4Z7IA

Crystal structure of insulin regulated aminopeptidase in complex with ligand
Total Genus 259
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
259
sequence length
867
structure length
859
Chain Sequence
b'KLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucyl-cystinyl aminopeptidase
publication title Crystal Structure of Insulin-Regulated Aminopeptidase with Bound Substrate Analogue Provides Insight on Antigenic Epitope Precursor Recognition and Processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 259
structure length 859
sequence length 867
chains with identical sequence B
ec nomenclature ec 3.4.11.3: Cystinyl aminopeptidase.
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF11838 ERAP1_C ERAP1-like C-terminal domain
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.60 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4z7iA02
1.25.50.20 Mainly Alpha Alpha Horseshoe Zincin-like fold Zincin-like fold 4z7iA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 4z7iA01
2.60.40.1910 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z7iA03
4XN2A 3EBHA 4L2LA 1HS6A 4XMVA 4ZW6A 3FTZA 4XMTA 2XPZA 4NAQA 3T8VA 4J3BA 4GAAA 3CHPA 4KXDA 3FU5A 4FYRA 3PUUA 2DQMA 3B7SA 3FTXA 2GTQA 3B37A 4K5MA 4R5XA 4KXBA 4XN8A 3EBIA 3QNFA 4KXCA 5C97A 2XPYA 4QMEA 3FTVA 5LG6A 4F5CA 4NZ8A 3B2XA 3FH5A 3KEDA 4XN5A 4XN1A 4XO3A 3CHSA 2HPTA 4FKEA 3FUKA 2R59A 4XO4A 5CU5A 4XMUA 2ZXGA 4HOMA 3U9WA 5LDSA 4ZW8A 3FUIA 4PW4A 4Q4EA 3B7TA 1GW6A 3CHOA 3FH7A 3CHQA 3Q44A 5BPPA 4FGMA 4RSYA 4PVBA 5J6SA 4PJ6A 3FTYA 2VJ8A 2XQ0A 4RVBA 4X2UA 4XMXA 4KX8A 3B2PA 5K1VA 5J5EA 3FH8A 3B7RL 4ZQTA 3FTWA 5LHDA 3FUHA 3B34A 4XN9A 4FKKA 4K5LA 4QUOA 4K5NA 4MS6A 4JBSA 3RJOA 4PU2A 5AB0A 4KX7A 3FUNA 3FUEA 1SQMA 5DLLA 4XMZA 5AB2A 4KXAA 1Z1WA 4ZX5A 3FUDA 2DQ6A 5FWQA 4FKHA 3FUJA 4Z7IA 3B7UX 5DYFA 4ZX6A 3FU3A 4XNBA 3FTUA 3SE6A 4QPEA 1H19A 3CHRA 4E36A 4FYSA 4QHPA 4ZW3A 4K5OA 4R5TA 2YD0A 3Q43A 4K5PA 4FYTA 3QJXA 4QIRA 4R5VA 4OU3A 4FYQA 4Q4IA 4P8QA 4ZX4A 3FU0A 3FTSA 3FUFA 3FHEA 4XMWA 3Q7JA 3MDJA 3CIAA 4WZ9A 3EBGA 4XN4A 1Z5HA 4XNDA 4XO5A 4ZX3A 4MKTA 4ZW7A 4R7LA 3FUMA 4DPRA 4ZW5A 4KX9A 5AENA 3FU6A 2HPOA 3FULA 4XNAA 3B3BA 4XN7A
chains in the Genus database with same CATH superfamily
4JW3A 2VISB 4R84A 3FONB 3F7VA 3IXTA 4NENA 1K6QH 3S7GA 1MI5A 5BXFA 3VG9C 3FCSA 3Q5OA 1X5AA 3QI9C 3X11B 1CLYH 4X5PA 4TSCH 5T5NG 1DJSA 4RFOL 3GXIA 5J1AA 4XXWC 2XSKA 4GRWF 1KB5L 4NDMA 1A22B 1WAAA 2HFGH 3QNFA 1DBMH 3KLAB 4G2AA 2VLME 5TF1H 1F6FB 4L8BB 1NCWH 3CVHB 3MZTA 4WI4A 4HHWA 1Q9OA 5GS3A 5CZRA 1EBPA 3SDAA 3IDNB 2W9DH 3I6LE 1JXDA 1KOAA 3S3DB 1KV3A 1HQRB 2MCMA 5FYKD 3RFRA 3TWCL 4ZFOB 1NKOA 4TQIA 4RA3A 1GY1A 2VXTL 2GUOA 3ASWA 2P5WA 4PJDE 4Z7UE 1A7RL 3APDA 4KH2A 5BQ7B 1MCSA 1ET5A 1PD1A 1A7QH 3X1EA 4TULH 2HX7A 4YLBA 3BWUF 3C5ZB 1IGYB 3ZTNL 1MXGA 3COOA 3OMZA 4JZNA 1HU8A 3L3OC 1AXSB 1I9JH 4X6BA 3RU8H 2WBJC 4F8QA 3ORJA 2NW2B 2F8XC 2L04A 2BIHA 2BCKB 3T04D 1RZJL 3HFFA 1TZHB 3DUUA 2AJXH 3SKUD 4JHBA 6FABH 3IPBA 1O9ZA 1PGRB 4AK2A 3BDYL 2J8HA 4YUEH 1ZLSH 3U6XS 1EX0A 3QCUH 1KJ2L 4MLIA 4HZLB 6CGTA 2HVJA 4EN3A 3MXWH 5JZ7D 1RZPA 1F13A 1JVKA 1TZHA 3DHJA 3TURA 1KUMA 3MGAA 4L4VA 4X6CB 4QY8B 4AJ0A 2D9CA 2IGFL 3BAYA 4R26H 4N4EE 2VAAA 4EN3D 1UFGA 3QZPA 1CTMA 4M93C 4AG4L 1F42A 2VDRB 1MHCB 5DD6A 3TL5A 4WU5B 2IEPA 4TNVK 5KYWB 3K1DA 2V2TA 1QZ1A 4IBZA 4TLUA 4TSAH 4OJDH 1TT6A 2WZPA 3MTXA 4KK6D 5JXEA 3CSGA 5F9OH 1QBML 4BWUA 1HXMB 4HEPA 4LARH 4QR7A 4KQ4L 4WFFD 4MVBD 1X9QA 2C9PA 5FFLA 5JA9A 1FGVH 3D39E 5LAXB 2ZONA 5DJZB 4MTMA 4MKTA 4FL4B 5G5DB 5GSVB 3U0PB 5DC0A 5JXED 5AENA 3B2MA 3LXBA 3Q5TA 2IMNA 5DA0B 2ZUUA 3OLEA 3N1MC 4PMEA 1U91A 2J8UF 3BZ4A 4LOEA 5GHWL 1RUML 1KIQB 1XAUA 4HPOL 4RDQF 3FXIC 3IRPX 1M7UA 3A4DA 4ABQA 1HSAB 2PXYB 5D7KE 5C0DA 4A7GF 4B5ZA 1WZLA 2R9HC 3E38A 1OD7A 3ZQ9A 4FYRA 1CXIA 2OJ1A 2OMBA 3D3VA 3KL5A 4JL2A 4U1IA 2GTQA 5EA0L 2EEFA 2DJMA 2YD7A 4S11A 3QZBA 5CHNB 1CICA 5KSVA 1E9OB 5DRZB 2OXHA 3OAUH 4PGJA 5J6GA 2AFNA 2WLYA 4JJHA 1KIRA 3GMQB 5F7YC 4NSKA 2AXFB 1CG9A 5DS2A 3MTRA 1MRDL 2MOQA 3VWJC 3VXSB 2HT3C 1NUGA 4JCLA 1W6WA 1NWPA 3K4AA 4QWWC 1KNOA 4FCAA 1XCWA 4XWOD 3H7BA 5DHDA 5DJXA 2ARJQ 1MG3C 1C08B 2GI0A 4I0KA 2GUYA 3KPPA 4AGLA 1NGQL 1RAMA 1U8LB 3MC0A 1WSST 2H41A 4MZRA 4R2GD 1HINL 4LSRL 1BAWA 1T1WB 3RHWF 4GBXB 3KD4A 3CXHK 1EH9A 4CU7A 5I2IA 2X1PA 1TJXA 2R4SL 5AQ0A 3FRPA 2OQJB 4ABWA 2Z35A 4TTDD 4PRHA 4PRPA 5E2VH 2YD3A 1U8LA 3KYMA 2WKLA 4QEGA 5IHLB 4R83A 2CU9A 3VXPB 1ZPLA 1A5FH 4K5NA 3B6SA 4G80A 3EF4A 1VFBB 1YY8B 3KS0H 2QQNH 1OCZB 1U6AH 5HI3C 3FUNA 1NJ9B 1S7RB 4HFUL 3W37A 1GSMA 4JFHE 2A6IB 5T1KA 4YHNB 4XMZA 4KJYA 1QNZH 3CDGB 4NC1E 4PRHD 4PRPD 3WO4C 5F9JB 2Y5EA 2Y1YA 3OSVA 5E5UB 3L3DA 2V2XB 4JG0H 5SWZB 4DP7X 1E27A 4X5WA 5HY9A 3M46A 1EEZA 1G0XA 1MVUB 1I7TB 3GSRB 3GXPA 3AU1B 3AC0A 4LCYB 1QP1A 4KZDH 1KLFA 4JE4B 1AP2A 1OM3H 2G2RB 3NEOA 3K7UA 1EHLL 4Z7AA 5HDRA 3HHMA 4KK9C 3EJJX 3STZB 3V7AE 3TIEA 5HVWA 4QHLA 3D1MC 3DXAA 3HCVA 1QTSA 1JN6A 1FNGB 2APSA 4PGEB 4OU3A 2FQFA 4DN3L 3PGDB 4N8VG 5IB2B 5EBMB 2JNZA 4FQCH 4KY1H 3ZDZF 4QRQA 4LCYA 1IEBA 4J5VA 1OTUC 2OYLA 1JF1A 2G30A 2J3SA 1J1PH 1JZJA 4FQ1H 2J44A 4O02B 5DUML 1L7TL 1UT1A 5I1HL 1S78C 3LQZB 2O26U 2WJ7A 3VFPA 3ARWA 4JFPA 1SN2A 3NA9H 5CEZH 3I02A 1HL8A 2YPLA 3VXMD 1EEYB 4ZUVA 4LIQE 2BSRA 3KJ6L 3LHPL 4JDTH 3MJ9H 5E8NA 4D0CA 1BFSA 2X4QA 2FYYA 2A4ZA 5CEXA 2XN9E 3QCTH 3D4GA 3HHSA 3HE6C 3Q2VA 4D9QE 3EADA 4NI6A 4QJ5B 5IP4A 1UVQA 4QF1B 2Y7MA 4UQ2B 4X0KB 4YDJA 5EC1A 5F7WC 4ZDHA 4GUPA 3IJ8A 4B9ZA 2IQAB 5TDPA 5IHBA 5JOFA 2GJ6A 5EF1A 4AC4A 2ZOWA 4ELME 3QIBB 5LIFE 2OMZB 1EBAA 1BQBA 5D71H 4A7GA 5HGAB 3E1F1 5IEKA 1DJXA 3BVDB 1XL6A 4RMRA 1SDDA 2WQSA 4WTZA 5DK2A 2O4EA 4WDIB 4WJ5B 1NBVL 4AKPA 2R2HA 1NDTA 5G4NA 5I1DA 4PTUA 2I7SA 4OIFA 2HUHA 1BP3B 5FUZL 2GT9A 3AS3A 4TLTA 4A7VA 4HAGA 3WY4A 1C7SA 3CQPA 3ZL4L 9CGTA 5B1JC 1NGXB 1RK0A 1LNUB 2HX8A 5L9DH 1T1ZA 3IVKA 3EJQA 4OZHE 2N56A 1CFBA 1I1RA 1Q1JH 5I8OH 1TQWA 1NPUA 1TMNE 2V8LA 3QUMH 2DAVA 2MJWA 3L3IA 1NL0L 5HHMD 5GQBA 4QXGH 3TBWB 1U8KA 4G1MB 3TEUA 3HIZA 4PSRA 5FCUH 2QGEA 1TLMA 1ZGLB 1WT5C 4JPSA 3P7PE 1R3IH 3NIDF 3HS0A 2E47A 4LP4A 4OD3H 4UQ9A 5DZ9A 1N4XH 1OVZA 2BNQA 1AS6A 3FFOA 1HDMB 3E0GA 3O2VH 4XNXL 5FO9A 1GGBH 5C3TA 1D5RA 3BKJL 5KYNA 5I75C 3FO9A 4UT6L 4O4YH 1RQ5A 4X6FB 5ANME 4AMWA 1I7UA 4GAGL 4X9FA 2XQYA 1P6WA 4BFNA 2X4NA 1DDHA 1U2YA 3KJ4B 4JGUA 2Q3ZA 4X6DE 3S48A 2WCSA 3U2SA 1Z6JT 4JCMA 3LNGA 4NRXA 5FUCC 5LO7A 4ZFGH 5MENA 3QPXL 5CCHE 3UH8A 1ZA6A 5JR1H 3OKEB 4MQ7A 4N2HA 1HIMH 4DP6X 3EFFA 4X9IA 3J7HA 1H3WM 2OSXA 4TUOB 1KELH 1MVYA 3DC0A 1HFUA 5MEND 3INOA 5E5LA 1I3UA 3NCMA 4UM9B 4P04A 2CO4A 4Y9EA 2FZ3A 1XEDA 4XE5B 4EI5A 3OKLB 4BV1A 1KXQA 1YEEH 2BDNH 3OX8B 1CBVH 2WXHA 5SWSA 5DJYB 1NCAL 1BQLH 1R24A 3DX2A 5FGRA 3U30B 4K94C 1JZFA 3F7YA 1TVBA 3PCYA 3DVNA 3CTTA 4F7CA 2AKRB 3P30L 1A3QA 1V10A 4PCSA 4AXWA 2LVCA 2ZKWA 3TV8A 3KGTA 2ZG2A 3CHSA 4KHXH 3CSYA 4ZBJA 5T5FL 4B27A 1JVLA 2R59A 3GMRA 4JY4A 3OKNB 1E4WL 2V9UA 2X05A 3ZKND 3GXNA 4PY8J 3BN9D 4IGBD 1IGIL 4HKJA 2A7GE 4H13C 1E8XA 1W8EA 2AI0L 1XGQA 2GBAA 3F12B 2XTJD 1RERA 1D7CA 2XY2A 4MKMA 2R15A 1IAIL 5D1ZA 3HMXL 5J8OA 4GW5A 2XZQL 3HNSL 3IFLH 4JPVL 5F9WB 3ESVF 3QJVB 3TT1H 5CILH 3H42L 2XQYK 2GSMB 4NZDA 3SE3A 1KBVA 3MRGA 1I8LC 1JFHA 4K71C 4BUGA 4GSUA 4PJ8B 4AR9A 2MPAL 3QJTB 3U2JA 5IY5B 4P9HL 3GSNB 3A22A 2M1KA 3HBPA 1JPGB 2ZG3A 5C6TH 1AKJA 3W56A 5D72H 1AGDB 3ERXA 3KNBA 4HK0A 3SDDA 2ATPA 3PIQB 4NO0A 1R19A 1ZPUA 3QXAB 1JGIA 1P5UA 4ZX5A 3RAJH 1FBIH 2NY0D 5C2BL 1X5LA 3WTTA 4M1GH 1ZHNA 1EWHA 4RNRA 2F5AH 3M8OL 3MLWL 4NO0D 3SDDD 1V7NL 4AENA 4DEWA 4J2XA 3VFRB 3H9HB 4FG4A 4K7FA 4BXSV 3O6KH 1OQXA 3BN3B 2ED6A 3RNQA 1MCKA 2GJZB 3NYKA 4K3JH 3FT9A 1VKXA 4N5ED 3EYUH 2P49B 4JE0A 1CXKA 2FJGB 3UC0L 4AQ8C 4FQHA 3VXRA 3QH1A 1R3KA 2IO5A 2Z93B 3MLPA 1H3PL 2VZ3A 1BEYL 4HCGA 2NUPB 3QRGL 3QQXA 3PJNA 1INEL 4BCZA 2YN3A 3E1ZA 1TKWB 2NZIA 5DRXA 3ZZQA 5H35A 3V55A 1G7JB 5DD5L 4UT7L 3V4VL 1GIGL 2MTAA 3QEHB 4MASA 2QQKH 5B39A 3VXRD 4JKMA 4PJIA 2WXFA 2ERJB 1SM3L 2FX9H 1FNAA 2V6HA 2NT1A 4DKAA 3ZKMD 4G9DB 4MCMA 4O5LL 5DC4B 1ND0A 3ZHNA 2OCJA 5ANHA 3SGJA 1T83A 2WP3T 4ZAKB 4DGVH 3SOBL 3BP5B 1A1NA 1DYZA 1OGTB 4JZJB 4X80H 2KT6A 3TBTB 4FMKA 5IV2B 2JKRM 1UKTA 3UTQA 3VXOB 4BHUA 3VXME 2O5ZH 1E6JL 5AVZB 3MSAA 1JZ6A 3AY4C 3JSSA 4MNHA 4I0PB 1OCOB 4V2CB 5TDOA 3T9WA 3ZSSA 1RZIB 1QFWI 4DK3A 1CFMA 3PHOA 4BQ8A 4GQRA 2G9HA 3RVUD 3BD5A 4L05A 1JXKA 3ARFA 1OAJA 3UZQB 1MY7A 4L8CA 1IC7H 3N42F 2K3TA 5AZEL 4YHIB 5IW6B 1JHKL 1NIBA 4RGMB 2GTZA 4XPHH 3HUJB 4YH6A 4GSXA 4KKNA 4DCQA 4XO8A 3LMJH 4Y19D 3NACL 3ARFD 5FHAH 3A21A 2VSMB 4NUMA 4RVBA 2WVVB 2AQNA 3RUGB 3CX5K 4HXBH 2C26A 3A67L 1XMEB 4EZKA 4ZMPA 5I1AA 4XBMA 1EAPA 2J8UE 3FW6A 5AW8B 1QI5A 1ZVNA 2ZX7A 4MSWB 4JM0A 3PV7A 5DEGA 5AOZA 3ZUCA 4B9CA 1F6AB 1AIZA 4ZS7H 4C56B 3SODB 4H25B 3ZJAA 4XMPH 2QV2A 3VA2C 5GS1C 1E90A 3QQ3A 3FSZA 5E8EB 2BSTB 3T3PB 1G9ML 2Z64C 1NOFA 2KZKA 3EYOA 5TH2A 3EDDA 1U8CA 5FYKH 1KCSH 4UV7L 4XC1L 1C8QA 3KE0A 3SZKC 4ABUA 4FLOA 3V95A 2D73A 5H37G 3FJTA 4CADB 4XZUB 1NKRA 5A2AA 1C9SA 4NHUA 5I1KL 3KLDA 3T0EA 3ESOA 4GIOA 5KJRL 2ZUVA 4XNYH 3CVIL 4JY6B 1MDAA 4JQIA 1EGJL 3WJLA 5DF0A 4I2XB 3B7YA 1AQKL 2ARWA 3MDJA 4OSUH 1KJMB 4LL1A 3UGEA 4PHXA 5D4IA 1V55B 1Y7VA 1AXIB 2OMVA 1EO5A 1OZTG 5HHXL 1KIUA 2DLGA 5CNHA 4KTEL 5EWIL 4AEIH 3MYZA 5F1IB 3L1GA 5DURB 3MLUL 4MCZA 3FHQA 1T5XB 3GMMA 3SKMA 1AHWB 2P47B 3L3JB 3UAJA 5KVEH 2ZUSA 4Z7WA 3VRIA 1B2WH 1CMOA 3GMOA 1IGJA 2J2ZB 3ABGA 5F1IA 4PYHA 3C2SA 1LGVA 4D0DA 3AM8C 4EIGB 3LY6A 3O6FB 1Z3RA 1QWUA 1QSEB 2X9YA 3BP7B 1Y18A 3FQ4A 4JO1L 4ONGH 1AQHA 2DQDH 1ZHBB 2HLAB 4GQPH 1DLHA 3V2AR 5BZDA 4BZYA 5IR1B 1WPCA 1JPEA 1GRWA 3TYGH 5D2LB 1HNGA 4RWYL 1X7QA 2QTEA 4HH9B 4N26A 3TZVB 1JPFB 4Q6KA 1JGDA 3FO1A 5KUMA 1F3JB 3HTLX 3QXDB 4J6RL 3VI4E 1ZHBA 2HLAA 4KKLD 2J88H 5AL8A 3WN5B 3P11L 2DRUA 3EGSB 4DQAA 5CFHA 1JMZA 3VE0A 2ATKB 4JPWL 2XG4B 2P8LA 2AGJL 5HJBA 4W93A 1JPFA 3ABKB 1CFSA 3P9WB 2J21A 3M1CA 1P5VA 2RQ8A 4G6AC 4WW2A 2IXQB 2YGNA 3VFUB 3VGAB 3KPOA 4ZMLA 3QUXB 1BD2A 1RCYA 1I53A 2HRHA 4P46A 2XTJE 4YHZH 3LNIA 3US1A 1H0DA 4ONHB 3ULUL 3EO1B 4A37A 5E2TL 4IJ3B 4F33A 1AXTL 2YEZA 4TPRL 4P46D 4CW1A 2OR8A 1QUNA 2BVQB 2VH5L 3BUDA 3GZQA 4RIRB 4L8DA 4ZTEA 5DYOA 3IDGA 3MSPA 3F7RA 3QS2A 5HDBF 1T03L 4XX5A 3HFMH 5KVFL 5KAQG 3QBTB 4OCWH 5LKNA 4LLWB 1HXYB 2G5UA 2VSDA 1A6WL 3VI3B 2VWEC 3QJFB 1TLPE 1P4LB 2FO1A 5H4YA 3GYRA 5D2NC 5AAMA 3QJXA 3W3BA 1CGXA 5DJDB 3VTMA 4N8VA 2FECI 2QELA 4GRWH 1YEFL 3TFBA 4AZ8A 1X5MA 3RZCB 1EIBA 4HDIB 1GPOH 5C09B 3ZMNA 1PL3A 2CMRH 3ULSB 4AYBA 4Z76B 4AK1A 3OD3A 4P5MB 4MJ6A 5F7MC 3VD4A 3CN2A 4IJTA 5DQ9A 1T4KA 1QMUA 1ERNA 4LCCB 4OD2B 1MHHA 2H2PC 2BIIA 4UINH 5E4EC 1LO0L 4UOW1 4UQ3B 3IU3A 4A7SA 3F5WB 1F11A 3ULVF 5C0GB 1UTDA 1J1XH 4N9GB 2H6OA 1ZEAH 3W2DL 5C07B 2FNWA 4H88H 4XZ4A 4G11A 1ZHLA 5D5MF 3VRLF 1E0OB 3B2UC 4KXBA 3IJSB 3TA3C 3TP4A 5TE6L 2H32B 3TGXA 3SSGA 4HG4K 3TESA 3IPEA 5F8QC 1T6VN 5BVPL 4Q97A 3DKHA 1AZCA 1JYWA 1C8PA 4DP4X 2XWJA 1QRND 1TOXA 3TNMA 2CJUL 1OSZB 3A24A 3SPCA 5AAPA 2PKDA 1A0QL 2XZAH 1GXWA 1T7ZA 4IBYA 1W91A 2NY4C 1DQLH 1A8ZA 4LPVA 1N5AB 3CK0L 1PYWB 1SOSA 1NAMB 3HPLB 3I6SA 3I50H 3DTXB 4JKLA 2VW4A 5B21A 3MBXH 3IE9A 4MD4B 5F7AA 2VQUA 4NQDB 5KYUB 2CO7A 5E9DA 3RX9A 3DSFL 2D03H 2R56H 2YXVA 2FO4A 2HT2C 4LHUA 3DO7B 4OJFH 2IAMC 3BQUC 5J1SC 1XB3A 2JFCA 2PF6A 1OW0C 1U8HA 2H4EA 1NMBH 3L95B 3KW8A 3NJVA 5E6IA 4XE0A 2YO3A 2WSKA 3QUZB 2KQNA 4JM2C 3QG6B 3RFZB 3B1TA 3WUZA 4EIZC 2MQ0A 4YR6A 4IDLA 3CU7A 1SJHA 4LHUD 4U1LA 2CO2A 4E42B 3BO8A 4MA8L 1G9EA 5TLIA 2VDOL 1DLFH 2MQ3A 2F74A 4Y19E 5E6ID 5L88L 2HWZH 1CD1A 1F4HA 4JREB 1KLUB 2XICA 3ZRFC 4L23A 1ET7A 1XGPA 2FEEL 2Z0BA 2A74C 2EIEA 1G7HB 4OI5E 1FDLL 1M7DA 1NBZB 1QEXA 5GRUH 3TIDB 4ARFA 4WGVB 4PJHA 1EXUA 4GW1B 2JJSC 3TCTA 4AMKL 3QQNA 3DIVA 4H8WH 1BSIA 4J6IA 1CDIA 2J7LA 5FAAA 3DX0A 2G75A 3ATEA 3RVTD 3SQOH 1KL6A 2WZAA 5FK9B 4AUYA 1KYUA 4AEHL 4YEFA 4OQ1A 2P80A 1GGTA 1MRFH 2HZHA 4HWBA 3UAFA 4TSBL 1T22A 2VABA 2P9RA 1NPCA 1DQKA 2B1AH 3RGVB 5IIEB 2QVTA 2PYED 3U4BL 3VXQA 3HS9A 4LF3A 4N5PE 1I3RA 2BSEA 1KCVH 3WKNA 1U95A 5BO0D 1AFVL 5F93C 4JHWL 1NAKL 4I9XA 3VXNB 3CPUA 5I1JL 1J5CA 1CLOL 4OCRH 4KO9A 5JHDB 1T89A 2WZ0A 5FF6A 3OAWA 4FNLL 5GGUB 1RPUA 2FGZA 4Y16B 1A6AA 1P2CB 2EDDA 4G9FE 3TLRA 3MMEA 2CUIA 4BZ2L 4OF7A 4X83A 2EZ0D 4ZW6A 4HFWB 1CFQA 1PD6A 1WZAA 2XQBL 2FTAA 3U6RB 1CIUA 1I9EA 1G9NC 1E7VA 1J5DA 2BFVH 3HN5A 3QNZA 4OLWL 4LSSL 2Q8AH 4ZMAT 4ZOBA 2YPVA 5JLZA 2ZT9C 1URZA 3D08A 1R3HB 3JWNC 4HKZB 3Q06A 3JTSB 4GPVA 4PGZA 1Q0YH 5D1ZI 2GJRA 1UXSA 4U3XA 1FORH 3CFIC 5EZLB 1KPUB 1GZPA 4X4XB 4GNKB 2UY6B 1T7WA 1PU0A 2W0FA 3P0VH 4XO3A 1E4JA 1GW0A 3VFSA 1WTGT 1FAKT 1FZJA 5CR1A 5JIQA 1NBQA 4XP5H 4Z78A 2OMTA 1Q9WB 3QEUB 1WC7B 1Z9NA 3VO0A 4M6OL 2J4WH 1WA2X 1CD9B 3Q5YA 4H20L 4WUUE 5DUJA 4DO6A 2EDJA 3MUGB 3QP3A 3ULVD 2VITB 3F04A 3GIZH 3HG1A 1LNEE 3UFIA 2FL5B 2A0LD 4LEBA 3V6FA 1YMHA 2MMXA 4HXAH 4Y2DC 1IBZA 5B7MA 4FNQA 1G7MA 4QRPB 3VSVA 3TVMA 3QEQA 4NQSA 5CINL 3AB0B 1KTKE 1TNNA 3DIFA 4GW4B 2E74C 4HOXA 1D9KA 2WOYA 4H26B 5IFHH 3PXLA 3M45A 1JZIA 1A7OL 1QR1A 1KEIA 3VFOA 4JFQA 1DZ0A 5JXAH 2IALA 2CM5A 2GABA 2BP8A 1KS7A 1KCUL 3RBGA 3LIZA 1A8JH 1B4TA 3QEQD 4YC2B 3G6JA 1D9KD 3EJSA 4Z5RB 2XACC 1AZUA 1BM7A 1YNTA 1YMMB 4HD9A 4E9WA 2DQUH 1OF2A 5IJKA 3VWKC 3FHAA 1GTNA 3QQ4B 4G6KL 1YYMH 2RACA 2DICA 4IRJA 3ATAA 4PWFA 2ORBL 2YD1A 1ILSA 4XHJD 1WITA 3V6ZB 3ZMEA 3BSHA 3D69B 5FYLH 3NZ8B 1YN7B 4QRUA 4HP5A 4TVPD 3TT3L 2VDML 1QEWA 1HKFA 3BH9B 4UANA 2VLKB 5KTEH 1X4YA 4YDZA 3FOMB 5ALBL 3V9EA 4BUHA 5EN3A 1RSYA 4L3EA 5EZIL 5I16A 3EJPA 1BBDH 4KPHL 3GMPB 4W4OA 5DUPH 3HE7B 4GS7B 3T0BA 3OC5A 5CJOL 4KKPA 1JNHA 3AW5A 5JPMB 3NN8A 5CSZA 3NIGF 5DJ2B 1P7KB 1KBBA 4LLQB 1PZ5B 4HD5A 4JMNA 3WIIH 1WVZA 4ODTH 3IFNH 4LGRB 1FO0A 5D4HA 4KVNH 1P69B 3T65B 4DP9X 1A7PH 1OAUL 4MD5A 3MJ7B 3K2IA 3MBEC 4B0MM 3QHTC 5E94B 3VD7A 4NCC1 2VT0A 2HT4D 4JJOA 4JRXB 4PR5B 2WNKA 2V5TA 4UV4L 4XOCA 4PJCE 4CL7A 5GZNC 4NP4H 2A9DA 4FI6A 4GFXA 1EJ8A 4NRYB 5CF3A 2NXZB 5HHVL 1OWRM 5SV4A 1QLEL 1SNRA 4YK4C 2WNGA 5E4IA 4BFBD 1BPVA 4Q14A 1FL6B 1LDPL 1A1OA 3MROB 4M5ZL 5E8OB 2Y6SD 2AVFA 2OTWB 3UP6A 4FN0A 4TQEH 1TU2A 1W72L 1HHKB 1UASA 4J2QA 1FC1A 3MV8E 4YBHA 5FYKU 3UG3A 1WBZA 1TYJA 1BBJB 1E30A 3QNYA 3K46A 4XX1E 2WTPA 2K6WA 2OR7A 2LTQC 3ISWA 1ZE3H 2UXVA 2B39A 3HMWL 1Z3GL 1QRNE 2WSPA 3L1EA 4NKMB 5JORA 2X4PA 3NPSC 2X4RB 2JH2A 3HG5A 3L45A 5LGKA 1KROA 2X70B 2P46B 1DEEA 3JWOC 1AZRA 4XMXA 2FATH 2XU9A 4KROC 8CGTA 2OL3A 3ECWA 1AR2A 4I13B 5EPMA 4PJDB 5EO1B 4Z7UB 3G5XB 4OVUA 1UKSA 1MWAL 2Y24A 4FTVD 4I7ZC 3LKNA 4WWKA 3BI9X 1U8NA 3G5ZA 2EDTA 2WC7A 2DEXX 1ZOXA 2CRIA 3TO4B 1BQHB 4AGOA 3FB5B 1W2KT 4M3KB 3RTQC 1IAIM 5KYYB 4GG6A 5EFIB 2P8PB 4APQA 3QPQD 1NZRA 2DI7A 3OQRA 4WWKD 2X12A 3H6AA 5I1EH 3RJDA 4Q9RL 5HHNB 1KN4H 3D0LA 1FNLA 3L9EA 3IU4L 2EDLA 4YWGL 1XCTA 2WWKO 5DD3L 3NMEA 3GLZA 1KEML 5DPEE 4CSTA 2JJWA 4CC4C 4XP1L 4APQD 3MR9A 3SY6A 4X7SH 4O2EB 3LV3B 4N2IA 4LNRB 2EYRA 3KEHA 3DX9B 1XGRB 3RY4A 3ZTJG 3EOAB 4CN4A 3PDDA 5FGSA 1Y1DA 2OXGA 3SJVE 2AS5M 4AM0Q 1E42A 4TUUA 2XOTA 4MZIA 4N1CA 2Z31C 1YJDC 2HFFA 3L4ZA 2X3AA 5IM7B 2YMXL 5LCVL 1CR9H 4JPIA 2PYEE 2OA9A 5JT9E 1DR9A 2XA8L 1RK1B 4JR9L 3TJPA 2D31A 2FT6A 4PS8A 4MXQC 1C1EL 4UBDC 3D39B 1WE5A 3CDFA 5IVXF 2F08A 3F05A 1O0VA 5IK3A 2C9RA 2R1WB 4NFDA 3GGWA 3IWVA 3V4PL 2M83A 3EOBB 1YEDA 5DMIH 3FZUD 3L5WA 5FYJE 1TQVA 2NY6C 3MA7B 5I6MA 3FQ2A 3GI9H 5KJ7E 4Y5XB 3D06A 2BPBA 3AZUA 3REWA 3FN0H 2JJVA 1A3LL 1OALA 5HDBE 2FBJL 3WNPA 4U1KA 4OFKA 3CVHL 3HLAA 4XAKD 2IGTA 3C60C 1PG7X 3WY3A 25C8L 3OZ9L 5I8KH 3L7EB 2CR3A 5L6YH 2YC1A 3DROB 5MEQB 2VLJE 4OV5A 2ZXDA 3U36B 5TMNE 1J1OH 2DQHH 3QISA 2E7DA 4JQIH 5AD0B 3SKOA 5FO2A 1S7TB 4K7PH 4TNEA 1IBHA 1TNMA 1WA1X 2B14A 4NERA 4X6EA 1S7XA 3GLAA 4JM4L 3D2TA 3VM7A 2VRQA 4Y4FB 4QHMA 5JIKA 5GS0L 2CDFA 3VD0A 2QADD 5AKRA 3O45B 2XNAB 1TEGA 3CC5B 2B9BA 2XKSA 3D2UD 3PAYA 4P23A 2X4UB 3DRQB 3VXTB 4ZSOA 1N8ZA 4KRPC 3O0RH 4K94L 3WG7B 5HHQB 2OP4H 5C0AE 4BSWA 5A3IC 4HJJL 4RRPG 5D5ME 5GRJH 2NRDA 3VRLE 2F54E 3G9AB 5I74B 2PCPA 4GXVL 4UB0L 1KACB 3IJYA 5CGYC 4D9LL 5F7KC 1FZOA 2A4CA 3MLSL 4LPXA 4TXVB 3UPRA 1I8IA 1CGTA 4KUCF 2VXUL 5F1NA 3OMNB 1LYQA 4MHHI 4HIJA 3SE6A 2QKIB 1FCCA 1KB9K 2JV6A 3CHRA 2BVUA 4CVZA 2GK0A 1YY9C 2Q2LA 3EJZC 4OCSL 3RA7L 3D09A 1CD0A 1MPAH 2NXYB 2NYZA 3X3GL 4NJAL 2WYIA 1CGSL 3L4YA 3POCA 5GISL 4OLXH 3IJEA 2Y1ZA 3CLFL 2NZ9D 3K3QA 4OGYL 5IMLA 5GGRY 1HEZA 1IGTB 5J06A 1YYLH 3KL0A 4MX7A 2PWDA 5KBDA 4ANVA 2QVIA 3OLDA 4UIMB 4PLKC 1ETZB 1RULH 4WEBL 4ZOCA 3K72B 2A9AA 2PWEA 1TETL 5AKTA 3BUYA 5KZCD 1F58H 2E56A 2FYVA 4J4PC 4XH2A 3NGBC 1WICA 1TIUA 5CO1A 1BIIB 1MLCA 3U7WH 5HYJA 2C7UB 3V6OC 1ZV9A 4Y1SA 3MREB 3NAAL 2F1EA 1ZLEA 4DH2A 1JYNA 1BOGB 3OB0K 5EU7C 2UX7A 2ZX8A 1Z5LB 3LOWA 5FOBB 2QR0B 5HYJD 1I1FB 3DHUA 2XN9B 3QUKB 5D7LA 4HLEA 1SXCA 2E8YA 2Q20A 4J12A 1N8OE 4DSYA 4NBYB 4UNTA 4JDVA 1PZSA 4OLYL 5IVXA 3QO1B 3FCQA 4BE6A 1XF3A 2FWUA 2JIXB 4C4BA 5JXNE 3PWVA 4OCNC 4AT6A 3GNMH 2QR0A 4U7MA 4NM8H 2D7PA 4Z7OF 4RMUA 4UQDA 3T0XA 4L8SA 4EOWH 5D7LD 1XGUA 3S4SA 3IB4A 3QDHA 2KC0A 4UZGA 1M2OA 1N64H 4PJEE 4U4IA 4ELMB 2ICEC 4X8JB 5FW7A 2ZXEB 1DQML 5FW8A 3SY0B 5F21B 2ODHA 4KX8A 5BUGA 5CN3A 3CFMA 4NEHB 3BSZA 5MI0B 3MRBB 5DEJA 3EO9L 4Q89A 5I0YA 1U8JA 2YJQA 1DSFL 3QORC 5KJ4A 2VLLA 3ILQC 2P7TB 2VDKH 1UM4H 4FNPA 5I71B 1G87A 3WD5L 3GUTA 1DUYB 2QFPA 3PUCA 5E0FA 2WD0A 1WFNA 1LO3H 4WI5A 1UB6B 3IF1B 3MLZL 4R6UA 5INDA 3ZE1F 1P9MC 4I89A 2J55A 2FWOA 1NEZG 3ARSA 4ZD3L 2R0LL 3BD3A 1ZT1B 4E41E 2R39A 5DZPA 3SDCA 4YDLC 1RJZA 3K5RA 4D91A 1MCQA 1F90L 2HH0L 3GLDA 5E2WL 2AK4E 3LX9A 1MH5A 3LKOB 3NUKA 4ZFZA 1G43A 4XVUC 3FTUA 2NY1D 3VNZA 2ZWZA 2AEWA 5D1QD 4KI5F 5DR5H 1GOFA 3GMNA 4I88A 4OZHA 1DUZB 4XPAH 3G08B 5SWQB 3GSXA 2APVA 4XTRC 2VMEA 4OQTA 3PRZA 4EUPG 2J1YA 1WAPA 5ANMB 4KQ3H 1RZFH 4TVUA 5BMFH 2ZJSL 5IJCC 3TBCA 4RAHA 4L29A 1M56B 3WAJA 4PUBH 3HB3D 1QFOA 3VUAA 3W5MA 1Z9SB 4X6DB 4J3TA 2OJZH 1LK2B 5CXPA 4NJ9H 2ITCB 1JGLL 4YSAA 4TUKH 1R5WB 3SKNA 5K9JL 5EC2B 3QWQB 4CN6A 5CLWA 1G5AA 3IYLW 2OZ4L 3WXVL 3NABH 4I18B 3TOPA 1L9NA 4KUCD 4B97A 1K8DA 3T6VA 4W9JC 2IWKA 1E8YA 4PD4J 3KXFD 1A7NL 1P1ZB 1RIHH 1AQ8A 4NQCA 5CEYA 3S5LA 3I6GB 3QHFL 1DBBL 4OI8A 3W9EB 1NFDE 4NCC2 1L3NA 4HUVA 2PTUA 2YD2A 4I8DA 4PLJC 3A0OA 4U3CA 3X14A 4M02A 3ESNA 3L4XA 1KPVB 1B6UA 4WCYH 4Z7QF 3KHOA 5HJ3B 1Y0LB 4LCUB 4FMFA 5E95B 5DJ0A 4IOSD 3Q8FA 5DHVA 4HWBH 5I9QC 1E67A 2ZWSA 4NLAA 4WNJA 2YBGA 2ZWNA 4OF6A 5FUOL 3UZVB 5BRPA 4IEFA 3HR5B 3JV4A 2VJ0A 2QPDB 5D7SL 2V7HB 3EYQD 5JW5B 4U1MB 3S2CA 3DOSB 4XODA 3OJ2C 3JVGA 3GSWA 2EKSA 4HAFA 2MNWA 1RIVH 4QLRA 2QQQA 4DZBB 4KRLB 4YDMA 1YPZE 3NIGE 3T8XA 4AKOA 3WFDL 2XRAL 3CFTA 2UWEA 3KBFA 4GINA 1BJMA 1ETB1 2NMSA 4ENEC 1BJ1H 3X13A 2AABL 1MELA 1K2DA 2E3VA 3IKCA 4FLSA 4RX4A 1BX2A 3KLSA 4RFNC 1KG0A 4JBSA 1KN2H 5IBLC 3BXNB 5IUCA 1XVSA 1XH1A 2HRLA 5CJXC 3X1FA 2VKWA 4KQ0A 3O3AA 1PSKL 1I75A 3BT2L 3D34A 3MOBH 2YZ8A 3N40F 5EMYA 1QBBA 3Q0HA 3PV6B 5E5MA 2X44D 3ULVH 1I1YB 2FLBT 2YD0A 1ORQA 4XNUH 1CO1A 2VZUA 5KVGL 1JUFB 1X5HA 2WB1A 5KSBF 1LL1A 2H8PA 2Y23A 3QIWA 1HHIA 1OAQL 2JWYA 4L0YA 1A21A 4PCKA 4B41A 4MNGE 5C0IB 1R75A 1CLZL 2XLLA 3QFGA 3MACL 2VXSL 5ADOL 2F61A 3FULA 1V3JA 5GSRB 1IM3B 3QIWD 1ILUA 1P7HL 1KBWA 3SO5A 1SOXA 1M53A 4GXUN 3MNWB 4AZUA 1OCWH 1T7VA 4GP8B 4OKDA 1RFDH 4AQEA 4R96A 3KS0J 4DGIH 3WTUA 2YK1H 2HFEB 3INUL 3R06A 5T3XD 2LQRA 5TGBB 4KI5D 3LIZH 3QFJA 5F0PB 1L7IL 12E8H 4M43H 1KGJA 4N2MA 4L0PB 4HX1A 5AYTA 1C5DA 3HZYA 2AJZB 4TVPH 5F6HJ 4XOAA 3IDUA 4GLRI 3SQBA 3GXTA 4GOSA 5LGHL 2D9QB 3BPCA 2DYRB 2HYMA 3QFJD 3TONA 4ESKA 4E68A 3RYMA 4P4KB 3ARGC 3LB6C 3VXMB 4PVNA 5E8DL 5GRZA 4WY7H 4NUQA 3U25A 2WXPA 2MHAA 4FQLH 1MHEB 4LCIL 5E9NA 1UD4A 3KWVA 4JFDA 4XP4H 4GKZB 3Q9PA 3RIFF 4AIEA 4F9PC 5CMAA 5H94B 4JO3H 3QUYB 1YQVL 2HCZX 3QA3B 4OZFA 2Z4QB 1YNLL 4X4YA 4YXHH 4MHHG 5A7BA 2NQ3A 3L4WA 3QDJA 3EYFB 1WQVT 2YR3A 4ZXBB 2VW7A 1B4JH 3S97C 4UTBL 1FO0H 1CBJA 2Y2TA 3QUYA 5ENWB 4XX1G 3QJOA 2C3WA 3U7YH 1LE9A 1ZWIA 4F7MA 3QR2A 1HE7A 2J8UB 1TF4A 2OPCA 1CZ8L 3AS0A 4JKKA 5D7HA 5GGTA 4X9HA 3RWHA 4NBZB 4X5QA 1F2QA 5IMMA 3O4LE 4PW3A 3KPNA 1WH0A 3CN3A 2AP2A 5DQJA 2FSEB 2V17L 4OFPA 2BVTA 1N6UA 3ZYZA 1M7IB 4L37B 1EO8H 5AKSA 3LS7A 3MA9L 3TWYA 4LDLB 2WAQA 2EDNA 2FD6L 2K8MA 3HI1A 1RP9A 5FM5O 3FMGL 1PTZA 3Q6GH 1M4KA 5F89B 1LP9A 4Y4KC 5T1JA 4AEFA 3W39A 3PWNB 5L0QB 3P1VA 5GS2H 5HGDA 5I66A 1MFMA 2AJUH 2BM3A 1DBAH 3QC6X 3ELAT 4Y2OB 5D1QE 3ZZLA 4KUZL 3D18A 4HMDA 4K23L 4O2CB 1CUOA 1O6VA 4NIKB 1L9PA 4R7LA 4GLRH 2OL3H 2O6PA 3GIVA 4P07A 4Q9BA 1JCVA 3LPWA 2WIMA 1FFOB 1NLBH 1PCXA 2NYYD 3W11D 4W9IC 4AM0B 1JZ4A 2PO6A 1XR8B 3FDWA 1W15A 4JN2A 4YSOA 1I8KA 4X99A 3S36H 4ALAL 1DN2A 1CTNA 3WUWB 3IM1A 4F3FA 4P5TD 3WTVA 1USZA 3P4MB 1S5HB 4I3GA 1FA4A 3QDMD 3FU5A 3O9WB 4MJIE 4YLCA 1G84A 3BZFA 1KDIA 2YSTA 1G6RL 1G7LA 1B0RA 2CJTA 2J25A 4RFEA 5FECB 1OO2A 3K6SA 1MREH 5DTFB 4WO4A 3WXWL 3MBWB 5F7EH 3FH5A 1OP9A 4XN5A 3MRDB 4ZO9A 4WWNA 2GTWB 4G6ML 3SDAC 4FKEA 3KXFE 1ZD6A 4KRNA 4Y1AA 1HKLL 3BVTA 5I18L 3EFOB 3SE8H 1U92A 1VGEL 2A83A 1NCBL 4IBQA 2PW1B 5T33H 2ZXGA 3RBSA 1WEJH 3BVNA 1J8HA 5C8JA 1E43A 1PZ3A 4JFYB 1CPUA 4QCIA 3TASA 3VGFA 3WKMH 1A14L 4GXFA 3S3BB 4F9LA 2Q2EB 5CCKH 4Y1AD 4XVTL 1NC2A 2VGLM 2IH1A 3MRJA 5FHBH 1RUKH 4YGVB 3A6CL 3KLKA 1J0YA 2RD0A 3BUBA 4ZMYA 4H0GA 4LBEB 2Y5TA 1J8HD 3US9A 3VI4B 1XF4A 1IVLA 2CDEB 5F7DA 1G9NL 3DBXB 3ECBB 4JNXA 1E3XA 2UVFA 4FG0A 3QZLA 4XVJH 4MB4A 4ZFFA 2FJUB 1UXMA 2PABA 2VZ1A 5KVDH 1L3WA 2CD0A 3D6GA 3F85A 4WUUB 4IGBB 4LB8A 3BEWB 3TJHD 2R0WH 5BS0E 1E40A 1KCRL 1FJQA 4JKNA 1Q0XL 1O6TA 2XTJB 3LN4A 3S88H 4OLUH 1OARH 4QNPF 3QWNA 2B5IC 3GZKA 3TNNB 2FQDA 2JI1A 1CL7I 1VADB 3HZVB 1N6QH 3PFUA 1MF2H 2KLRA 4LFHG 5KSAD 1HYRC 4MMXA 1FAIL 4HJ1A 5FKAA 4YDIH 2XX0A 1YNKL 4KK6C 5EEZA 5GGSA 4FJZA 1IAKA 2E4TA 2P1YA 4YXLL 3BGAA 3QI9A 5B4MD 2VDPB 3HNTH 4FFZA 4MVBC 1LEIB 4DPCX 4K5OA 3P69A 3F58L 3CDZB 1CDGA 1RJCA 1F02I 4H1LA 3ULAB 1HESA 3DDGA 3RIAF 3UDWA 4P8QA 5GRVK 3BKYL 4C83A 4RCAA 4MXWL 4Z7OE 5JXEC 3FYEB 2R8SH 4PBXA 4B9IA 1T3FA 3QI9D 3IMBA 1SJMA 3GB7B 2DWDA 1CGUA 4PRAB 2D7QA 3BH4A 4IS6A 1UA6L 4Q2ZB 1EFXB 3GI8H 4PS4H 4L3FA 4BH7B 1TLKA 3OB0H 3V0IA 1NM9A 3WL9A 3PNRB 2G60L 1JIBA 3PFQA 2DIBA 4HLZH 2P24A 3GK8H 3WMQA 2W65A 1HZHL 1SPDA 1PZ2A 2IDTA 3C6EA 1V3LA 5D55A 3SBWC 1WHOA 2BK8A 4JB9H 5LNGA 4A04A 1CDYA 2CLRA 2EE2A 4ZRGA 5I5MA 3BPOC 3NFPB 2X40A 5ELIA 3RL2A 2NSMA 3LCYA 1A4KA 1NC4A 3K8KA 4PJAF 3ZE1E 1DBKH 1ACCA 4MTWE 4PV9A 1BYPA 2CWRA 4G7VH 3TCLB 2DDQH 5IB1A 4W6YB 4L4JA 3OR6B 2JJUA 1CICC 1P4IH 3MRIB 4H2AA 4NCDA 4QMEA 3PPSA 2WN2A 4XWOC 3E6HA 3FT0A 3FUKA 1MLBB 2K7QA 3TYFB 5GXBB 2WBJD 4FLHA 2ZYRA 4M56A 3HZ3A 4MMYA 1KWKA 3GTTA 4R2GC 3S3CB 2V4LA 2LFGA 3U0TB 5F3HA 3X3FH 1N6VA 3X12A 4NQUA 2YD9A 5EZJA 3UGXA 1MZYA 1W0VA 1GJIA 1WFIA 4QHUB 1HHJA 1JNJA 2W5PA 3MYJA 4DEUA 1YZZA 1XT5A 1AQDB 3N43F 4FZ8L 1N0LA 3BDBA 4P2RA 4G42A 3NOIA 4KZCA 4J3OG 5GGVL 1HJBC 2FHBA 4IU2B 1N7MH 1KIPB 4Z0XA 1OB1B 1EZUA 2CHDA 4XCFH 5HPMB 1NEZB 2R29A 1II4E 4XMLH 2CCLA 2VDLL 3PDGA 1HT6A 5BRZE 3OKMA 5CIPA 4Y88A 3AXIA 5DK0B 1LNBE 3II3A 3RI5K 3ROOB 4L1SA 5GJSL 3SGEI 5MEOB 3D0VB 1KFGA 2VDNB 1F4AA 3I74A 4BE5A 4HJGA 4GKNA 2RCSL 4UM8A 3I3EA 4MB3A 4Y19B 4D2NA 3K2MC 3ZQWA 3KGUA 4FLRA 4H8HA 4ODWB 5ILTL 5CFAA 3WU1A 2C3VB 5IOKA 5C0BE 3PL6B 4KTDL 1ASOA 1XZWA 5CR8A 4DEPC 5F9AC 1CU4L 2BVOA 4FYTA 2Y2YA 1CDJA 2R1XA 1SOKA 3T74A 3RVVC 1MCPH 4EUPA 3J8F7 4L3CA 2DH2A 1A4BA 5H2BB 3BWSA 3SCMA 2ICWB 4NGHH 3EXLA 2YWZA 4CKVX 1KPRB 1XO8A 1VRSA 2XDHA 4HJUA 2O5NA 1QWHA 2R9HD 5DVOA 4DWHA 3T4AA 2ZUYA 3R4RA 5C9JB 1TCMA 4QJ4B 1K6QL 1U8IB 2CIIA 4FEMA 3SCMD 1CLYL 3QGOA 3MRFB 1B4LA 5DLMH 4TN9A 3OKOB 5TJWK 4TSCL 3WIHA 5D9SB 3BZEB 1QSFD 4AC2A 1F45A 1MY5A 2ZCHL 4L3AA 3ULUE 4Q8BA 3VWJD 1XGZA 2R23B 2J20A 4G9FB 2XKNB 2HT3D 2WOBA 2ZICA 2HFGL 4R5XA 1DBML 3U1PA 5IVZB 4WKZB 5TF1L 2X87A 1FV1B 1NCWL 2A4EA 2E59A 5JQ6H 4PB9H 3SPVA 2QZQA 2AEIT 4DGYH 2QEJA 3VG0H 2JF1A 3QYNA 3W57A 2W9DL 1BF5A 5CN2A 5B8CB 3QDME 1S7SA 2IPTH 3QNXB 4AWJC 4DQOH 1M1XA 5KVFE 3AMLA 3W5NA 1X5XA 2MKWA 4OF5A 3D07A 3ATBA 2Z7WA 4LMQE 3SGEH 3MLRH 3NQZB 1A7QL 2XG5A 4OQTH 4TULL 5KSBE 5CP7B 1AG6A 1HAUA 4YGAB 3B7TA 2OYMA 1NAML 1QA9B 3Q44A 1I9JL 2Z8SA 3RU8L 5E2UH 4PJ9B 1PF3A 3IAQA 4N0UE 3ARPA 8FABB 2BZ7A 5HJGA 2XN0A 1UZ8B 5GGRB 1MCEA 3PAUA 5HI3D 2AJXL 1LD9A 2UXFA 3QAZC 1PQZA 2OI9B 4U1SA 6FABL 4L1LA 2VERA 2OKMA 3NJMA 4YUEL 4BCYA 1VFAA 1ZLSL 2EABA 1XEUA 2QDWA 3MRCB 1NH6A 2EE3A 2ZKHH 3EAKA 4AJYV 3DI2B 4NC2B 4MDIA 1A64A 2EO9A 4AI7A 1BAFH 2XWDA 3I6KB 1DVUA 2M2DA 4AYDC 4F58H 3FOLA 3H9SE 3OV6A 2FT7A 4OF0A 3DGGB 5DFWH 4FFWC 1R0AH 3CZSA 4R26L 1FG9C 3ZPDA 4OKVB 2NUTB 3HR6A 3DVFA 4N6RB 3MSNA 3L81A 1XX9C 2ZXCA 3HS0C 3IJHA 4LLAA 2GB2A 2IDCA 2YA1A 5LAPA 4MXVE 3T08A 3V0VA 3IFPA 5F88A 1Q38A 4P57B 4XNBA 5EDSA 4NXSA 2B77A 2PCXA 2XPGB 2CCWA 3PJSB 4TSAL 2QHRL 5DHVH 3UBXG 3KCPB 2HLFD 2FWSA 7FABH 1YC7A 5F9OL 5D4QA 3TTYA 1B4RA 3IETB 2CO1A 3THMH 4LARL 4MNQE 4ZI8A 1WP6A 2IQ9H 4JDEB 3VH8B 2BX5A 1TQBB 2ZZUT 2IF7A 3C2AH 2WP3O 2F0CA 4FQQB 1AG0A 3DX3A 1OPGH 4ZW5A 2PMZA 3S34H 3N42B 3HE6D 1GSKA 3ZRCC 1CQKA 3C6SB 4AIZA 4DN4H 2OR9H 1UXWB 4QRTB 1EANA 3JTTA 4EI5C 4P49A 1O7DC 2EYTA 3CD4A 4GQ9H 2WXOA 3MGOA 1BVKA 5IHZA 4YLQT 4W9CC 3DI3B 3RRQA 5KSUA 4QHKJ 5EUOF 3N1FC 2IPUG 3OAUL 5EEVA 5AZUA 1ED3A 4HPYH 4UWQB 4JRYD 2Q76B 1J5OH 3FB6A 1BZ7A 3C6LB 1VHPA 3E6FB 3U2IA 5IQLA 3QB7C 1L0XA 4ZJ9A 5BCAA 5D1XA 1IBDA 4ELKA 2I9TB 4PJCB 2DEYX 2YD6A 4MJJA 3RWIB 5B38G 3NCFB 2EICA 1LDSA 5D7JA 1LLAA 4WGWB 3ZYJA 4XO4A 2L4OA 4AE1A 5CBEA 5E1IA 1TZIB 2W1NA 3MRPB 3E6FA 3S5ZA 4PWKA 4MMZB 3D9AH 5DUBB 1WT5A 2BLFA 3QGVA 5D1XD 2H3NB 1DQIA 3LDBC 2B0SH 1TJGH 1CB4A 5D7JD 4R4FH 1UWGH 3MV8B 5D1ZC 4QT5B 3UOAB 1YN6A 2ZYSA 4LLUB 2C1PB 2K70A 5ITFA 3ZE0E 4NHCH 3MRQA 5E2VL 5EOCH 4ANXA 3SE3C 2CPCA 1ORSA 1QRNB 4GRMB 5T3XH 1MRCH 4U6XA 2QQLH 4CDGC 2TRYA 2AEOA 1A5FL 4U7KA 4A2HA 2EADA 1E2VA 3H85A 2B2XH 3K4ZA 1IEAB 5DS8B 5ESAA 1WCBB 2QQNL 4EI6A 1XBDA 1AGBA 1U6AL 4P9MH 1PG7W 4QRSB 3IMSA 1MJ7H 2B9AA 4WV1B 5F9WC 5B22A 4PM1A 2E7LA 15C8H 1AOHA 3D7PA 3VFGH 1QNZL 4Z9KB 4EJ1C 3DV6B 1LWJA 2X53A 3WEXB 4JG0L 3NFNB 4PGBA 3NJLA 5HGBB 1CF8L 4JAMB 1SY6A 3LTVA 3WHE0 1X5YA 5SV3A 1P5UC 4RGOH 4ETQA 5DHYA 1OM3L 1RH8A 4HUKB 4PJGE 1QHOA 2FO8A 5EO0B 3DRTB 4N0RA 2C9VA 3VA6A 2O5YH 2ZSWB 2VRKA 3GHEH 3LQAL 3NFNA 1S3RA 4QTIH 1M1SA 4FQCL 3NFSH 2X42A 4KY1L 1BREA 1AY1L 5IW1B 3ROLA 4LL4A 3TN0B 3T2JE 1J1PL 5EF3A 2HG0A 3OKKA 1HXKA 1ZE3C 2VM3A 3KVPA 3AITA 4OFIA 2WHVA 3ME0B 4OZFH 1AGEB 3NA9L 3ZKMC 3MKGA 5CEZL 3D33A 3LZFH 3ZSTA 3CZKA 4LDEB 2HPOA 4FA7B 4XNAA 1ZS8B 4K9JA 4EIBA 4IHOA 4DKEH 5E4OA 4WNSA 2A6JB 4FNSA 4EXPX 4JDTL 3MJ9L 3DSNA 4GMTH 4WAFA 1GYUA 3FO2B 1QVOA 2WI0A 4O51B 3T1FA 2YBRB 3QCTL 4HKBA 1CXFA 4NKOB 3RGHA 4WNQB 2JCCF 1NCDH 2PYEB 1XCQB 3SGJC 1T83C 1D6EB 4QNPE 5GGTH 3ZDYE 3SJVA 1SMDA 3L3KA 3B8YA 3T8HA 1D5ZA 4A6YA 3PHQA 3LZLA 4NO2A 4NWTH 1QSFE 2BJMH 3FTVA 4Q6IB 4ZQKA 4JDZA 1ID2A 3M07A 1ACZA 4DZ8A 5D71L 4A2DA 1TVHA 2NLJA 3FQXA 3NSXA 5TLNA 5CU5A 4XOEA 4D9RD 3CDYA 1YEGL 5SX4I 43CAB 4NQVA 4EMZA 1HZLA 2BNUA 4NUPA 3E80A 5HDBB 5I1CH 4X8CA 2CR0A 3EGXA 5EU6E 5F0MB 1S7WA 1EJ6A 3D12B 3DUSA 3HZKA 5FGBA 3A6OA 1Q9LB 3H54A 3S98A 2HSIA 4TLSA 3D8MA 2HP4A 4FGMA 4GY4A 3ZTJH 2EVIA 1FFNA 1TTAA 1JV5A 1DQJB 3A23A 3BHBB 2PCYA 3BJ91 4AYSA 2W95A 1UH2A 4L5FH 1JNLH 4XAWL 5DJ8B 2NR6A 3PLYA 4JVUA 5FA3B 5L9DL 1Q1JL 1AE6L 3CH1A 3B56A 2OS7A 1WFMA 3QUML 3RWFA 2IBZY 3UIZA 2ADJB 3VW3H 4QXGL 2VLJA 4YXKH 2R2BA 1Q4NX 5GIRA 1MW1A 3GJFA 4UTAA 5F96H 2PP8A 4AQ8A 4HS6A 5FCUL 5FO7A 5J4MA 3RL1A 3H0TA 1R3IL 4AIOA 4PJAE 4G1EB 3JVFC 5FA3A 2P5ED 1E8WA 1L4IA 4F15C 1NGWB 1GGBL 3IKKA 4P5SA 4WW1B 2X7LA 5E56A 2HFTA 2XN2A 4O4YL 1Q72H 3MFFB 4FXKB 1NCNA 3Q9QA 1RZ8A 4LAQH 4HGKC 1G7QB 3UP1A 5C0AB 3V52L 3ZRSA 1E9PA 3EJRA 4F2FA 5D5MB 4J3VA 2F54B 5J6HB 4S1RH 2WUCH 1CFTA 3EJTA 3NJNA 4OZGA 4ZFGL 2RAMA 2VN7A 2DKUA 4FQPA 2IGLA 2QSCH 1MAMH 1T1XA 1TTGA 1UOKA 1XL4A 3CZFB 3N0PB 3T8GA 5JR1L 3T0EC 1HIML 3ZZSA 1FZMA 1KGYE 1YECH 4OF8A 1B9KA 3H53A 3WJLC 5KS9F 4Y9CA 1KELL 4NQXA 5J6HA 3IDIA 1M9SA 2XI9A 5C3LD 3AY4A 1IGCH 4XBPA 1FFPA 4AGPA 1JZHA 1KB5A 3VXUA 3V5KA 3QXTA 1GL4B 2LFEA 1JK8A 5DMKB 4LOFA 5G4MA 5CJQH 4NBXB 4WKXA 1DE4A 3BVVA 1MQ8A 3IGKA 2BDNL 3EBHA 1CBVL 1NQBA 4MAUH 4OZIF 1BQLL 5EU3A 1T7YA 1VESA 3UAJC 3DURA 3E2HC 1UJ3A 2LU7A 4MAYA 4QAWA 1A4JA 1HQ4A 1KBPA 1AD0B 3PE9A 1PZBA 3P9LA 3VMOA 2APFA 1BM3H 5E6SB 4KJQD 4J3UA 4OIIH 5LXVA 4K8RH 1DJHA 4KHXL 3CCHA 5CD5C 1KJ2B 2WMPA 3IXAA 4WI7A 3T4YB 4ZUWB 4KKLC 3MVSA 3GJFK 4H40A 3G6AA 1IB5A 2H0JA 4FFZH 1VIWA 1VGKA 3IBOA 2I24N 4JRYE 2X1XR 1Q94A 4H1LH 4YSUA 1GVIA 3EZJB 4R90H 4KKAC 5BV7H 1P6AB 3IFLL 3TT1L 3O3UN 5CILL 4WK4B 3RDTA 1F56A 1GJUA 5F3FA 1I8MB 2J71A 3NESA 2CKNA 2DM3A 1CGWA 1UURA 3IDYB 3QCVH 4WW2C 1J8SA 5DJCB 5IF0A 1XH2A 1U93A 2WNXA 4GIAA 4P46C 3FQUB 3HC0A 3QQDB 4W70A 5E00A 5FGCB 3B1UA 3RDTD 1AGCB 4ZTOL 4ORZC 1RK7A 5K5YA 5F1SA 4QUOA 5MERB 5IGXH 5I6PA 5C6TL 5D72L 2MFNA 1HHGB 1AD9A 3DO0A 2BSBA 2ZOLB 3U9UB 5ECGA 1N3NA 1BLNB 3EIFA 3RAJL 4PJEA 1FBIL 4R4BA 2FHCA 4M1GL 3QAQA 2N1TE 1HH6A 3BPNC 4WO0A 1OGAE 2F5AL 2I60H 1RPKA 2VDQH 1NFKA 3R19A 1KTOA 1SYSB 2DYPD 3ARZA 3CZGA 3D4ZA 4HCRA 2DJUA 3H8NA 1ZTMA 3CX5J 4FTVB 3O6KL 3G9VA 1HC1A 3P2TA 4E41B 2VQ1B 4PY8I 3Q43A 4HS8H 1EUUA 4GP5B 4K3JL 2FX8L 5EUKA 3C08H 3EYUL 5AAMC 1WHPA 2AK4B 2CUMA 4IBTA 1BLIA 3EXJA 4JK0D 3CIAA 2BIPA 4B5EA 1RZGB 4JM2F 3ARTA 4JGMA 2CAKA 2QQKL 4YSQA 5C0NC 4XT1C 4X7FC 4PRDA 2FX9L 1YEIH 3FFCD 2R29H 5CZKA 1L9OA 2I25N 4LU5L 2NY3C 5CIPH 1SYVA 4WQOA 4P59L 1COBA 2ZXAA 3GO1H 2DQCH 3C9NB 2IWEA 4PJFF 2FX7H 5I0VA 5KS9A 2EE0A 2I85A 4N68A 4EKJA 2AQ3A 1UACH 4IIQB 4LASH 2O5ZL 3CWGA 3EBIA 4J3WA 2CQVA 3TBYB 3ABZA 2BOCB 2AJVH 4HBCH 2OMXA 3MNZB 4HUCA 5FWRA 4LLVB 2MTPA 3NZHH 2E27H 5BVJB 5AB9A 3ETBJ 1MCOH 3WFZA 4Z3EA 1RVFH 3KGRA 3MNVA 4M1DH 2K1MA 2VR5A 1YUHA 1UQSB 3U83A 1VB9A 4G6AD 4P3DB 2EECA 2VJXA 4UUJB 4XPHL 4KH9A 3VMPA 5DZAA 4EUPH 3EW3B 3DPBA 4OM1H 5HHOD 3LMJL 2GCYA 3UMNA 5FHAL 2YAMA 4GAJH 4XBGA 5DEZA 1FFQA 4DVBA 3N9GH 1NFDA 1E50A 2Q6WA 1E4KA 1XIWB 1BWMA 5E6IC 2VZVA 2Z91B 5DVKA 5C7XH 1UEYA 1GZQB 3WS6A 2Z92B 1OWWA 1ONQA 4M3HA 2W92A 1Z9PA 3HG3A 4XMPL 3WIHH 1GHFH 3C09C 3DJ9A 2OBGA 4QRRA 1YPZB 3NIGB 2ESVE 4U0RB 1JZ2A 5FYKL 1KCSL 2K4WA 2WZ5A 3GKWH 3KLLA 1HNFA 4P48A 5EUOE 3RVTC 3UBXB 2HXAA 4XCEA 1GS6X 2DBJA 2I07A 2IANA 2JELH 1X6LA 3AREA 1CJYA 5DYFA 4JREC 4TQHA 4QRRD 3JT0A 3I9AA 3DLQR 3BGFB 2A2QT 2QADB 3P9MB 4O9HH 4AQAA 5ID0B 2P5EE 2BNRA 4IYKA 1CFNA 3D2UB 5TDNB 2RMNA 1XGYL 4QYAA 4XNYL 1NSNH 5ERWA 1A2YB 2DZEA 2YUZA 5HYQB 2BRRH 2I7OA 1JWUB 1EZVY 1QOKA 2H2PD 4GEIA 3ARED 1TSHA 4LEXH 4OSUL 3QO0B 1DFBH 2DF3A 3H9ZA 1INQB 4BQCA 1IBGH 4AEIL 5L2KA 4KX9A 1THAA 3IDJA 1T89C 3B2UD 5CD3A 4I1PA 3GBDA 3CAFA 4ODUB 2JCWA 3ZLQC 2KDGA 4KK8D 4POUB 2N4IA 3JUZA 4MNGB 3PQYA 1B2WL 5I8CB 4ZO8A 1AZZC 4UIKH 5L2KD 1DVFB 2PP7A 4LLYB 1H15B 2NY4D 2HVKA 2V2WB 3QH3A 3MV01 4JO2H 5L8LB 4KKQA 4QHNA 3FRUB 4XCYB 8TLIA 4JM2A 4N2LA 4KZEL 4N0FA 1I7ZA 2VYRE 2DQDL 2N7SA 2BS9A 3HI5L 3EF7A 3PQYD 1FH2A 4ONGL 5KN5B 5DD1H 2GITA 3L7FA 3WNNA 2HT2D 4NZUH 1TJHL 2FJSA 3TYGL 2IAMD 3BQUD 2QMKA 5B38A 5BO1L 1MJ8L 4L1DA 5I24A 4JM2D 3ULVC 2J6EL 2J88L 1DL7H 2BVEA 2YAHA 1HILA 1SUHA 1UOWA 3LIUA 2FJHB 2Y3AA 4BFIA 1TJMA 2PETA 4O58H 4UAOB 1BVLA 1EJFA 1ADQA 4DOHB 2WTOA 5IBTH 4KXZI 4HEMA 4F80A 1THLA 3HG4A 4RQQA 3WS3A 4Z95L 2AHIA 5I5JA 2RR3A 4P2QA 3N85H 4ZPTB 2NW3B 5DSCB 4HG4J 4ZUUB 4FS0A 5C08A 3HC3H 4Y5VA 5JHAA 4F37K 1XH3B 1GA2A 2EIDA 4MA3A 1FLTX 2H7WA 5G4OA 3TVMC 5IJVB 1SFDA 1A6TB 3P4LA 1CVSC 2KHAA 3GT6A 4LLMA 2Y7QB 5I73B 1D9KC 2FH8A 1GGUA 1I4FA 1L5GA 3FT2B 3OWEA 2JCCE 2RH0A 1UOVA 4FFTA 3CQQA 3KLQA 1UM5H 3EYVA 4M8RA 4QXTB 3B9KA 3OTTA 1ZSDB 2A3TA 3F84A 4QO1A 1SHMA 1FG2A 2DIEA 1TO5A 2B4CH 3PWPD 4NYLB 3V0EA 1WZKA 3VFTA 4OCWL 32C2A 4BKLB 2E75C 2ZWKA 1E7UA 2C9AA 1ADWA 4XHJC 1GR7A 3E8UL 5TTRA 4X7TB 5A16B 4B9PA 1ZV5A 2OV0A 1K5NA 2ZUXA 5IJKC 1XF5A 1DJIA 4E36A 3QIUB 1PFOA 1WLHA 1GCYA 3O4LB 2QPUA 1ECYA 4IRJC 2F68X 3OXRB 3QQ9C 3WJJA 1D5MA 1UB5B 3FU0A 5TPWH 1GPOL 2CMRL 1LK3H 1TYRA 1JTPA 4H57A 5DWUH 5EORH 1PIFA 2A7BA 3K0WA 1H3UA 1SBSH 4IK6A 4W4OC 3IFOB 3VGEA 4ZUSB 2W60A 4G7SB 4H2CA 4UINL 4Z7VF 2HT4C 2XBZA 3S3SA 1PKOA 3CFDB 3U46B 1H6UA 1J1XL 2NY1B 1J9SA 1ZEAL 3WCYA 4F2MA 5D1QB 4U05A 4O2FB 4ODVH 4APXB 1V3MA 1TG8A 5T5FA 4G7QB 2WVSA 4H88L 5FCSH 4KKZA 4WI3A 3K5SA 4EZLA 5BQDA 4Y4HA 3OR7B 1WS8A 3KVDD 1U8OB 1T04B 3QDAA 3HB3B 1MUJB 1SY6H 4YIQA 2YSSB 2GIMA 3MAWA 4LKXB 4Z7NE 2WTRA 2XZAL 4F5CA 1DQLL 4MJIB 4Y4HD 2Q5BA 3N41F 3H55A 3I50L 2X10A 1T0OA 1BQSA 3MBXL 1ZT4B 4JVPA 4QI3A 4OJAA 1MKFA 2ZWLT 1BG1A 1G7IA 3BRGC 2LU5A 2APBA 1KTLB 4IOIA 4JLRB 4Y2DD 4ZMQA 4LRNH 2R56L 5JUEH 1FYTD 4GRLA 3ILPB 4OJFL 1S4IA 3P77B 1U8QB 3W0WA 5KVGE 3EH2A 1NMBL 3KXFB 3KWWB 4FXGB 1AZNA 3GSQA 1O9WA 4EDXB 4M48H 5JMOC 4HBQA 1NCOA 1XZ0B 1F2XK 4R7NA 3GSVB 3O11B 3QDGA 4HWZA 2F7OA 2X4OB 2BP3A 1MCLA 3CUPB 4IKNA 5EU5A 4BQ6A 5G55A 1UXLA 3WE1A 1DLFL 2OSLA 2HWZL 3SBQA 3H3KA 4WWKC 2B8OT 3D85A 4AQ1B 4HWNA 3DVGA 1EERB 1FNSH 3DNZA 4X4KA 2XT1B 5BZZA 3FVPA 3VWKD 1XTMA 1ZVSA 1E28A 1JGUH 4HF5L 5JIIA 1DN0A 2OSYA 3B9EA 5GRUL 2IBZX 3QG7H 3HAEG 3NJGA 5KBMA 2YMOA 4PS7A 3TEWA 2ROYA 5K59F 5J11B 4APQC 3GBMH 4H8WL 1Z1WA 4K2UH 4ELDA 3G04B 3V4VB 2AQ2A 3D85D 4A6YH 5JPNB 4HJEA 3M86A 4LVEA 1RJYA 4ODHL 2GBVA 4K3EH 1ZHKA 1FJ3A 2XWTB 2WQXA 3QZNA 2O1AA 3U82B 4QOKE 3TPKA 1M2VA 2YFOA 4A2FA 5CP3A 5BS0A 1N59A 4JANA 1KCVL 5FYJH 1LEKB 2XXMB 2OJEA 1WDAA 1IQDB 3BFQG 1N70A 2OMYB 4JQXA 4PG9B 3Q7JA 3KMDA 1XGTA 5EOTA 4OCRL 2XVBA 2F58H 3U4AA 3BP6B 5GZND 4I3SH 4JJ5A 1JERA 3PWUA 2ALWA 35C8H 4Z7OB 5T1DH 3QYMA 1DVQA 2J1ZA 3GSOA 1FVDB 3L16A 2DJ4A 4L9LB 3U79A 3CZLA 3MUJA 2BFVL 2YQBA 3IGAA 1U3ZA 4LE8A 1WAEA 4AYFA 1EZMA 1GGCH 1JPTH 5FB8A 4HHAA 1W0WB 3GJFH 3MODH 4UTAH 1XF2A 1OE2A 4OZ4B 1YA5A 4P2OA 4XNMB 1BEXA 3B3IB 3ATDA 1Q0YL 2Q7YA 3PHAA 4J7RA 4PBDA 5L4JA 1FORL 3FT4A 4FQXA 4J3SA 3P0VL 4Z7VA 4GO9A 5F97E 1QPXA 1FNHA 1T20A 3DJRA 3BUIA 4XP5L 1NGZB 1QO3A 2G5BB 3OHXA 3VRJA 3ZE1B 1KWGA 1VFUA 2Z1PA 4KHTL 4KROD 1XR9B 1FJOA 1WFUA 4ZMXA 2XTSA 5T3ZD 2J4WL 1P4BH 4HK3N 2GSGB 4JG5A 3BUTA 4PRIA 5IMKB 2DMBA 3HZMA 7PAZA 3CXDH 3GIZL 1EHKB 2XIDA 2BW4A 4W81A 3ARDB 4RFOH 4P4RA 2AZAA 3FTYA 4K15A 3R8QA 4DPAX 5HI4C 4HXAL 4F8LA 2Y07H 1KB5H 1WK0A 3RTQD 1IFHH 3EDKA 4U31A 5B3JF 4PJ7E 2W07B 4LP5A 5L4IA 1HSBA 3FB8A 2J8OA 1AJ7H 1NGYB 5IFHL 4KNUA 5K9OA 5LHDA 3MFGB 4R0LA 4DUVA 4P23C 3FB7B 4NWUH 1WBXB 3NQIA 3RB5A 5JXAL 1TCRA 5CZVH 3TWCH 2V7NB 5AVWB 1TZAA 1JK9B 3RWGA 3HNVL 3BPLC 4MQXD 2MOVA 3MO1B 3OPUA 5BRZB 1VFOA 4TS6A 2DQUL 1QNIA 2G3NA 5BRQA 3L2LA 2R7EA 4I48B 4ZX6A 5C0CE 1YYML 3KPQB 3FN9A 2C9QA 1J18A 3SGKA 1U3NA 1NINA 4KV5E 4D0BB 2QL1A 4UI2A 5BZWA 3ZQXA 5DJ6A 5JOPD 3UTOA 1FSKB 4F7TA 3VNYA 5ICYA 2C7FA 1QPKA 4NO5A 1VZGA 5FYLL 2R1YA 5H8DA 3PWPE 5I74C 2AEQL 1GMIA 3MRKA 4Q7DA 4IMLB 1K9TA 3P73A 3N1PC 4YO0B 4MXQD 4UBDD 5C0BB 5TFSH 3FCTB 5ESVA 1BBDL 2DB8A 5IFAL 3VYNA 3D50A 5IHUH 3O3DB 3O6ML 1CE1L 4MS8C 1H6FA 2DQJH 2R0ZH 2ED7A 3BAEH 3E9UA 5I0DA 1ZVYA 5EZOH 1IEHA 1MCFA 2NY6D 3NPZB 3WIIL 1KJ3H 4KNQA 2IGFH 4ODTL 1KXTA 3IFNL 4G3YH 4KVNL 1PKQE 4MD0A 1A7PL 3IN2A 4HIHA 3S3JA 2X2IA 1QQDA 2A73B 4YNYA 1MJJB 4NPJA 4RESB 1BF8A 4GMSH 1HK6A 4LK4A 5JS3E 3CHPA 2J56A 1KJVB 3K0YA 3WGVB 3MN8A 4HH8A 3L13A 1ACXA 4YPGB 3JWNE 2IDFA 3MLVH 3UTZB 1NA8A 1KYFA 2NNAA 3SGDI 1LJMA 4G8EB 2N3JA 2VLRA 4IBVA 4KQ4H 4RAVA 4ONFH 5IBUG 5IMOA 4J1UA 4U1JA 2PR9A 3SZ6A 1NEUA 2P45B 2VXVH 5TF0A 1AQMA 4HCRH 4K0OA 1T0MA 1MCWW 2WKGA 5E03A 3MCKB 2E4FA 2VLRD 1B6DA 1GAFH 1XD0A 1OLLA 3U9WA 1I7RB 2BW5A 4G43A 4MYPA 2WO4A 4P5TB 3WYRA 5FIEA 4WU7A 3QDMB 1OS0A 1ZANH 2GJPA 5I6LA 4UNVA 3CHOA 1U3HA 4PY7B 5E1AB 2QLYA 4L8SC 3NCCB 4KRPD 4PVBA 2EVHA 3LSOB 3IS0X 5EA0H 4HUNB 1I1AA 1S9XA 2X4TB 1B88A 1AACA 2GFBA 3HRZA 4GKOA 4OB5H 4WTWA 4XXDB 5K39A 5TQ2H 5KSBB 2V33A 4CVXA 3QRFM 4YHYB 1FYTE 3UEQA 5CGYD 4DFIA 5F3BB 4N0UB 4PD4K 5HTSA 2CO6A 2V5SA 1MRDH 4WEEA 4YX2H 1YDPB 1ZCRA 4MDRA 4YDNA 2H6UA 3MV7D 4XRCA 5IQ7H 5I1EL 2XWBB 5MI0C 1YY9D 4TV3A 3NCWA 3U6XA 3FQWA 1KN4L 1AR1C 4B95C 1QAWA 2YPKA 1QLRB 4ZUTB 4M4PA 3M1OA 1CVRA 2BZDA 1OKEA 3H9SB 3SDCC 4JN1H 1G9HA 2FEJA 1HINH 4NAMA 5E70A 1KLGB 4YHLL 3OJMB 4M8UA 4X7SL 4CNIA 3RWEB 1VJSA 3ECVA 2R4SH 4NN5B 2A77H 4PLKD 3L8QA 1M6OB 1B0WA 3WFHB 2PW2A 1OP3K 4WI0B 3SGDH 2NY2B 4OJEH 1ZA3B 4KMTH 1AIFA 4J4PD 4LSUH 1EZVX 5D2LE 1CYXA 3VFNB 4NN7B 2VM4A 1CR9L 3SO3B 2NX5A 5C0RH 5KSAB 4MNQB 1PJ9A 1RHHA 3JUYA 4GQQA 1TPXC 4JFOB 2FEDD 5ETUA 2PPFA 3MV9D 2YRLA 1GH7A 1S7QA 2OULB 4P5KA 3EH1A 1EFQA 1Y3GE 1ZIBA 2FJFA 4G8IA 4PJ5A 2VIRB 5DMIL 3MOAH 4OD1H 5CGTA 1C16A 2NDFA 1CDUA 1KB9J 1E5YA 2NX5D 3GI9L 3DJSA 1PLGH 4WUKH 3WLBA 5DMYA 2FHFA 3FQYA 4ANKA 4M6ML 4OFYA 5AFAA 2BP0B 2GJJA 3VG9B 3FN0L 1A9EA 1D5XB 2FBOJ 2J57A 4Z77A 3MS3A 3LN5B 4PJ5D 4D8OA 3AQXA 1G6VK 4I18C 3L6FA 3X2QB 5I8KL 5I1HH 3HN8A 1TO4A 1K4CA 4BSVB 4UT9A 3ARBB 2HJFB 1R5IB 1GXEA 1G1OA 1J1OL 5HI5D 1U2CA 2E6QA 4JQIL 3MLTB 3EH4B 1DANT 5DO2D 5AVUB 1HI6A 4HC1L 2F7RA 3PXHA 2H0PA 2RFXA 3ILQD 4NZJA 4RZCA 3RY6A 4CBPA 3PGCA 4ORGA 2GQHA 3F8UB 5FV2A 5FKPA 1PDKB 3JVGC 4YSTA 4HLJA 1RP8A 3AT8A 2XFXB 1ES0B 2JXMB 2YRZA 4M8QA 4BQBA 1LE5B 5C09E 3UTTA 3L3OB 3O0RL 2WBJB 3LEXA 4IRSA 4V1DA 3DTUB 5AVXB 2DLFH 1J5IA 2OP4L 3BDXA 1Q90A 1SLVA 2MCAA 5GRJL 3ZE0B 4XPFH 4YQXH 4KX7A 2JI3A 3OKDA 3O3BB 5DO8A 1DCEA 2CKBA 4U1NB 1NEPA 4PBWD 4XTRD 4DHLA 2PTTB 3I3DA 3AXLA 4G8GA 4R7DB 2HRPH 4E5XA 2ZAHA 2EXTA 3EFDH 1O7SA 4R8WH 2EIZA 1OE1A 2I5YH 3OGCA 3LZOA 3RPIB 2YEQA 2HJLB 1MPAL 3OXSA 4RGNC 5IB5A 5FW6A 3VYOA 4OLXL 4OGXH 2VE6B 4G8GD 1FGNL 1R5VB 4M93B 1C12B 1V8HA 3JV6A 4PJGB 1YYLL 2AJSL 5CM1A 1RMFH 2JB6A 3QIWC 4HUMB 1ADQH 1FN4B 5JOPE 1RULL 3WFEH 3DX7A 3KPSE 5IB4A 3BE1L 4S2SB 4ZTPH 2L7JA 5LNDA 1B3IA 3MGTB 4W9LC 4OUUA 1DJWA 1F58L 1QYGL 4QTHA 4GAGH 3U7WL 3GJEB 2F53A 3N06B 4TNWK 4Y9GA 1Z0NA 1E5ZA 4NT6A 5E23A 1JL8A 1QFWM 4MCYB 5ID1B 4ZZFA 4NNXA 3UTSA 5JDSB 2Y36H 5ISZA 1BPLB 4MLSA 4TTGA 4Q0XL 2F53D 4XWGH 1O5PA 3D25B 1JWMA 1JYXA 2CHXA 2EDFA 3DV4B 4FXTA 3TC9A 3C5SA 5CWSB 3GNML 4JFFA 4BDVA 4CMHB 3UTSD 1FRGH 4NM8L 3WOVA 3WJMB 1QSFB 4EOWL 1UENA 4NNYB 5HHPB 4X5XB 3V0FA 1N64L 3MX0B 3FH7A 3VWJB 4DTGH 1NCAH 4ENED 2WSDA 3KPLB 1IC0A 5E1GA 1B0GB 1SEBA 1CDBA 1NBYB 1BVNP 4JFFD 2Y1AA 2DMHA 4FC3E 1TTBA 3GBNL 4GG8A 4TRPL 1U8MA 3MLYL 4IM8A 5IBLD 5EU6B 5C9JA 1KT2A 4MQTB 1TTFA 5BJTB 1SJEB 1IM9A 3HAEB 3S35X 4B96A 2VDKL 4YAQB 5LQBH 1UM4L 1T21B 4GSRA 3UO1L 1DVZA 2VDMB 5FA4A 4DPBX 4DFHA 4ES8A 5T5FH 1LO3L 3QUYC 2Y5QA 1XAKA 1URIA 1JWSA 2WWOA 4TNVF 1UGKA 3ZBMA 1IBFA 4PU2A 5I1IL 5KYXA 5MEPA 2ZOKB 3K2UH 5AOKA 1BOYA 2AI0H 5FR3A 1WAAF 4ZXBC 2GAZB 1T2XA 3L48A 4GAYB 4YHKL 1IAIH 2WINA 2XZQH 1S9VB 3HNSH 3IDMB 1FLRH 3RTLA 3L5XH 3O3EA 4QYOB 3E8VA 2H6PB 3MV7E 4PJAB 4AV0A 3QK0A 4XPAL 3WO4B 5F8RC 5ACMA 2YAFA 5F7BA 3D0AA 5FC9A 4NKDB 4JFEA 4ISVA 2W38A 2OMUA 3JV5A 3QXVA 3NDYE 4KQ3L 5BMFL 3KYNB 1QLEB 2A6KB 5IB3B 3ELQA 3IDMA 2X2YA 4DAGH 4F57H 3WLWD 3HEIB 3VFVB 3W11C 3ZO9A 2OJZL 2BH0A 4NQEA 4NJ9L 4I4WA 4YL4A 3ISRA 3TF7C 4JFED 1DP0A 2NOYA 1W72B 1E9QA 3DWTA 1WFJA 4BXVA 1ZTXH 1GY2A 1U4EA 5IG7B 3FU3A 1UWXK 2DIAA 3TV3L 4LOVA 1S9YA 4PG2A 1NCCL 1NMAL 2WXGA 3NABL 4XGZA 3CPLA 2ISDA 3V9CA 3KYOB 3TO2B 2DWTA 4KI1A 3PDOA 2PO6C 3N43B 2OSWA 1KTBA 3M8OH 1BHGA 2ZUQC 1R46A 1Q9KB 3V6OE 3Q1SH 4KZ0A 2KQMA 1RIHL 3PGFH 4Y1TA 1WWBX 1NFIA 2EDMA 3B37A 3LRLA 3ARGD 1XV8A 2EYSA 3MV9E 3NCYP 5EU7E 4DUWA 3HPJA 5D6CB 1NDGA 3VCLB 3RGBA 1MWAB 5FDYA 1A6PA 1FJ1A 4GERA 3L4UA 4WCYL 2X09A 3HBGA 3GINA 4WO4C 3REVB 3B2XA 1T5WB 2JKXA 1BEYH 3HE6B 4LCWA 4HWBL 2AERT 3O9WC 1PX3A 4HIXL 2R4RH 4N85A 2B59A 4W6WB 1M57B 3UAEA 3FGDA 4X6CF 4UT7H 4ZK8A 5J13C 1GIGH 4U1HA 2UYLA 4Z23A 2IAAC 5AW3B 4CRPA 2L3BA 3N1QC 3O8XA 3F7LA 2EIMB 2JK5A 3LD8C 5CP3H 3UYOD 1THCA 5HYSG 3EGDB 4GO8A 4AL8L 5J1TC 1RXLA 4F9LC 3SOBH 1CDHA 1RIVL 3HC2A 3WV0A 4JRYB 2DH3A 1UWYA 4D3CH 1W6LA 4MDJA 2CDGB 1MFEH 2PPCA 1MQKH 3QWOB 4M5SA 5D7IA 1PE8A 3EJUA 2QHLA 5T1MA 5CEZE 3RX8A 4ODXA 4EAEA 2W91A 3G5VB 5A6MA 3KLHC 2VN6A 4ZNEE 1JF5A 4DKFL 2YPVL 4NM4H 4UNUA 1KN2L 3VU2A 4MB1A 1QBAA 3K80A 3DMMA 5LB1A 4YHPB 5E6YA 5GGVY 4LVOB 4B50A 2ZPKH 2X0UA 2ADGB 1EZLA 5AZ2L 5L7XH 1BZEA 4OCYH 3S3PA 3SDXA 2Q86A 3OC8A 3QEGH 4GFTB 1AO7E 4HUUA 4OVVA 4TM9A 3F65A 4H4NA 2UVEA 3LKQA 4YBQC 5LBSA 3MOBL 2LGNA 5T3ZH 3LRSA 2A9CA 3RX7A 4X0NA 2FR4A 4OAWA 3FU7B 3NACH 4PH8A 3LKPB 4K8RC 2WGXA 4MMXC 3ULVL 1IC5L 4NO3A 1XB6A 4XNUL 5DDHB 3A3YB 3A67H 3V4PB 4AH2A 2BSSB 4WFGD 3F3HA 4PJXA 5DD0H 4XC3H 5I75B 1R3JB 1FZKA 1OGAB 4X7EC 3I75A 2EDRA 1JHTB 4ZYKA 2BFGA 4AR8A 2C3XA 3I85A 4M61B 3SE9H 3UDWC 1JZ5A 1QABA 2VISA 2CGYA 5BV7C 3L5JA 3FONA 4LKCB 1MI5D 4HIEB 2ZCZA 2H2SC 3X11A 3CH8A 2W88A 3GRWA 4BH8B 4PREB 5IVNA 3D5OF 1I85A 3GPSA 2IADB 2Y3NA 1I8AA 3UPCA 4GEJA 4NFCA 5EOCJ 5GPRA 5AOLA 1OCWL 2N0KA 3WNIA 1FP5A 4PLNC 3KLAA 1QLFB 1J9RA 2BY2A 2F19L 1RFDL 4L8BA 3CVHA 4HYTB 4NC0B 2ZCLL 4AY0A 3U9PH 3AXHA 3FTGB 4DGIL 5F7HA 5ESQB 5IBUB 3BLPX 3SDAD 4F7EB 1KMGA 2CA4A 3IDNA 3FTXA 2WGNB 3IBEA 4NPYB 12E8L 5KJRH 3CVIH 4JO8A 3LS4H 4HJIA 1HQRA 3T77B 1YJDH 3BIAX 4ODBD 4ZFOA 4TVPL 5DC2A 2GG1A 3O41B 4JZOB 3IGUA 2P5WD 4F8NA 3FLFA 5BQ7A 2DQFB 4KKCD 3C5ZA 1IGYA 3ZMRA 2OX5B 1AXSA 3TCXA 1LVEA 4FQLL 1MZZA 3K6NA 1HCVA 2NW2A 4PMFA 5TE7H 3I9GH 4XP4L 2BCKA 2IPKB 5CJ8A 3JWNG 3CDCA 4NOFA 1LILA 4A7TA 3KPRE 3NP3A 1A4CA 2YXMA 5DRWB 4DW2H 4WWPA 1OSEA 4HZLA 3VFWB 5ALCL 4WSGA 3CFCH 4YXHL 4B7IA 2PCFB 1GOGA 3B2PA 1IU1A 1U42A 43C9B 1B4JL 4N2GA 3BGMB 3P3YA 2MEJB 1FO0L 2VC2H 2ZG1A 5DI8B 3B83A 4L4VD 2FSDA 4X6CA 4QY8A 2CCVA 3FUHA 3L9YA 3U7YL 1SJVA 1DZBA 2ROXA 1T1YB 4UYPA 2VR8A 3AS2A 4AV4A 4PRBB 1OP3H 4NXKA