F89A 5JO5B 4L4TD 4OFVA 2FL5A 4J3OF 2JXMB 2JLPA 3GLEA 3A4FA 3DSUA 1K5WA 3BD3A 3WG7B 4K94H 2Y36L 3N04A 2B7DT 2BZDA 4KKLD 2VMCA 2XI9A 2HT3D 1F4XH 4UYQA 1J12A 3PJSA 4HHAB 1GZHC 3NEOA 1D5XB 2OCCE 2BVQA 5CJOH 5I1EL 3FTYA 3TAXA 1XB3A 1WO2A 5EKQD 2VR9A 4GMJA 1YEHL 1PVHA 2BNRA 4DX2A 3LCYA 5D5MB 3WEXA 1DL7H 2IEPA 1B9KA 2YMOA 3WNJA 3D07A 2NCEA 4I3RL 2KUTA 2A77H 3STBA 2B59A 4MA3B 5B22A 1Z5HA 3LH9A 1JZDC 2W9DH 3FXIC 2UVEA 2X1OA 2G3NA 1IM3B 2OMWB 3R06A 2JB5L 3TXNA 3PAUA 4J8RB 2GROB 3GXPA 2BSSA 3APDA 3ZXPA 5E23A 1D5IL 1KXQE 1CFQB 5D7IF 1SN0A 3SFXA 3EJNA 4L5FE 2K78A 4R7XA 1YYLH 1M7IA 3H9SA 2DI9A 4ZMPA 1OCZE 1QFPA 3BWZA 4RGOH 2MNWA 2LVEA 1HWHB 2F7RA 4X98A 4G26A 3O45A 3ZKJA 2A83B 3CZGA 3C6SA 3FU0A 25C8H 4XO8A 5IQNA 1KLGA 1W0WA 5FYKD 1A66A 3L3KA 3MN8A 5BQDA 4D0DB 4X7TA 3ISMC 2AMUA 3QVAA 5LAXA 4FABH 4MD0B 1TXKA 1B4JL 2FO4A 4LPTA 3B9KD 1E96B 5FUZL 1KULA 4B89A 4HZLB 5FZSA 5ARGA 1JK8A 1F4HA 3KPRB 1GYUA 1WFTA 5HDLA 3MUGA 3J2PA 2OMTB 2OYKA 4Y88A 1IAOB 4K71C 4UWGA 1BEYL 1NCNA 3RDTC 1SMDA 3BUDA 5EU3A 3VXSE 1G6RL 1T20B 3PNWB 5F21B 3UMVA 1DQJA 3BGMB 3T4AA 3DV4B 3D09A 2E0IA 1Z9SA 5LQBL 4TULL 3T0BA 1B3IA 5HPMB 3DMMB 2H8PA 3FO9A 4QJ5B 4EBAG 1NCAL 3HRZB 2WQ8A 3V0HA 4B53A 3REWA 5I16A 4DWHA 3O6LL 5KSAD 1E5ZA 1KPVA 4Z18A 1M6OA 1B2WL 4A1SA 4P07A 3WS6C 4YSSA 3MKKA 4NQVA 4EIBA 1L0QA 2ZUUA 5DHYA 5D7EA 5C7XL 5H2BA 5JUEH 2AS5M 3QEHA 2DQHH 2Y25A 2H3XC 1M3JA 1UWGL 4MNGB 1AFVH 2QDVA 3MCKA 4NNXB 4UINH 4Y5YB 1CDYA 2PETA 2PO6D 4U0ZA 4GZ3A 2H9GB 1URIA 3R0NA 5T5FA 1NKRA 2D8KA 3GIZH 2QVTA 1B6DA 5A3IC 3GI9H 1J11A 3GXTA 4IK6A 3DXAD 4CU7A 5DRNA 1JG9A 3IDNB 2CIIA 5B3NA 2NSMA 5AQ7A 3AW5A 4PJAA 1H0AA 1OE2A 2NY3D 3NN7A 4IHQA 2OTWA 4HJJL 5DEGA 4YSCA 3REVB 4HOQA 4GSXA 4JG1H 1KCRH 4OIIL 3VSQA 4CEMA 4WV1B 4ZAKA 5BXUA 4UWFA 2OX5B 1C12B 4ELKA 4ERSH 3QIWC 4KVCL 4DGIH 2EDKA 3BP4A 1MLBB 3FQWA 4UQIM 1ZGLB 5D7JA 4AGOA 4TYUA 2IQ9H 1GPOH 4Y8AA 1F18A 4L9DA 4BSVA 5DR5H 1JVKA 2H32A 1VB9A 3QEQD 1KTOA 3ZYMA 1ZD6A 2N3JA 4HJ0D 1RP3A 5E5LA 3ULVF 4M48H 4PJ8A 4XMVA 2WQ7A 5JHDB 5MEOA 1LE5A 1JNJA 3AU8A 3GYZA 2VSXE 1A6TB 2IPKA 2P9RA 3FQ1A 5ICZB 2NY6C 4AGLA 1IIIA 4UWQB 4F93B 3FU5A 2APWA 1XQ4A 4MQ7B 2OS7A 1S5HA 3CVHA 1TVBB 5EC1B 5JW4M 1SN2A 2BIOA 3BT0A 3QDJA 5IBLC 1FH5H 4XCCL 2WAHA 3TO4A 2AABL 1K72A 2PYFB 1Q2ZA 5A23A 1VACA 3PGDB 4PYHA 5GGSA 4JM2A 4QRBA 4NKOB 2DTSA 2ZYHA 5GJSL 3VGEA 5EU7C 3EJCA 4A1RA 1MKFA 2VN3A 2NYYD 2G2RA 1RERA 5E8NA 5BUGA 4Y5XB 3SDCC 2RALA 5SV3A 3DBXA 1HQ4A 4Y5VB 3MRRB 1WAAE 2M26A 2CKBA 2ZCKL 3GXMA 3UC0L 3JTSA 2FJFB 1KZOA 1B0GA 3QPQC 4LCWE 3FB6A 1MW2A 2D7MA 2AHIA 2FR4B 2NUTB 3V0WL 1X5HA 2J57A 4Y2DA 3TCLB 3B9VA 1AE6L 2MOQA 2AV7B 2HH0L 2ZNWA 1AXSA 1A4CA 3IN0A 4CSPA 5FGCE 2HPOA 3LPGA 4OV5B 4D8PB 3PNRB 1F1AA 4KKRA 3CU1A 3QAZB 3CFEA 3MRLB 3CCHB 2YPKB 4O4YH 4HJGB 2WI0A 4F24A 3UTZB 4S2SA 1C08B 4KK8D 4U3CA 1JUFA 1A4KB 3U7AA 1F6FB 1NKGA 1FN4A 1FVCA 4DFIA 3HMXH 4ZMOA 2ITDB 2KDYA 2AJVL 1MPAH 2J4WH 3RYMA 1TN8A 3T0EB 1LE9B 4K5NA 1IGMH 4P2RD 5M7QA 4TNLA 4Q2ZA 2NY0D 4LK4A 2Q87A 4DF9A 2C0LA 4JLRB 3S98A 3ULSB 1CL7L 2ADIB 4KZDL 2E7MA 4RGMC 3FU3A 2VXTH 2WQHA 1N68A 3K71A 4MQTB 5AARA 1OANA 2VM3A 3NIDF 5FYJD 4M6NL 1KJMA 1GOGA 4S10A 1X5BA 2ERJC 4KHTH 1LP9E 2UWEE 2IEJA 2A9CA 3GSRA 2KI6A 4KTYA 5D93C 2CK0L 3STZA 2DYPD 4PG2C 2XQYK 4ODTL 4E9QA 1I9RL 5IB3B 1U3CA 4I48B 2IJGX 1U8HA 2P46B 5FWRA 3TNMB 5MI0C 5D70H 4NACA 3GM8A 2C9AA 3PIQA 3FHQA 5EOQL 2Y07H 4MRUA 5CBEB 1SMAA 2OPCA 3HCVA 4WNFA 5HDWA 4B27A 3WQSB 4FNPA 5HYSA 4G6KH 3K4DA 4UZUA 4YXLH 1NCGA 2G5BA 2G4ZA 2GJZB 3IETB 3ANMA 3PS6A 5JHAA 4QYOB 2D03L 2WVSA 5A2AA 1MJJB 2IDCA 3LH2H 3D30A 5C0CE 4E42B 1WM5A 4Q9RL 3UXGA 2IMMA 2XTLA 2IAMA 2VUYA 4XN5A 1U8PB 1MX4A 1AIFA 4MWPE 3OKMB 1USZA 2QKIC 2LAGB 3VXOB 4FKHA 1TTRA 4BQ6A 1BM3L 1AGEB 1QF1A 5LG1A 4XBGB 1GYAA 5IVZA 3ECBA 4LLVA 2WYHA 2AK4A 3B7BA 4FX5A 1ZIBA 2WLKA 4N1CA 4OZHA 4Z7NF 2XS8A 4LSSH 1F2XK 5C6TH 4JEHA 5DQ9A 1SVBA 3LKOA 3KXFE 1U93B 2NSQA 3B7UX 2J6EL 3UYPA 1DQMH 3PABB 2Q6WA 4QLRA 5I30L 5EIIA 4LNBA 1PFCA 4MNQB 3U0TA 1LEIB 2DTML 1GCFA 3L54A 2G0LA 1DSWA 2R69L 1J0ZA 3C5ZA 5HRYA 4ZFQA 4B7IA 2EC8A 3MMEB 1QSEA 3FB8A 4ZFGL 1KJ2A 4YGAB 1YAIA 4JG9A 3TBYB 2GK2A 5T3ZE 2A6IB 3QOUA 2D31B 5AUMA 1XCTB 5HHXH 4OJEH 4ZUUB 2YN3A 4L0YA 1L0YA 2OAAA 4EOWH 1PQZA 3VXSD 4WI2A 3ARPA 3GLAA 3TONA 1MWAH 4LF3A 5E0FA 5I76A 1KBKA 4FFZH 4P2OA 1QVOB 2XKNA 1IQWH 1MHEB 4LMQI 1PY4A 4WI4A 3TA3C 3IMRA 4U2YA 4XPBH 3WHE1 4OCLC 3T0AA 3VQMA 5FLUA 5E5MA 5EZJA 1N10A 1ZT7A 4D0CA 2EILE 2JCYA 1KT1A 3OZLA 2X70A 3DUUA 4MJIA 2YS4A 2BSRB 1R3JA 4PRHB 4ILDA 5TF1H 3VGHA 3MRNA 4IQHA 1MIEL 5KJKA 1WCBA 1BIHA 1MHCA 1SEQH 3RLSA 3EG9A 3LNGA 1MH5B 5KYWA 2VXQL 3II2A 3IE4A 3QH5A 4M61B 4AL8L 4OGAC 3DJ9A 5J6HA 5ANMA 1OARL 2CHZA 4Z0BH 2V2TB 3TA3B 1CIUA 2YK1H 4R7VA 4BK4A 5IT2L 4PTUA 3CSFA 3KDMA 1N54A 5KSUB 3V79K 2EVIA 4G8IA 1MAML 3S3PA 1N7MH 2M63A 4OLVL 5IQLA 1QFHA 2ADGB 4FE9A 3ZFWA 3HVEB 3W9DA 4AENB 4DX5D 2AJ3A 5HHOE 2DQ6A 3FEXA 5I1IL 1FPPA 2J6WA 4RLDA 5HDRA 4MDJA 2XQ0A 3DHUA 4JKPH 2PW2B 4QJ3B 5KS9A 4OQTA 4PLJD 3KR3L 2Y0BG 1JPSL 1A1OA 2NZIA 3JWDH 4HBCH 4ORZC 5E1AA 2R83A 5C0IB 3SDYL 4AIEA 4DGWC 1BAGA 1EXGA 4OD1H 2R72A 2JB6A 1FRGH 4GAFB 3VFSB 5BV0A 1X3DA 3LZOA 4KJPD 3SDDA 1R5WA 4H88L 1HL8A 3SO5A 4QXVA 3S37L 3TF4A 1HEHC 2R59A 4F15C 5D6CB 3IDJB 4KI5F 5CWSB 2QR0A 3HG0D 3N43F 1OWRM 4FLQA 3DUHA 1F3RB 4OI7A 2AJZA 4BFBD 1T3FB 2ZWSA 3UPRB 4GAYB 4PV1C 1KDJA 3ZUNC 3PWPA 2L3BA 4HV8A 5IMLA 4JKWA 3RKDD 2WZ6A 4MB1A 4XPAH 5J4MA 3JT2A 4KKZA 1A6UH 3NOCD 4BX9A 1MAJA 2H3KA 4JKMA 3IV0A 4U7MA 3E9TA 4G6ML 4X4MA 4YWGH 5GS1B 2Q8BL 1RJLA 3ZTJH 2R56L 3AB0C 2IANB 2ZUYA 1ZWIB 2BNRE 1GW6A 4Y4KB 3VRJB 2ICWI 1JPTH 4OUUB 5I74B 4KYOB 2W65B 2VAJA 2Y1AA 4NBZB 1INDL 5CZVL 1TKWA 3US9A 2B0SL 2MFNA 2AI0H 4HULB 3WNKA 3O3UN 4K3HA 1QABA 4YDVB 3VU2A 3O2DA 3US0A 1OB1B 3WFZA 4DT2A 3MBEA 5FHAH 3RJQB 3V0DA 2X9WA 4MHHI 4N3TA 2C1PA 1DJGA 4JQIA 3AB0B 4C57C 5TE7H 1VKXB 4LCWD 4UDTB 1TQCB 1XXDC 3F12A 5LBGA 4JDTL 4DEPC 1UM4L 3K8LA 4LKCB 3H9SE 1HYSD 3B2VH 3PL6D 5A6CA 4MWFA 4HOMA 3KSLA 4PG9A 1F00I 3O8XD 3QRGH 5T33H 3SYPA 4DCQA 5FYKL 3SE9H 1FBIL 3D34A 4KUCF 1A7PL 1N4XL 1JERA 4Y2OB 3T6VA 3H3KA 2AQPA 4LSUH 2CO6B 3HE6D 4OCRH 2AV1A 1O7VA 5ADPH 4WEBH 4YLCA 2BVTA 3MYVA 5ILTH 5CU9A 5EBGA 4F8OA 3WD5H 2X89D 2XWTB 2C3VB 1UJ3B 4AYBA 1RP9A 5CKAA 1JBJA 4BT8A 3EH1A 1F4YL 1JIBA 4RFOH 4L8CB 4S1SH 1PG7L 2EO9A 3V0VB 2DJ4A 3V4PA 5GS0C 4BBWA 3QG7L 2CDEB 4JKLA 5F7EL 4EKJA 3CVLA 4GB9A 3N2JA 4JO1H 4XPHL 5E2UH 3ZDXB 3EDKA 4BK5A 5IWLC 3BW9A 4JFXA 2IG2H 5D2LE 9CGTA 3MFFB 3KPLA 5CERB 1G9MH 3WL9B 2Q7AA 3K6SA 3Q8AA 3VD3A 2XN1A 3ZZLA 3ZXSA 2GBTA 3HXCA 1BFOB 1PKQE 4KZ0A 1T66D 4B9JA 1F13A 3MV9A 4JUTA 2YA0A 5I5MA 2W92A 2UY1B 1S9XA 5TLNA 5FJYA 4LHQB 1P6FA 4V1DB 4MS8C 1QKZH 4JZJA 2VDNH 1AR2A 4WZ9A 4Y4HC 3D3VB 4FJYA 2CIKB 3OLIA 5E08H 2B5IC 2ZP8A 4E9LA 1A3ZA 1KCLA 1MRCH 2VAAA 4ORGA 4PRDB 3H7BB 5LGYA 5FM5O 4N2BA 4TL5A 5HI3C 3EJPA 4OLYH 4DLQA 3ZKQD 2WXNA 5DT1L 2G60L 3RFRA 3BP7A 1VHPA 4I7ZC 1MCCA 5C0CD 2WZ0A 1LO3L 3VD9A 2EP6A 5BZXA 1A7RL 5AJDA 3RILA 4OZIB 1JGLH 4K3GA 4PJAE 4JPSA 4QT5A 4CN4A 4GG8B 4FD0A 4UNTA 2IGFH 1MQKH 3KD7A 4PJ9C 4ZRGA 3QFDA 1VZIA 3CDGB 4ECNA 2I9CA 2B1HH 3BE1L 5AWNL 3AT9A 5GS3A 1K85A 1BQHB 2QPSA 3R0IA 3QXUA 4MDIB 5ICYA 2DMHA 3RWJA 1MYOA 5KJNA 4MXVF 4WI6A 4ZNCD 3G6DH 4U96D 4X6CE 1JD7A 3C6LA 1QNZH 3OHXA 1X3ZA 1FG2B 3EFDL 5HI4D 2DQTH 2RFXB 3FB5B 2B15A 1CICA 1Z9NA 2GG1A 4PGCA 3KXFD 4ALAL 4CMHC 1FLRL 4FXGA 4Z7QB 3CUPB 4ETYA 4PJ9B 1XSIA 1XR9A 3ARGC 1RPQA 4DUWA 3P7QE 5TQ2L 1DZ0A 3MCG1 3P30H 1FO0L 2P28B 4PVLA 3MRQB 4TNVF 4HLZH 4QKXB 4P3CL 3WEOA 2VMFA 1ACZA 3LNDA 1E8XA 1MFBH 3C09B 4NFCA 4NFDA 1KELL 1NIFA 3N44F 2Y1GA 4WRLA 2JMRA 3FFDB 1S78D 3GFUA 4CMHB 3CVYA 2ALAA 2XWRA 4BSJA 2BX5A 2DQDL 1PEWA 2CMRH 4PI2A 2OVFA 1AXTH 3A6BL 4LEOB 1JNLL 4NC1C 3W5NA 1PF3A 3QDJE 1KCVL 1CD0A 3KZ8A 2FT8A 4G7RB 3WYRA 4G7QB 3IXTB 4JFEB 3X3FH 2R2HB 2IOIA 3HTLX 3MNWB 5J12B 2ZXBA 3T2QA 4ZPVB 1LXMA 2R7EB 1F6AA 4YXHL 3DSVA 1YMMB 3VW3L 3QFJB 1N3NB 3ILPB 1V27A 1YEFL 3TTSA 3PUJA 4HJIA 5K9JH 5FQ6A 4J8YA 1WS7A 1ZS8B 1KKKA 5JSSE 5F6IC 1UEYA 1S4IA 3D25A 4N2SA 5C08E 4IRUA 4AMXA 3VWKC 4LCCA 2QSVA 2Y5QA 2DQIL 5E0QA 3D9KA 2LW3A 4GPKA 1V7NH 3FRPA 2BRRH 3Q3GB 4NO0B 4FN0A 1DBBH 5DJ0A 1JMZA 3LNHA 5CO1A 5JNYB 4C47A 4QFVA 1EERB 1FORL 1M2VA 2PTVA 3KYMA 3O9WB 2ZG2A 5BO0D 2XRAL 3B7YA 1CXEA 1ZVHA 4U7EB 2GK0B 3AMKA 4MQXC 4CVXA 1ZU2A 5B39B 3GUTB 1PAZA 4A6YB 1W8NA 1BAFH 3FFCA 4JHAL 4NNPH 2N01B 4TLTA 5DJ6A 4W9LC 3VSTA 3JV4A 5BXFB 5FCUL 5HHOD 3BEEA 3FQ2A 3P9WB 5EUKB 1IGFL 4ZQHA 3X11A 3LD8C 1TIUA 5FK9B 4HBQA 4OD2A 4WUKL 4JHWH 3G6JA 5H8DA 3FQNB 4S0TD 2HAZA 1XMEB 1JTOA 3I74A 3ZN3A 4ZHBA 2Y22A 3P0GB 3KW8A 3Q9UC 1JCKA 4GRLA 3VGAC 5K93A 5FX3A 2BO0A 3QQ3A 5DUPL 1MRDL 1CJYA 5KANG 4XOAA 4AYGA 4X99B 3OKYA 1SY6H 4KQ0A 3VH8A 2YKKA 3QW9A 4QHUB 3BXNA 3TIEA 3RC8A 3P1VA 4EZMA 1BXXA 2LT9A 4MQSB 1URLA 4WCYH 1AY1L 4GBXA 1NC4B 4U0RB 3GXIA 1G5AA 3BP6A 3P7SE 4HT1H 3B3BA 1L6ZA 3MRJA 4WO4D 1IJNA 3NJMA 1ZSHA 2ZCHH 2R27A 3MLYL 4TN9A 5FUCC 1TN6A 4I43A 2QELA 2FQEA 2UV3A 3TBSB 4GINA 4HIEB 4K5BA 4PWIA 5HNHA 2W9EL 4E0RB 2ICWA 3LPPA 1P1ZB 4HC1A 1ILUA 3R18A 1ZHKA 4TUOA 5F96H 3K8MA 2BFVH 3ARTA 1G4RA 4ANUA 1QSFA 3LKPB 1S7XB 1RZ8A 1VFAB 4JMXA 1L9SA 2FNBA 5I1JL 3RC3A 3QISA 2X6MA 2VXVL 3QHZL 1SA4A 3F7YB 3LPWA 3IDMB 3QDNA 3PP4H 4G9DB 1WZ1L 5IK3A 4ZG1A 2VH5L 1HSAB 2BNRD 1MHHA 3LPZA 4FXKA 1BZOA 1JYXA 2GJ6A 4YR6B 1K2DA 4JFHE 1EZSA 2VLKB 2W8CA 5CJQH 2YLKA 5IZ7A 3DYMA 2BC4B 3TN0C 4PJFF 3HMXA 4C83B 3SBQA 5IESL 5E5RB 5IG7A 2H0FA 2B4CH 3EGDA 5C86A 1ZA6A 2AK4E 4QF1B 4EZKA 5DD1L 6TLIA 3QSKB 4GRMA 5CHEE 4OZHE 3Q2LA 4L5FL 1NFKA 4O02L 1UA6H 4P06A 3NABH 4F7TB 1U8OB 4JFQB 2H2SD 2WOBA 5KVFL 4OR1A 5LUMA 3TWVA 2X9ZA 3H9SD 3OAWA 4ZFOB 2FGWH 1FH2A 3Q79A 3FQRA 1MI5B 2CXKA 3TN0B 5D6DA 4ZXBC 5F1NB 4JFVA 5D2NA 2BZCA 2EYSB 2CUMA 1PS3A 3Q9NC 1QSEE 5EZIH 3T2NH 4HALA 4NWTL 3DVGB 1AQDA 1H8LA 5TE4H 4XBEL 3FN0H 2IBGA 2L7QA 1RPKA 4NRYA 1A9BB 3GMPB 2NYJA 5DXWA 4CYMD 2OJEB 2GITA 4ZMWA 4BCZA 5K9KB 2IH1B 1Z3XA 4PW3A 1CFVH 3L5WA 3MLWL 1WBZA 4NQUA 4YFEA 2LAHA 4X7FC 3RB7A 4O51A 4ZX3A 1K5NA 2VLRA 3DWTA 3DBKA 2GC4C 4UIMB 3IFOB 1JV2A 3ZHEA 1JNHA 1JVOA 3NMEA 2G30A 2PPFA 2QT6A 3HNVL 4UT9L 3U7WL 3WUWA 3FQUB 4K23H 4BZ1L 2RJIA 4JRXA 4OW6A 3ARBA 4PUBH 3MV8B 3OB8A 3A6CL 4MJIE 2EIKE 2VLJA 4J0UA 2WQRA 4WI0B 3SODB 3AS2A 4N2QA 4V33A 2WKOF 3QCTL 5ECGA 1UA7A 3TBWB 3L5XL 1TZ8A 3PWVB 4A2LA 5F8RC 2CLRB 4OLXH 3EJZC 4K8RD 5ANME 2HVKB 2WBXA 1G3NB 2A99A 3QUYD 2IO5A 4LNRA 1NBVH 2J8UA 5C0ND 4KOCA 4RFEA 4K2UL 1TYJA 3FMGL 1LYQA 3T2PA 4K5PA 3NFNB 1U0QA 1RUKH 5FOJA 3GZ1A 1JSYA 4KQ4H 1U8KB 4XTRD 2JF1A 3ZYLA 2X4NB 2C9UA 4HK3N 1PX8A 3TZVA 4DETA 4WVRA 2QY7A 4DZBB 1LDPL 3GSVA 3HS0C 2O5ZH 3IMWA 2R4SH 4JJHA 5ENRD 1LEGB 1NM4A 4UM9A 3LS8A 3RY5A 3GIVA 4PU2A 1OSYA 3LKRB 3P0YL 3OKLA 4ZAKD 1ZSDA 2AK1H 5B1AE 1MWAA 1DVZA 3UQ3A 2MIZA 5A7BA 3MO1A 4FFZA 4GW5A 1G6RB 1H0DB 1T6VN 1S7WB 5B1BB 4MD5A 1JZEA 1X9LA 3QCVL 4H8WL 5DUML 3ZIMA 1KBPA 4F5CA 2JD0A 3OX8A 3QI9C 2DH3A 4OM1H 3T8GA 3PWPE 1S9YA 3R1GL 1BFTA 3Q01A 1Z5YD 4PJ8D 1HT6A 1U95B 1U8CA 4PY7A 2ZNXA 1O6TA 5FZQA 3N42B 4MBGA 1IQDA 3EOBB 3FQ4A 2WIIB 5H94B 3CXBA 2R29H 3IJ7A 1OWMA 3AJIA 4NP4L 5JHBA 4L1SA 4OTXL 1FCGA 4EXKA 4U3SA 8CGTA 4M3OA 4FQCL 2WINA 4NO5A 4X4ME 5IJDC 3Q1SL 4M5SA 4PY8J 1ZHBA 3M17B 2YIHA 4OGYL 2R9HC 4OKVA 3N21A 4KTEL 3OKOA 3QI9B 5EMYA 4ADJA 3QDJD 5LXVA 4JM0A 3TO4D 1WDYA 1OCOE 3EBGA 5JMPA 3CXDL 1FF5A 5A2IH 4XN7A 1BA9A 3W9EB 5IEHA 1A65A 2YD3A 3MS3A 3RRNB 2QZ5A 1T2QH 3OZKA 1E9OB 4JM2D 5HGDA 1RFDH 4UF7C 2F2HA 3QUXC 4ZOCA 5KYUA 4S11A 2NTFB 3ESMA 4YDWA 3IU3A 2AXFB 2QZAA 1VFBB 2F7IA 1RZKL 3OD3A 4RG6A 5C08D 4Q6KA 4DKAA 3JQ1A 4NQQA 1HFUA 4NN6C 3WXXA 4YZFF 5DK0A 1R0AH 2YAEA 2FX8L 1PE7A 2V17L 2VMEA 1S7QB 4R4BB 4D0BB 4Y2DD 2NXYB 5DZVA 1HXKA 1NMBL 3QUXB 1YO4A 2HFEA 4KK6C 1U58B 2RFAA 4NKMB 1R75A 4OT1H 4WI3A 4I1AA 3DX9A 1R24A 4H25A 5FLVA 1FJTA 1AZCA 1NANH 2ZT9C 4MJ5A 3WJLC 2O93L 8TLIA 4D9LL 4Z76A 2B1AL 1Z2KA 4AYFA 3E2HB 4K90A 2EINB 4NJAL 1NZNA 2WXMA 3NCWA 4Y4FA 1RUQL 3L16A 3F05A 4X4ZA 4MXJE 3AG1E 4Z7VF 4GA1A 4X5WA 4QYAA 1EEUA 3GBNL 4GPVA 4NBXB 3GZ2A 4U6HA 2PGGA 2Y69B 3DJZA 3SGKC 5A2KH 5CECB 2V6HA 3EAKA 4TSCH 3AAZB 2QSTA 2V5YA 3WKQA 4JA7A 1FE8L 1ZEAL 4GT7A 3RKPA 3KWUA 3MKGA 4I3SH 1OAUL 3P3UA 5EWIH 2PP9A 4WJG3 5KCMA 5E4IA 1BXVA 3K72B 3SSGA 2IFFH 3KLAA 3TM6A 3MV9E 5H37H 3RUGF 4NC0B 1R3IH 4FNLH 4PJ5B 5HHME 4DO5A 1TUPA 1KCUL 1SVZA 3MJ8B 4FQ1H 2R0KH 1F2QA 4GXVL 2LSUA 1EAOA 4KXDA 4KKNA 2SODB 2X6KA 4RZCA 1RCYA 3CPLB 2YQ2A 3AG2E 1P5VB 2Y4UA 3L3OC 4KJYB 5EB9A 5HSFA 1NGYB 1H8OA 4HETA 4WFHE 3ZSTA 5ADOL 5C0DB 5TQ0L 4EO5A 1FWXA 5J7CC 1EUTA 3VFVA 2LU5A 3QORC 3V5HB 1DCLA 3A67L 1IE5A 2DEYX 5L9DH 4FMKA 4EIUA 2IAMD 2CDGB 1SDDB 2CJUL 3MUZ1 4FMVA 5BW7A 4JFHD 4WHTB 3IRPX 2BSTB 5HYSG 3ZN6A 2OL3L 4U05A 3O81A 2JKJA 4NZ8A 4DERA 3LB6C 5HVHC 1IAIL 2AK4D 2ENSA 1V54E 4QTIH 4ZMZA 4YLQT 1W8OA 3N41B 4PDXA 3CN0A 5E9DE 3OM3B 5JA8B 4JGNA 3UP6A 1OAJA 2H0EA 2Y1ZA 3O3DA 2V7NB 2WXOA 3FQXA 3SO3B 2QADD 3PDOB 1ILSA 5FUOL 2ZQKA 2F0YA 3FUKA 3ULVE 5KBAA 1HFAA 5C8JB 4K0OA 1WK0A 4DEUA 4R8WL 1F58L 3QC5X 1V7ML 3C5ZD 3ULUF 4KDWA 2AQSA 4RA3A 5D1XC 5T3ZL 3VFGH 3TVMA 1QSED 3VFPA 2WLLA 3FSOA 4LMQE 1P7QA 1T80A 5EIIG 1T1RA 5JXNE 4MMXC 1KNOA 2W80C 4N2MA 4XVUC 4C58B 5KSBB 1IO4C 4CJ1A 1IGIL 4TTDD 3UIOC 1NMAL 3FU8A 5FYLL 5D96C 3SJVA 2JELL 5BO1L 1UFGA 1SLVA 1CG9A 3MXWH 3P7UE 1N6VA 3WY4A 4F8NA 2BSDA 3M8OL 4X7SL 4XGZA 3UGXA 1ZGLP 1X7QA 3X12B 1OSZB 5F72S 2GEQA 1EBAA 1T0MA 3DROA 3CDCA 4OOEA 5LBSH 1C7SA 3BSGA 1Q1JH 4PVBA 1BMGA 2MQCA 4NN5C 4P2OD 4UWKA 2KXPC 1D6VH 1NCTA 4YLBA 4FFYA 4U04A 2OTPA 1TQWA 4M6MH 2AQ1A 2ZKHH 3CHRA 2FBRA 4HS6A 1H2VC 3O2WH 2VJXA 4MJID 5D96B 1FFNB 5DSCA 3BT2H 2QDWA 1KB5H 1ZVSA 4P9HL 2VLLB 1JCVA 4FC8A 5KTEL 3BISA 1BV8A 4P99A 1RXLA 3VVWA 1KSRA 3BVWA 1A6AB 3VRIB 1KG0B 3LYAA 2VC2L 1WCQA 2XN9B 4S1QH 2Y0SA 4J39A 3O3EA 1FZOA 3HI1A 1OY3D 5I2IB 4JANB 3HB3B 4HA1A 5HGGS 4QRRA 3RTLA 2AXGB 4HIXL 4KV5F 5EU6E 5FM4A 1N2RB 3KLDA 3ZTNL 5JHLA 4BSWA 4DKTA 1BD2B 1GAFL 1ORSB 1SXBA 2Y2YA 4BESA 5BJTB 1AQKH 3G6AA 1T1SA 3HUJB 4CCAA 4Y9GA 1VRSA 3AQZA 1LNAE 4IRJC 4S0HA 1N6QH 2RCSL 4JREC 3G6JE 1SJHB 1Q4NX 2W91A 2V9QA 4H1LH 2GUOA 2AWIA 1LD7A 2L7EA 1ZV9A 4HLJA 4L8DB 3BIKA 4DGVL 5E1HB 5FC9A 2E7LA 1T7YA 3SDDD 2HFGL 1VADA 3ZZQA 1L6XA 4GAGL 3PV6A 4Z5RA 4X8JA 1HH9A 2VITA 3WE6B 2A5UA 3VLEA 3LIZA 3H9HB 4QUOA 1KLFB 4O1PA 2NDGA 4HS8L 1EF1C 3T1FB 5IF0A 1OAQH 4ZMYA 4M7JL 4TLSA 1QLEL 2A6DB 3PWPD 3O6FC 1JOIA 3PUUA 3ARZA 1WIPA 5B38A 3G5XB 4WAFA 3RPBA 4BFNA 5ENWA 4L9LA 3NSFA 5DZLA 5MP6H 4FZ8L 4ZMLA 2OI9B 2CDFA 5TDOB 2NXPA 1QSFE 4IIQC 4AT6B 1VEOA 3CZFB 1PX4A 3DTUB 2ZWZA 1CZ8L 4LBEB 2DBLL 3RIFF 4DN3L 2LLLA 1Q72H 3EGXB 4G8EB 1U3HC 1GHFH 1XH3B 2QMKA 4YL4A 3CVPA 5CSBA 4K5LA 1QOKA 3AZUA 3EFOB 3ZYQA 1BSIA 1D7BA 3BKCH 3SOTA 3RWGB 2FWOB 3H9YA 1QR1A 4GSDL 4F8TA 4P3DB 2K4WA 3ZDWA 4IIQB 4HUWA 4QRUA 3MRPB 5D4HA 5F0JB 1UG3A 3I50L 4Z7NE 3H85A 4QWWC 3MOBL 3TBBA 4GYYA 1U3HB 3SPIA 3MBED 4M8RA 2Y06L 1CTOA 5EIQA 3BWUF 5MHSE 4CSSA 1I9IH 2EXWD 1SY6A 1NANI 4JQVA 2Y7QA 1S7TA 1SXSA 3V4VH 2C7UB 2L8AA 4KKCD 4I88A 4KKLC 4ODVH 2HT3C 3EO9L 4KKBD 4H0GA 2YAOA 1R33A 4MJ6A 3TS8A 3JTBA 4GZCA 1JHKL 1NPJA 4PS4L 2WBJB 1D5MB 5D2NE 3GMQA 1XF2B 5ENTD 4CNIB 3QJSB 2HT2D 3BWSA 5IV2B 1UACL 1BHGA 2R23A 4N2DA 2VOTA 2N7SA 5EA0H 4MNHB 4O58L 1RZFH 2V3DA 3LS4H 3DX6A 4HJ1A 5LGHH 3QA3A 4CRPA 1AZBA 4GAAA 4N66E 1AP7A 2FIKA 4GMSH 4PR5A 5GHWH 4IU2A 1INEH 2ADFH 2AZUA 3BAJA 4NT6A 3GMRB 3QFGA 1H15A 3V6OA 4P9ML 1A8JH 2VLRE 1K4CB 4M62H 5DQDH 1AYRA 2J07A 1T83A 2OXGA 32C2B 2OTUB 7PCYA 1W8EA 3RKVA 1I8UA 1I8KB 3RE0A 1GW0A 3NIFE 5JO5A 4JVSA 2ILRA 3HS8A 3LKSB 5FGBA 1E4WH 4JRXE 4DP4X 2RR3A 4L4VB 5BV1A 4K03A 2VLJE 3Q7AA 3MV9D 2O61A 3AGVA 5GSVB 1HE7A 5HHMD 1U3NA 4QGTA 1IKFH 1N8ZB 1HXIA 2VDLH 1T04B 1D5XA 3CV5A 1FCCA 4HHAA 4V2CB 2QVKA 2O5NA 5B3JF 4FYQA 5B1JA 4DVRH 5HVWA 3V8CA 1YLBB 2ITCB 3B9KC 1VEMA 3GK8L 4R0LC 5T5FL 5HY9B 5D5MA 1GYCA 1XGRA 2J8UE 3KW7A 1BGXL 4U1IB 4WFHD 3CZSA 1SEBB 4ADIA 2OMXB 4KMQA 1ADQL 3BH9B 1MLCB 2ARWA 5F6HJ 3RVWD 1A8ZA 1QD0A 4MA3A 3L4YA 2VDML 1M3IA 4XHJD 1GZHA 2YA1A 4BRJA 2OMWA 3KS0H 5K1NA 1UH3A 4J8RA 5GS0H 2YN5A 4A68A 3VFUA 3ZDZF 4GZDA 4Q9BA 4AUYA 4F7CB 4NURA 2NQ3A 3CBJB 3P3RA 5KSAC 4N3UA 5I0WA 3FNKA 2KZWA 4IULA 4HHWA 5CP7B 5CEXA 4JN2B 4JO3H 4F7PB 1S3KH 2JFCA 5HYQB 4OJCA 3X3GL 1H19A 2P2CP 3C6LD 5E9DD 3IXAB 1IEHA 3IDXH 3R4RA 4M8VA 5E8DL 4YGVA 4D0DA 1G94A 1RZ7L 1CICD 2Z9TA 3J5QB 3MCXA 4MD0A 3F04A 3HE7B 1F3DH 3HI5H 2WMOA 5KNHD 2EDRA 2PO6C 1JF6A 1FJ1B 2H45A 2V5SA 3KPRA 3Q6GH 4HZLA 4NO3B 3MLVL 4F5CE 2OMTA 2AJYL 1IAOA 4OJFL 1F0LA 5BRQA 3R4DA 2H1PL 1OPGH 5AQ0A 3ROLA 1U8QA 1T20A 4EZJA 2QHRH 3PNWA 3I02B 3BGMA 3GJEB 5T3XH 2JLBA 3DV4A 5EF1A 4OF3A 3E8UL 2MCG1 5HPMA 1NL0L 3DMMA 4LLDA 3SOBL 5KVEH 2A9NH 3HMWL 3JXJA 4KJQD 4UQ9A 1LO0H 2XHNA 5TFSH 1G6VK 3EJQA 4EUPB 4HOTA 1ZK5A 1KBGL 2K3HA 5GGVY 3S48A 3MEKA 3UDWC 3IIEA 1UYWH 4ILHB 5HYJB 1U3ZA 5DLMH 3BAEH 3RDTA 3V6BR 4OW3A 4AZUA 2DJSA 1NAMB 2YAFA 3PHAA 1IFGA 3FV4A 4XXCC 2CBTA 2H6OA 4J7WA 1TTAA 4LSPH 5FO7B 3AG4B 5JO0A 2I24N 1I1AB 1E50A 3LH8A 4MNGA 4YHLH 3IGLA 4NNXA 5IHHA 4Y5YA 4L18A 5AQAA 4P49A 3UEZA 1SXZA 4IKLA 1YA0A 3O6MH 2H9GA 4XNZB 3L4XA 3GRBA 4HJ0C 4W4NA 5I23A 4MAUH 3ONLA 2PWEA 5F7BA 3WS6A 3DPDA 3DI2B 1V55E 4YNYB 4QNPF 1E4KA 5F1SA 3V0FA 3OMNB 4PIBA 5EZLB 2IH9A 4PJXF 2OV8A 4NOFA 4LNUD 4GEIA 1EBPA 5GRVL 5EU6D 3WLWD 3SPHA 2D3LA 2CO1A 3UT4A 2NNCA 4HCGA 5HI7A 4MA7H 3AJ7A 3FRPG 4LIQE 4CDHA 2ZF8A 3MV3B 3CK9A 3EF4A 3QIBC 4PJ7F 1MCEA 3CWGA 1NJ9B 3HFMH 4WV1A 2ZUTA 1NBQA 2ZSVB 1I7TA 1F8TH 3B83A 3F58H 1MF2L 1FO0B 1MLBA 3PWLB 1WBYB 3T0DA 1WLHA 2YMXL 3NZ8A 1ZGLA 1X6NA 2RBLA 1VAHA 4POZC 5AYUH 2VDPB 3FCQA 5DRZB 1M71B 2NYYC 4X5XB 3TV3L 3CVNA 3VM7A 2DQMA 4GRLD 3CFKB 3UJTL 4ISVB 5CJXC 4GTOA 2HB0A 2DQFB 3FCSA 5DZPA 4A6YH 5JIKA 2UZXB 1RIHL 2EDWA 3MYJB 2ICES 2ZAIA 5CEDB 3EDJA 4UQCA 1OGPA 2EIJB 3QIWA 35C8H 4QTHB 1A6TA 3UBGA 3JWNE 5TH2B 3CFCH 3NIGF 3MV01 5L0QC 4NEHB 3VH8G 3SPVA 1ZLUK 4F8QA 1EO8L 2RQEA 1WIOA 1DLHA 3RX8A 5KYXB 1YEEH 4MQ7A 3LKUA 2E7HA 2VLME 1SVCP 1LNCE 2F58L 3UL4A 4JFFB 4CN1A 1TVBA 1IFHL 5EC1A 4RNRB 2AGJH 4XMPH 1ZDQA 3A24A 4B9KC 4WJKB 3S34H 1QSFD 4L2YA 4PIRF 3F01A 2XWDA 4KK8C 4F37F 4ZW3A 1TEGA 1OCWH 2HTLD 1W72H 2ZD0A 5BOZG 3CSYA 2CCLA 4XRCB 3AROA 2TMNE 3FN9A 5EN2B 2UZIH 3EYFB 3RWCB 2NY0C 4F1PA 2XVKA 4Y5VA 2FX9L 4GLRH 1CLZH 1YEJH 2FCBA 3QHFL 1DFBL 2G5UA 5B8CC 4ZZFA 4M7CA 1SLXA 4MHHG 2G3ZA 3HRPA 3KJ4B 4MXVE 4OCXH 4MAYB 3ZY7A 4F57H 3NQZB 4J2QA 2VSCA 1Q9OA 3TJEH 4JPKL 2AAAA 3QS3A 2AV7A 2X6VA 1A7OH 5MHSD 3KEHA 1TEYA 2JKTM 3DX7B 4D8PA 3L2MA 5AVSB 1CGVA 4U1SB 2Z91A 2VDQH 3MPCA 4FQXC 4NLAA 3QO1B 3MJ9L 4LASH 1DEEB 1PY0A 3NFSL 3MRLA 4KO7A 2YPKA 1CGWA 4HJGA 1NAKL 3UTZA 2X4PB 3H2PA 5GJTH 1XCQB 1E2WA 4RRPA 4M8UA 3IKOB 3TJPA 1A4KA 1XH1A 3RB5A 1PLGH 4NUPA 1OD7A 2ITDA 2VQ1B 3HPJB 3ZPJA 5DQJB 1E6OH 4OKDA 2BKGA 4BX8A 4WSKA 1M9WA 3QNZB 5KN5B 5L88H 3BZEB 1NFDB 4UOW0 2XZCL 4Q0XL 4NPYB 1C5DB 1MRFL 5L8PE 4HIIB 4FQXB 5HD8D 3ULSA 3D1MC 2ADIA 4TLNA 3DSFH 2ATAA 2PPAA 2CUIA 3IDYB 1WEJL 4HUVB 5GGTL 2J2ZB 3UO1L 2X6CA 1T0OA 1OP3H 4NHUB 4QHNB 2X5PA 5DRWB 4DAGH 1OALA 3DYPA 4C54A 4CC0A 3MROB 1SVXA 2VLRD 2WMPB 4HIPA 3ZGIA 3HXFA 4WDIB 2FX7L 2PL5A 4OCWH 4EI0A 4NKDB 5IB3A 1MCOL 1N64L 4JRXD 3U2IA 4I48A 3ARBD 4YSOA 1U8MB 1MFAH 1TZIA 3TNMA 2VLJD 2F7QA 1IBGL 2XG5B 5FFGA 1DQDH 2ZZUT 1OAXL 2KERA 4LCIL 1GZQB 3WUWG 4DSYA 1GIGL 2P48B 3QBTB 5I1HL 1QBAA 1WY6A 4UT6A 2GJZA 2NY4D 3IETA 3ABME 4LLWB 4WWID 4QYOA 4X9FA 4E42A 1MJJA 2EVHA 3BAIA 3GWJA 1RD6A 2IH8A 3U1SL 1DQLL 3C6EA 1WPCA 3MLXL 4KY2A 4QRRE 4XCEB 3TNNB 4O02B 1U8PA 3TXMA 1TCRA 1XH2A 3OKMA 4MZRA 4Z7OF 1SUJA 1ITCA 4FTDA 4L48A 3VXOA 3L8QA 4X7DC 4O9HL 4U1MB 1YEHH 5IM7A 1TLKA 4XBGA 4LSQL 3F2LA 1L0XA 3MA7A 3TZVD 5EUOB 4K55A 3NAAL 4I3RH 5BS0B 2BSEA 5IP4A 4D9QE 5E75A 3UTQA 4UM9D 1ZVYA 1TETL 3C5JB 2JB5H 2QSCL 4C56E 1AR1B 5FQ7A 3S4SG 2DLTA 3ATDA 3I6KA 4HAFA 1D5IH 4MNQA 2CQVA 1ID2A 3OQRA 1OAKL 3LEYL 4KROD 4XNXL 1LEIA 5ECJE 4PHXA 4E85A 3RTQB 5GGRY 1L7IL 4U49A 1G87A 3MMEA 1X5AA 3BVNA 3TBYA 2VR6A 5TE6L 3T71A 1YNTA 3TEUA 3HG1B 1JV5B 2D31A 1XDTT 4YO0B 3H53A 1EDHA 3ALXA 6CGTA 4HS2A 2XXCB 3ESLA 2KATA 4H0HB 5EO0B 3ZHZA 5D2MC 1NPCA 4N0UB 1Q9KB 2B8OT 2XJKA 1A14H 1B4JH 3EJYC 5CMAA 4Y6RA 3SY2A 5MEQA 5T5NF 3VYNA 2ZISA 2VZTA 1JZ6A 4JXTA 4Z23A 1BEYH 1QVOA 2Q8AL 1MHEA 1CN4A 3I4GA 1G6RH 4FGMA 4KRPD 4PLJC 5HTSA 2L04A 3QJUB 3VXUB 1IXVA 5AN8A 4U8YD 4UT7L 4WY7L 4J6RL 1P7BA 3WJMA 4TULH 5LQBH 2YEVB 4I6EA 5JIMA 5ID0A 2EUWA 2BSRA 4PRHA 2XBZA 1G7LB 1KTLB 1NCOA 2BIQA 1NCAH 4B95C 4KJPC 4WK2B 2WXKA 1I7UA 3O6LH 5I75B 3IAGC 5KG9B 4UQBA 1N52A 1B2WH 2OMZA 4M61A 2H0JA 2WQXA 4PRPB 2OR9L 4Y89A 2DYSE 4KX9A 1YY8B 1NGXB 1FL5B 4H1LA 5C7XH 4R7NB 2V2TA 3TA3A 4PV8B 4H8WC 3CFMA 3WY1A 2WP3T 4M56A 1O1RA 1WGOA 1UWGH 3G2UA 3RKDC 1JPGB 1JJUA 3PDDA 3PHQA 4Y1TA 3WELA 2ADGA 1EJOL 2E74C 3J7HA 43C9B 3HVEA 4AENA 2PCFB 2BHFA 4LEXL 4KUCD 3ASOB 1O6VA 2PW2A 3BEWB 3BQUC 1G7HA 5ETUB 3VXQB 4DEWA 2YNQA 1AOZA 3RIAK 5C0IA 2MKLC 3WGUB 1NBYB 1PZSA 2DEWX 1OK8A 4WW2B 5D4QA 4ACLA 1EHNA 3EFFB 3E8VA 4FP7A 3KL0A 3VFSA 3ZKMD 5C70A 5IB5A 3JBG7 5LWYL 2J73A 2JSFA 2PKDA 3V4PL 1A0QL 4OIIH 4Y4FD 4P29A 2YC1A 4C55A 5IJVA 2BTDA 4UQ2A 3IDJA 5D6CA 3BQUB 2CG3A 3NF1A 2EEXA 4G8GB 4KVCH 3OAYH 5T1DL 3V6OE 1T3FA 3UPRA 3T65B 4GAYA 5LP0A 1FCHA 4TNWF 2WWNA 3NG5A 1LL1A 5TK2A 2XWBB 3MUHL 2RKKA 4R96B 1B6UA 5CLTA 5CAYB 3MC0A 1TMCB 4OJDH 3QDGB 3MRHB 1HYSC 2Q3AA 2H6UA 1GRWA 3PL6C 3WG7E 4NZTL 3ZTJG 2CPUA 2XQYA 4WWNA 4PJDF 2IV9A 3GRWL 4NJ9L 1KLXA 2G2PA 15C8L 3V0IA 1PKOA 4OJYA 4M4RB 1MY7A 4EECA 5GS1A 2BMKB 3JWNG 4U8VD 1A7BA 2VLMD 3ATFA 3D85B 3MZGB 5H35B 4ZS7L 3UIYA 1CO1A 3DXMG 2IANA 1ZWIA 4GLRI 4Y4KA 5LIFE 5D5ME 3RGVB 2CUHA 1JWMB 1M7UA 2W65A 5LB1A 1GOFA 4ZZKA 3AXHA 3EBHA 1QI4A 4DQOL 4X5QA 4XCCH 4AIFA 3ZHNA 2AABH 3T2OA 3GKWL 1EX0A 5B1KA 4C9BB 3OKKB 1YNLL 5DVMA 3ARSA 2WZGA 3RJVA 3GI8L 3H8NA 1OB1A 4RH4A 5GJSH 2DWTA 4BSZB 2CBPA 1UEMA 1EHXA 5CS7A 2Y6TE 5J13C 3WIIL 1O1TA 1H2TC 2WLHA 5K9OA 1UG9A 4LKCA 3ZYZA 5CCKL 2TRHA 2XZTG 3PZ4A 3T3PB 4XZUB 2ZCKH 3NCXA 4HK3J 1LEKB 3UC0H 3EHQA 2QVMA 1KPRB 4ODUB 1JYWA 1U8JB 2CA4A 1EEQA 4Y2OA 3UTTA 2I9LA 3V0WH 4D9WA 2CO6A 2OSWA 2KKQA 3UIZA 2XPGB 1TJFA 1AE6H 4AYID 2RD0A 2HH0H 1FAKT 4U6VL 1V3KA 2X4QB 3G5VA 4AR1A 3ULVL 4KMTL 1K8IB 4B96A 4U4IA 1NEPA 2XWTA 1Y7VA 3KPRE 3TWCL 1AXIB 1UXSB 2C3VA 1UJ3A 2P5WA 4YX2L 3VMOA 3ZRCC 1NEZA 4QRSB 5AZEL 3BP5B 2GB2A 2ZSWB 3TVMD 5BVPL 5I28A 1DZBA 1QZ1A 1YUKB 1P7QD 2WB2A 1C1EL 4JZYA 1X5LA 2VQ2A 4MA1B 4X9GA 2NXZD 5IUCA 4G9FB 2I1JA 3BD5A 5D55A 5LN8A 4HUUA 2AJVH 4W70A 4HHGA 3WEAA 1BF5A 4F1ZA 2ENQA 1A9VA 1NBCA 2Z8SA 4HGWB 1BAWA 4HKJB 5EN3A 4N28A 1DJIA 1YEWA 5I0DA 3W39B 3N91A 4I13B 1CL7H 1J0JA 4RQQB 5FR3A 4TQHA 5CHNB 2KZTB 2UY1A 1OIOA 1EDUA 1R3KB 1SJEA 3HHMA 4O2CB 3L9TA 4PJIF 4Z7WF 1T89C 3EDDA 2VN7A 3WFCL 4M6NH 2V4LA 4V1DA 1YHPA 5IWLA 3N0PB 1MCIA 4GKLA 4WHDA 3MSFA 2X7LB 4MNGE 1GJUA 1NWOA 4HMDA 2CK0H 1TVDA 3Q0HA 5AOLA 4OOFA 3SGJA 4DTGL 4ODTH 4PRDA 1DTUA 1I9RH 3BDXA 3H7BA 4YZFE 1NA3A 2OL3B 3T77A 5BVJA 3GTTA 4TXVB 4OIAA 5K5YA 4FCHA 4Z7UB 3ASDA 5EOQH 2P9SG 5IHZA 1KYOJ 1ETZB 3L22A 4ZX5A 3C72A 4QRRD 4OZIA 5FM8A 3CHMA 4Y4HA 4GG8A 5BZDB 1CDUA 2GBUA 5BCAA 4C4KT 2D03H 3OF6A 4U1JB 2F68X 4KDTA 1BQHA 1XV8A 3GTNA 4MDIA 3MNZB 5I19L 4NUJB 3KPPA 3WHXA 2FH8A 2IDQA 4JDZB 2P3YA 1BM3H 1JI2A 3PU7A 4DP7X 2CBOA 4PREB 2RFXA 1TZAA 4HLZG 3FB5A 4JHUA 2YHCA 4PBDA 4PRAB 5ICXB 4D9QD 3HHSB 4JX0A 4LLUB 12E8L 4C56D 1U6AL 4AKPA 4BINA 3CUPA 5DK2B 1A47A 2P44B 4PJ9A 3RHWK 3I9AA 4E9VA 4GP8B 1R3HB 5DJCA 2OR7A 2F1EA 4AYDC 4P9HC 2HYMA 2J6EH 4PRIB 1G0XA 2VSKB 5JHDE 3OPZL 2CRIA 5I30H 3CLJA 3BIBX 4MMYB 4PSRA 2DTMH 2R69H 3AG3B 1NGQH 1GH7A 1U2CA 1NLDL 3N9GL 4ZFGH 2ESVB 5FA3B 4ACKA 5I71C 3CD4A 4BE5A 3G2VA 1DQVA 2GC7C 5DDHB 4QHLB 3ARGA 1KDIA 1A1MA 2E3VA 2JH2A 3CGTA 4GMTL 2IQAB 4QMEA 1JAEA 2MEJB 4EN3C 3TEZA 3RG1C 2A9ML 5F0LB 1PE5A 1JI1A 1GXEA 3INUL 3IXTA 2R2HA 3MNWA 5B38G 1ET5A 1EWHA 4ZPVA 2R7EA 4Q58C 2ENYA 1YMMA 3V9FA 3QFJA 1Y3GE 3ILPA 1SBSH 3H9ZA 1ZS8A 3ME0B 5FO9B 2JJWA 2X2IA 1AANA 4PMFA 1T6BX 4EN3B 4MAZA 2K45A 2Y9RT 1QG3A 1L5JA 4NZUL 4PH8A 1GS8A 4OF8A 2OR8A 4FKEA 1Q90A 3K46A 2C9SA 3Q3GA 5CEAA 1X7TA 4IMLB 1C8QA 1MIEH 3AWEA 3SKMB 5JNYA 1I1FB 3F5WB 3O9WA 1TMNE 2R0ZL 2VXQH 1GJIA 4BCXA 5EU7E 4XCYB 4AITA 1LO5B 1GGYA 4AL8H 1QUNB 2GK0A 2I27N 2AANA 5IQMA 1OARH 3GUTA 4A6YA 5EFIB 1ZDSA 2F74B 5IT2H 1T21B 3QJRB 2WWKO 3TG5A 2VUOA 4WK0B 1NICA 4OLVH 3VWKA 5EUKA 5FK9A 1WJ3A 2C9XA 5DYOA 4N8CL 3FQNA 5JC1A 3SHSA 5I1IH 5DLLA 2HO1A 1M1SA 4FG2A 2IFUA 3DSWA 4LHUB 3LV3B 2AXUA 1E9QB 2HRLA 3DSNB 4MSWB 3MJGX 3KR3H 1JPSH 3IWVA 4X99A 4JA9A 1QLEB 1Q8MA 3SDYH 4LP5A 4FA6A 5ACZB 4HQQL 1L9NA 4HFUL 4QHUA 1MJUH 5F88B 4ZO7A 3ILDA 5FEBA 1FFOB 3ZXAC 4Z3HA 3W38A 1NGZB 3ZL4L 5I0XA 2YHGA 4Z3JA 4H88H 3MJ7B 2TAAA 3GMLA 3S37H 1BVOA 2EICA 2ZOWA 2OM5A 5DVOA 3TBSA 4E0RA 3QR1A 4FFWD 1FNGB 3APNA 3IS1X 1P1ZA 2PM7A 2GRPB 2H2SC 4X80L 3GB7B 3GZOA 2NX5B 2JKLA 4OQ1A 2GIYA 1BZDA 4XNUL 3LKPA 2AW2A 3G08A 4O5LL 3BRDA 1RH8A 1VFAA 3VFWA 2PN5A 2IY0C 2CG9X 5F7UA 4QHPA 4ZFZB 4G24A 4N2NA 1HOCB 3U64A 3F7YA 4UNIA 4P59L 3CFJB 3JV6B 4G9DA 4G6MH 4NERA 3BAXA 1HSAA 2WBWB 2BW4A 3QIUB 2Q8BH 1A6VL 4U1NB 2VLKA 3VRLF 2R56H 1YZZA 5GRVK 4E68A 2BC4A 4C83A 2DLEA 3T4AC 1KGWA 2AEQH 4PCKA 4QF1A 1IM3D 5CZVH 3GDCA 2EDHA 3R8QA 2B0SH 3RA7L 4G83A 1KT2B 3W82A 4CZ2D 2JEKA 1AKJA 2CBMA 4N87A 4HUNB 1ZT1B 4NM8L 1PLBA 1E42A 1U8OA 3OTNA 2YO3A 2FQFA 3JUYA 4JHKA 2LFEA 4IU3B 4GXFA 3WDHA 4ZFOA 3TJHD 2CR0A 1MI5A 1VCAA 4MNQE 2X4UB 4JE4B 2C34A 3TN0A 5F1NA 1UM4H 4XT1C 4M6OL 3BEVA 2EE0A 3CHQA 2Q7YA 4PRNB 4APXB 1X5FA 5JLZB 4O6FA 2DQEL 1RK0B 1PZCA 1ORQA 2WW8A 1I8LC 3DC0A 1FBIH 5FYKH 1OM3L 1N6UA 1A7PH 3B5TA 4IOFD 1N4XH 3QUYC 2V4HC 3PYCA 4MXWL 3BQVA 3KPRD 5C0NC 4XMXA 2P45B 1A9BA 4AQ1C 4JD2G 3GMPA 2OJEA 5K9KA 2XT1B 2IH1A 5CZKA 3MCLL 5HGBB 1Z3RA 3ZKNC 4AEEA 4QQIA 4PWHA 1CL7I 4UIMA 3BKYL 3CSGA 4NM4L 3IFOA 4L05A 1FFTB 1F4YH 2WLMA 3DMMD 1PG7H 2FHFA 4O2FB 1DVUA 3I9GL 4CC4C 3HZ3A 3QG7H 3VI3A 4G5ZH 3FQUA 2N59A 4XPHH 3RPIB 3MR9B 3APCA 1DQKA 3MV8A 4JGUA 5LBVA 4G2VA 5E6ZA 1XEDA 4ZAKC 4AQ1B 4PRHE 4HNAD 4WU5B 4FG6C 1A7QL 4S1RL 2DL9A 4WI0A 2KHAA 5F7DB 4MCYA 3TBWA 3S8FB 2XVLA 5LVEA 5C09B 3PWVA 1TFHA 2MOWA 5HJDA 2CLRA 3AWGA 5DJXB 2JKIS 4OAWA 1TRLA 2HVKA 2KCLA 4R7LA 1I53A 1OD9A 3Q5MA 5JMND 1QATA 3WSQL 1JGUL 1OEZW 4AUUA 3GHEL 3P7TE 5J11B 3NFNA 1ASQA 4APQB 1TMQA 4Y6WA 1U8KA 3L4UA 4ICWA 1AGDB 4TRPL 2X4NA 3EH3B 4F9PA 3FT3B 5K9QI 1NIEA 1VESA 4N39A 1F4WH 5E6YA 4DZBA 1YN6B 5FYJU 1JWSA 2WD0A 3LRGA 3FO0L 5KJLA 4XBPB 1LEGA 5DT1H 2G60H 3OWRA 2A5EA 1KS7A 4I87A 1LO3H 3FT1A 5IQOA 3FYEB 1A7RH 1QEXA 4CU6A 2XWZA 1EFXB 1SDAB 1Z5LB 3HPLA 4LKXB 3ULVD 1Z3YA 2EADA 1Y18B 2VGLM 1WFJA 4AXHA 2ZX8A 2CH8A 1T1XA 3BE1H 3SYQA 2A73B 1LDSA 3VU1A 1G6RA 4XAWL 2C2LA 5DUJA 3FO2B 4GYBA 3KLQA 1TPXC 1JRHL 1WBXB 3EFDH 5LCVH 1ZVNA 2OMVB 3PWNB 1BJ1J 4F7MB 4KJWD 3C08L 1T7ZA 1VENA 4KAQL 4R5VA 3DO3A 5FO2A 3RL1B 3SE6A 1FLRH 5JHDD 4GS7C 4KXZH 2X40A 5AOJA 2HX8A 3NOIA 3EOBA 2A7OA 5TQ2H 1XCWA 1FIGL 2X6FA 4HLEA 2QMJA 2WZ5A 4PGEB 4Y2DC 5H94A 2XPZA 4XI9A 1OWWA 3QG6B 4Q6IB 3H56A 3I6GB 1TPXB 3FCUB 4GRWB 3LCAA 4MASA 5K59F 2D4FA 3HKZA 1E43A 2HJLB 1P7KB 2CGYA 1KELH 3KYKL 3NP3A 4A63B 4NN7B 3S5ZA 2OP4L 4QRQB 4KUZH 5IMKB 3QI9A 5DJYB 2BVUA 3NPSB 3PZ3A 2IANE 1AS7A 1T22A 1IT9L 2WB7A 2DQDH 4HXAL 1N12A 3NFPB 1OP4A 3OJDB 2KDGA 4U6YB 3A6BH 4POYA 5C9JB 1JNLH 1RULL 2E9BA 3L3JB 2XZAL 3DX1A 1KCVH 4HKXB 2NY7H 4IIZA 4LVNC 2FQDA 3QUML 1FFRA 3FQYA 2NY6D 3FF8A 4E9YA 2WYTA 2AXFA 3GINA 1SJXA 1VFBA 3QUHA 4HD9A 1D6EB 1RZIB 3VW3H 1XD0A 1ESPA 4YAQA 4GUCA 2G3MA 3L7EB 5CJ5A 1YEFH 5IBLD 2JJTC 2FEZA 4KNUA 1DJXA 1L9PA 4P5RA 5GGQH 3QRFM 4R4BA 4GT0A 4D0BA 4FU3A 1JFQL 1BD8A 1QSZA 1XL6A 2GRLA 2DQIH 3QUXA 1U58A 5CP3A 3UTTE 4NKMA 3V10A 2JV7A 3N6YA 4DPCX 1FORH 2YD2A 4U3XA 3ETSA 4HZAA 3S7JA 1KCSL 4R97C 5G5DB 2P5WE 3QPQD 5DJDA 3MV2B 3OKEB 3OPUA 3OL2A 4IOSA 1P5QA 5FCUH 2YPVL 2F18A 1S9VA 5I82A 2B16A 2GFBB 4M02A 3KGRA 4KVNL 3ESKA 5IIEB 5IBTL 4XEIG 1IGFH 4X7EC 2MNJB 1I1CA 3ZDXE 3UACA 2ZAGA 4RRPG 3MX0B 3LSOB 4WUUB 4ZYKB 1CGSL 3WJLA 1QWHA 4NDMA 2XA3A 3NTCL 2JK5B 1NLBL 2N1TE 5DUPH 1INQB 1MRDH 3FW6A 3ARFB 1X44A 2UUDH 3BLBA 3QXDB 3K72A 4K5OA 4R7DA 1BI8B 3PP3K 3V2OA 2BHYA 5EO9B 4PJ5A 2MCPH 1GGUA 4N2CA 4PN6A 1YUHA 1L4IA 2NW2B 2ZGDA 3BSZH 3MJ8A 3RAUA 3FXSA 1AY1H 1QWUA 2QQLH 1F97A 4V1DE 1UVQB 3SGKA 5TK4A 3V31A 2QADC 1P5VA 1E9PB 3L5JA 4WEUD 2K70A 2W9EH 4KJYA 4K7FA 1NGYA 3KEZA 2PP7A 5K1VA 1P1VA 4KXBA 4QNPE 5BUPA 3ZGHA 2EJ1A 2ZKYA 4TTDC 3E6FB 4UNUA 3T5XA 4FNRA 3H42H 2CDGA 1SDDA 2VXVH 1QYMA 2I69A 3QHZH 1Y6NR 4OZIE 5E70A 5F1IB 1W2KT 2K8QA 4WHTA 4X8GA 3Q1EA 4V11A 1WZ1H 1P9MC 1MCFA 5IEKB 2EYRA 2PM6A 2XBTA 1IGJB 1VZHA 2C4XA 3GO1L 2RAMA 4UOZA 5T3XE 2N56A 4P2OC 3SN6N 5DTFB 5E6SB 3CFDB 3QORA 3UYRH 3LS5L 5IESH 1HCZA 2YBRB 5KVEE 5LGJB 3WEMA 4QLWA 2OULB 4KX8A 3QULB 2R05A 1PD6A 3TYFB 1KROA 4ZTPL 2F7OA 2V7NA 5DD1H 1QI5A 3OSVA 3PDOA 4Z7QE 1VGEL 2X6IA 2NRDA 1NGPL 3LKQB 4L5FH 4O02H 4R5TA 2IALA 2J1ZA 1FL3A 4LVHC 4MNQD 3VAEA 3UZEA 5KVFH 1N59A 2CNZA 4N1HB 2XZDG 3GQFA 2VISB 1I8AA 5LOZA 1A9EB 3T6WA 1SHXA 2OQJB 5E56A 5C6PB 5BUZA 1S0PA 4PJGF 3ZT7A 5KSBA 1TT6A 4G7YL 3UABA 1WGVA 5JW4N 1KJVB 5DJAB 1ML0A 3U4TA 3MAWA 2WVVB 3QJZA 1GR7A 4NWTH 5ITFB 1N18A 5E95B 1NFAA 4ODBD 2BOBB 1MCWM 1BZ7B 2WZFA 2HTKC 5KVDL 1OSZA 3X12A 4PLNC 5CD5C 3QYNA 4D10C 4K3JL 2VXSH 3AU4A 2VTFA 3D3MA 2Y7MA 3N5AA 4PHZA 4JFEE 3MLWH 3KWWB 1K1AA 2WHVA 4JFPB 3ESPA 3MRFB 3NP4A 1VGKB 3T8XB 4MMXA 4TTGA 4HWNA 4XN9A 1YMME 3QFJE 4A2MA 3HC0B 1MFCH 3N1FC 5J1AA 3TPKA 4PRHD 5MENA 4ZQKB 2YZ1A 2PYEB 3HNVH 2VLLA 4OV6F 4UT9H 3U7WH 4BZ1H 1N94A 5I1AB 3SDDC 3UTSB 2FB4L 1G7IB 3OGCB 4NC1E 3RAJL 3LN4B 3VRIA 4OUOA 1KG0A 1KXTA 4FNUA 2FYYB 3DYOA 2MNUA 3P9LB 3QCTH 4HMCA 5I2IA 4BWUA 3L5XH 4JANA 3TA3D 4JM4L 4UUJB 2AXGA 4G71B 1U3DA 5KYYA 3AM8C 3EYUL 1N2RA 4YHOL 4ZDHB 2KMWA 3RI5K 2Y7OA 4YFLF 3WOVA 4H1LG 5ABZA 4BFIB 1ORSA 2XEHA 2J6EA 3V9CA 3ZL1A 3EYOB 3FTSA 1UZ6F 4K2UH 5BJTA 1LK3L 3PUKA 1C5CL 1JK9A 2E8ZA 1Z3GL 3FMGH 3HUJA 3IPBA 4FF9A 2FLRT 3IJSB 1IC5L 2R69A 4LCYB 1YPZB 4WF7A 1BQ5A 1SJHA 2F9BT 4P8QA 4DP8X 5AW5B 1UB5B 4I0PB 4PLKD 1LWHA 2E4FA 3PHSA 5IOKA 1HZKA 3B5GA 4L8DA 5I8OL 5G4OA 1CIDA 1H3XA 2PUSA 1JGIA 4UBDC 4HOWA 1RUML 1AGBB 2J9QA 3P0YH 2RACA 5EOCJ 2E56A 1UWXH 3C60B 3GJFH 5DD0L 4H26A 4U2ZA 1NSNL 4MKTA 3QUZC 3WE6A 2X2YA 3H9HA 4IRJA 3L1OL 3CK0L 3NCYP 3Q13A 3X2QB 5DMYA 4FG4A 3T1FA 3U9WA 2XENA 1YN7A 2CCWA 2A6DA 5AAPA 1L9QA 2EXWC 3QCVH 4H8WH 5DUMH 3G5XA 1ERNA 3CTTA 5AW9B 2WXGA 2EDFA 3VXMB 5IW6B 4ODXB 5TDOA 2BF0X 4JY4B 3R1GH 3VE0B 4AT6A 4KKBC 3CZFA 4PMEA 3RK6A 3IYLW 1AO7B 4N3CA 2VXQA 5BMFL 2TRYA 3UOAB 2PPCA 2GPZA 3EGXA 4YDYA 4NP4H 4AC4A 2HT2C 5D7IB 4GSQA 5I5IA 4OTXH 2X42A 3EFOA 3O6FA 2IAND 4FQCH 3FDWA 3Q1SH 3DURB 2DBJA 4Y4KD 2YSTA 4AMWA 3MSNA 3RWGA 1KFAL 2FWOA 3H7LA 2VLKE 4GMLA 4KTEH 4P3DA 4X9YA 2IXQB 4IIQA 4WI8A 4RA0C 4UTBL 3MRPA 3QDMB 3SKJL 3CXDH 4I9CA 2VQ4A 3MCYA 3TYGL 1HZLA 2CA3A 2DVWA 4BK5C 5J6GB 1KWKA 2F5BL 3AUVA 3LKNB 4KRLB 3UUXA 1U3HA 3KAAA 2HLFC 4RBPH 4A39A 1WHOA 3K81A 3N1MC 3S3CB 3WKML 3PDGA 4MLPA 1CVSC 1HX0A 3BAYA 5A6MA 3WFEL 2P58C 3PEVB 3GPEA 2C7UA 3JV0A 2ZYSA 2BSCA 4B94A 2E27L 3VXRB 3UM3A 2IFGA 2OMUB 1MI5E 1EMTL 5DMJB 3UTTD 2GSGB 3KPOB 1D5MA 2FX8H 2O6EA 1R5VB 2V17H 3EKCA 4MZ2A 4NYLB 4CNIA 3LDBB 2V2XA 4JZJC 1UKQA 3DBSA 4ZTOL 5IV2A 4PJBB 3DTXA 1OTUC 4U0UA 4Q94A 1NMBH 3FCGA 3FB7B 4WU7B 1CS6A 4UAHA 3VFMA 3BHBB 3OTTA 5IQ9A 3VB8A 2P5WD 2XCCA 2Z35B 2YEZB 1CC3A 1AG6A 4GKNB 3MBXH 1ZJBA 3RVWC 4UI9J 4I18B 4KXKB 2B1AH 2EXYC 5F7AA 3CZEA 4ZFFA 1ZLWH 2EH8L 4NJAH 3C3RA 1EO5A 1K4CA 1NEZG 1RUQH 2XS1A 32C2A 3DECA 3T08A 3WIHH 2OTUA 2HWZL 5CEZL 1OT8A 2PPEA 5FDWA 1I3VA 1JNNL 4Q9CA 3GBNH 1E3XA 4XH2B 3LKSA 2AXZA 1JL8A 3BZ4B 5TGBA 1T03L 1LO4H 1EEZB 4XOEA 3MV8E 3ASNB 3ABLB 1CGXA 4L4VA 3Q2WA 1MHPL 4PGDB 4F91B 3GSUB 4F2EA 2BVEA 3WXWL 1ZEAH 2QV4A 5GSVA 4HRLA 1ID5I 1EEYB 1FSKC 5INDB 4URKA 1N8ZA 5INCA 1OAUH 3IVKB 2EH7L 4RETB 3S35L 3E0GA 4YHPA 4V1DD 5FECA 3ZEFA 1CICC 1CFNA 1HHKB 2WYZA 2XY1A 2Z92A 1S46A 4GW4B 4HUXB 2ITCA 5HY9A 3CKCA 4MMZC 1KEGL 1JVLA 3OR7B 4GXVH 3ULVC 4A03A 4AM0Q 4U1IA 3L9BA 2X4OB 3DKHA 2OMXA 3GZQA 1XSJA 1MLCA 4AZ8A 3TLRA 1NCWL 1Q0EA 1QRNB 1AQMA 4BH8A 4WTWA 2HJKA 1FSKB 5AVQB 4YSUA 2AW6A 1OV8A 2WUCL 4G6AC 5TQ0H 3TO2B 3M07A 4KJQC 4AYMC 2EXSA 4YJZL 4F7CA 2K6YA 2X12A 3EBAA 4GAJL 3QGVA 3B9KA 1J9RA 4H2AA 4MMZB 1NDMA 3F85A 3NT0A 1FGNL 2Y7SA 2CJUH 5CP7A 4DVBB 2Q7NA 1INZA 4JN2A 2VABB 3WGVB 4F7PA 5T3XD 5HYQA 4XCYA 1G7JB 5HI3D 2OL3H 1X5JA 4XXDB 1PZAA 5DPEE 4OAUC 2E7BA 2Z1PA 3BU8A 3IXAA 3WO4C 3T3PF 2Q76A 3GEFA 1D5BB 1BQHG 1IAIH 4PUCA 4WNEA 2EDQA 4YHNB 3P73B 5B1BE 1CGTA 3V0JA 4IN3B 4LP4A 2W1NA 4PJ9D 3P77B 3DWLG 1FJ1A 2YQBA 3APMA 1XGUB 1K3ZA 3LZQA 4ZOBA 1DJYA 4DJMA 5AKRA 2P8LB 1IEAA 5FUOH 3ZE0B 4Q9QL 3GJEA 1IJ9A 3LPFA 4JG0L 5AB0A 4R3SB 4R8WH 1F58H 4ZUTB 1V7MH 4JO2L 2DWYA 5T3ZH 4JJ5B 3DPBB 3WLWC 2H6GA 3L3DB 2YGPA 3IMVA 3KGSA 1RV6X 5HJ3B 5ITBH 1IGIH 3ARGD 2APBA 1MELA 3L13A 4I4WB 4LBAA 4RAVB 5KOMC 5BZZA 1FHGA 1NMAH 3VQ2C 4AQOA 5HYJA 1IC4L 3FU6A 3TH4T 3MYZA 1I31A 2JELH 2E8YA 2GQHA 5BO1H 2F15A 5LCWJ 4JFED 1FG9C 3NA9L 3M8OH 4X7SH 1XL4A 3WIAA 4HOSA 1URZA 2EEBA 4X8XA 3RBSA 1YMMD 1OXYA 3QFJD 2FWLB 1P4LB 4K15A 5FO7A 4JRYB 1I1AA 1SN5A 3SDXA 2I60L 4P5TB 5F9JB 5F0PB 3MV11 3EUUA 4AQZA 2W5PA 4LLMB 4AGPA 4IYKA 2ICWJ 1KZPA 4YBLC 5FKPB 2EYTB 5EDSA 2CO2A 4XVOA 4X0KB 4YNYA 4P9HH 4YS4A 4NO0D 4DK6A 5KTEH 4UTAH 1UXWA 3MRMB 3LNEA 4Z7UF 4XXCA 3O9WD 1J8KA 5DO2D 2A9BA 1F41A 2VC2H 3H2WA 3K80A 1BX2B 2C8NA 5AW3B 1H3UA 1LQSR 2L0IA 3CC5B 4HIXH 3ULUL 1NJ9A 1CYXA 1MZYA 4IBTA 3ZTNH 2Z3FA 2ZSVA 4YBLB 1LQBC 4DP0X 3NIDB 3O6KL 1UCBH 8FABB 4FI6A 3DO7B 5I1LB 2EINE 1FO0A 2QQKH 2UX6A 1QTPA 3FU7B 3ISWA 3PWLA 2HTLC 4PFEA 4FNTA 5DRZA 1M71A 4YHZL 5C1MB 4AE1A 5C0BB 2FIRT 3K91A 4X9BA 2VL5A 4X5XA 4MD4B 2AEOA 4XP5L 3CV0A 5E8OB 3FQTB 4AVKA 3CFKA 3V2XA 2LOEA 2RCSH 1OGAB 2Y69E 4YPGA 1WICA 2WCSA 1J9SA 1P4IL 3BX7C 5AVUB 5J3HC 3QIBA 2UZXA 1PJ9A 1TYEB 2AQTA 1C5BL 2BJML 3IU4L 3MYJA 3PWJB 4WEMB 1IC1A 3BFQG 1SF5A 3IGFA 1L7TL 4DGVH 3BGFB 4M1GH 3QQ4B 1CD1A 5TH2A 1PEZA 4FG0A 4O1OA 3FP3A 5C07B 2HFGH 4BEIA 4G43B 5G4NA 2Z65C 4PJ5E 4YVUA 1BOYA 4GAGH 4HKZA 1YAZA 5GSRB 5KYXA 2ZWKA 4PJCF 4HS8H 3HEIB 3WKPA 3EU5A 4JFFA 4RDQF 2FRGP 4M7JH 1ZA3B 3MTRA 4AG4L 1QLEH 5AG9A 2L7UA 1MCHA 4W9CC 1BF8A 4W9IC 4UT6L 3KE0A 1P4BL 4FZ8H 3K2IA 5GRJL 1FZKA 4KXAA 3H3BC 2O5XL 4LVEA 1CFBA 1EQWA 1EAJA 5EN2A 1CZ8H 3D9PA 3EYFA 1N5AB 3RWCA 4DN3H 2EE2A 2BH0A 4OCSL 3V2AR 5HD8C 3IKKA 4B0MB 4L3EB 4PB0L 4F3FB 2VLKD 4M5ZL 4J7RA 3VWJB 4GQPH 4MAYA