2XPZA

Structure of native yeast lta4 hydrolase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
632
structure length
627
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords LEUKOTRIENE A-4 HYDROLASE
total genus 205
structure length 627
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpzA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpzA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpzA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpzA01
2G4ZA 3FTYA 3P7VE 1FJQA 3B7TA 5A3YA 2GTQA 1LNDE 3P7RE 3FCQA 4J3BA 5FSJA 3FUEA 4QMEA 4XN7A 5K7TA 5J6SA 3MDJA 3P7PE 1BQBA 4PJ6A 1LNBE 3T8FA 2TLXA 3FHEA 3FH5A 3EBGA 4Q4EA 3CHSA 1PE8A 3QJXA 3MSFA 4K90A 4R5VA 4K5OA 4XMZA 1ESPA 2XPYA 4XO3A 5FSPA 3B2PA 4KX8A 2HPOA 4OI5E 1Z1WA 4QPEA 4PU2A 4RVBA 4XN2A 1KEIA 4KXAA 4ZW3A 1Y3GE 3T74A 3B3BA 1GW6A 3T2JE 4XMVA 4XMTA 3FUKA 3T87A 3FBOA 4ZW7A 1TRLA 5L8PE 1THLA 5C97A 1FJOA 2VQXA 4TNLA 4X2UA 1EZMA 3Q43A 5L41E 1QF2A 4TLIA 4XNBA 3FTZA 3T8CA 3Q44A 5AENA 5LHDA 4E36A 3FXPA 1HYTA 2R59A 3F2PA 1H19A 3FULA 3LS7A 3QGOA 3FUFA 3QH5A 4XO5A 1FJTA 4ZX4A 2TMNE 4WZ9A 4K89A 1TLPE 3CHOA 5LG6A 3Q7JA 3FUNA 1KS7A 3FUIA 4QHPA 1LNCE 4XN1A 3DO1A 3MSAA 3FH7A 4JBSA 5AB2A 3NQYB 5JXNE 3MS3A 3T8GA 1KTOA 2XQ0A 3FORA 5DLHA 3U9WA 5JVIE 4ZX6A 3SSBA 3B7RL 5TLNA 1LNAE 4ZW8A 7TLNA 5JSSE 1Z5HA 3B37A 3FTXA 3N21A 4K5MA 5HQDA 5JT9E 5LIFE 4FKKA 3FLFA 5AB0A 4XN9A 8TLIA 3P7SE 3EBHA 4FKEA 4MWPE 4XMXA 3SE6A 3QNFA 1NPCA 3DBKA 4FYRA 1QF1A 3FU0A 7TLIA 4HOMA 1KL6A 4P8QA 3T73A 3NQXA 4ZQTA 4M65A 4ZX3A 3DO0A 3FUHA 3QH1A 4FYQA 4Z7IA 2A7GE 4DPRA 4L2LA 4N66E 4KXCA 4GAAA 3FTUA 4FYSA 3F28A 1TMNE 1Z9GE 5L3UE 4FYTA 4R5TA 3FUMA 4XNDA 4QUOA 1KKKA 4KXBA 1FJWA 4XN8A 3T8HA 4QIRA 3B2XA 3FU3A 3PUUA 5FXNA 3TLIA 3T8VA 4K5PA 3ZI6A 1FJVA 1SQMA 4B52A 2DQ6A 1HS6A 1QF0A 1KJPA 5DPFE 5FSSA 3TMNE 3CHPA 2YD0A 6TLIA 3FU6A 3P7WE 4XMWA 5FWQA 5K1VA 4N5PE 4N4EE 6TMNE 1KJOA 1TLIA 1ZDPE 2ZXGA 3FH8A 4MS6A 3B34A 4RSYA 3P7TE 4D91A 4MTWE 1L3FE 5TLIA 4NZ8A 3CHRA 1OS0A 4ZX5A 4Q4IA 3FUJA 3CHQA 5TMNE 5LDSA 4KXDA 3FU5A 3DNZA 3T2HE 4R7LA 4R5XA 4XMUA 4XO4A 4PW4A 4OU3A 2WI0A 3B7UX 2WHZA 4KX9A 3EIMA 4GERA 3P7QE 3KEDA 5JS3E 4MZNE 1LNFE 4TLNA 8TLNE 3EBIA 4XN4A 2HPTA 3FXSA 3CIAA 1FJ3A 1GXWA 1U4GA 3FV4A 4MKTA 3T2IE 4H57A 3NQZB 5CU5A 1PE5A 2TLIA 3DO2A 5BPPA 1KR6A 5LWDE 4F5CA 3FGDA 3FUDA 4TMNE 4XN5A 3T8DA 3NN7A 4ZW5A 4K5LA 4MXJE 3P7UE 4OW3A 5DYFA 1LNEE 4D9WA 2VJ8A 4ZW6A 2DQMA 4K5NA 3B7SA 3MSNA 4XNAA 4PVBA 5DLLA 3FVPA 1FJUA 1KROA 3FTSA 5DPEE 1TLXA 3FTVA 1PE7A 4FKHA 3FB0A 2XPZA 4KX7A 4NAQA 3FTWA
chains in the Genus database with same CATH superfamily
2D4FA 1HAWA 4GNKB 3ABLE 2F74A 3LZNA 3TLRA 2ICWB 1TETH 3IDIB 4LBEA 2VR4A 3HG1E 3Q15A 4NUQA 5E1GA 1GXEA 1PL3A 3HPLB 2WXQA 2EUWA 5DO2C 2ITEA 1N5AA 1LHZA 1A8JH 1G7PB 1NFDB 1UJTA 2JKLA 3N1MC 4OFVA 3VG9B 1KG0B 3WKML 5MP6L 4S2SA 3HFMH 3BIAX 1CFTA 5JXAH 3OD3A 3ZUNC 1ED3B 1VFAA 1X5MA 3PQYD 2YIHA 3UAFA 3MOQA 3PWLA 4LOFA 5BO1L 1SDAB 3T74A 2JD2A 1A1NB 3MTXA 5HHOA 3I6LD 4Y4HC 4A2LA 4UT9H 2C3VB 2NY7L 4PJAB 5DHYB 4I18C 3UYPB 4WUYA 4FG4A 2RFAA 4TVPH 4Q9QH 4RZCA 4L5FE 4Q96A 3T0BA 4YFEA 4HIXH 2HMID 4N2NA 2BLFA 5FWRA 1XF2A 4RBPH 3EJTA 2WXRA 5ID1B 3FUFA 1P5UA 4NQDB 2Z92B 4IOSD 3A6CL 1T3FA 4XTRD 2VLKD 1B0RA 3SJVD 2F6AA 1JUFA 4P23B 3NOGD 1NCWL 3EUVA 3QXAB 3G5ZB 5E2JA 5JQ6L 2P7TA 3QCUL 4PFEA 5D4QA 1Y07A 1T03L 4TXRA 3MBEC 4GUCA 4AJ0A 1JMZA 1AXTH 4HIJA 4EUPB 5HGDB 4HIEB 4E0RB 1S5HA 4RRPG 4PJAE 4BCZA 1IRAY 1FO0A 3FU0A 3EXLA 3LQZB 4GTOA 2AABH 4MQSB 1T7ZA 5B3NA 3BUDA 2FYVA 3GMOB 1MY5A 2OSWA 5EU4A 4P06A 5D1ZD 5E6ZA 1BD8A 3PABB 4LRIA 4NZRL 4N8UA 1A14L 3CN1A 2AXGA 4JEUA 1O6VA 3GHBL 3RO3A 4FMVA 5C0IB 3RI5K 3VXRE 1SEBA 4R5TA 3DX6B 3F6LA 5IGXL 5EU6D 5IHZA 1FAKT 2E6QA 3T0XA 4EJ1C 3DDFA 5D7EA 2J56A 5KANG 4JFHD 3FT0A 1HXMA 1ZEAH 3L82A 2VXQA 4K71B 4PR5A 4XZUB 2D2OA 4X9FA 5D72L 5EO0A 3F5WB 2HO1A 4MA3B 4ZG1A 1TVBB 2XTJC 4IIQB 4XKCA 1DUYA 3ZKXB 2VL5A 4EI5D 1NM4A 4HIIA 3POHA 1WFOA 4WTZG 2OW7A 4KHTL 1OE2A 4NRZA 1A6AB 2YAFA 1CFNA 1LEGB 3BLBA 4KX9A 3G6JE 3SOBH 2XWBA 1OM3H 5I1DA 1KEGH 1AQKL 1Q9WB 2WO2B 3WD5L 5EORH 2FZ3B 1BX2A 1AR1C 1C1EL 1YYLH 2FBNA 1GGBL 4YXLL 4J8RB 2XJKA 5D5MF 2X2HA 3S8WA 4RFNB 1JV5A 4BUGA 2BKKB 1NCWH 4B9KC 1BPLB 1FL5A 4GYYA 3V5HB 1I3RB 4D8OA 1IC7L 5LXGL 2NY0C 5F7UA 5CIPH 5IROD 3GBDA 1LF8A 2BP5M 2DWSA 4JHRA 4N8CH 3V0IA 4W4OC 1YYCA 5KZCD 4QY8B 1E40A 3FB6A 4X5XB 1JTPA 1GKOA 2AMGA 3DWLG 4ZFHA 5FSJA 3UQ3A 3SDDD 1X5GA 5DT1L 1W6LA 2VZOA 2A6JA 2CJUH 2J43A 4IRJB 3VSUA 4H7YA 1MQKL 3S34H 4DETA 3FN0L 4U6XB 1MCWM 1MHCA 3Q9PA 4GQZA 5E6UB 3UX4A 4LLWA 4XNUL 3N55A 1LO2H 4NC1E 3D0VA 5FAAA 3E7JA 1I1YA 5I6MA 2NUTA 2WUCL 1HFAA 2PYEE 4PH8A 5F7YC 2ZP0T 3GZOA 4OV5A 4XMVA 3DO7A 4WLCA 3CPUA 1EZVY 2FO8A 1OSZB 2A7BA 3TPUB 5I71B 2BOLA 1IBYA 4O02B 3HJ0A 4IGBC 4RMBA 2GTWB 4TLIA 4O2CA 3FTZA 1FFOA 2CM5A 3DECA 4Z78B 3PDNA 1J5DA 3JTTB 4TQEH 1CI5A 2XG4B 4WHTA 3KEHA 4H8VA 4HJ1A 5E9DA 4AK2A 4BWWA 1TLPE 3ZQXA 2R29H 2Q20A 1M1XB 4KC3B 1WAAF 3JTSB 4FA8A 4QJ4B 4BQ8A 1C16B 5ENOD 4PJHE 4TKWA 3BW9A 4YHZH 2LU7A 5A2KH 5AG9A 5HGHB 4HJIA 2VITA 3FQWA 1V27A 1IFHL 2HFFA 2KC0A 4NJAL 5F3HB 3ULQA 3IVKB 5MEPA 4V3IA 1BJ8A 1QBLL 3KYOB 4HPYH 4NQXA 4D3CL 1JV2B 3BWSA 1N6QH 3Q4AB 1OGPA 2H6UA 2Z7UA 4IOIA 3NQPA 2EILB 3SKNB 4B41A 4WFHE 4FYSA 3AAAC 1A7PL 2FEDC 3FOMB 1A14H 1DANT 1NBZA 2XV0A 2F7PA 5ANMB 3VJ6B 2WZFA 3SE3A 3CVXA 1OAUL 4MNGB 4PGJA 3IGAA 5LFAA 1FJVA 3SQOH 5K1VA 3TN0D 4Q6IC 2ZG2A 4K0RA 4RGND 1K4DB 3QWRA 4P4KD 4YWGH 4X6FA 3KPMB 3EYQC 5BS0B 2VUKA 5IJVA 3IM1A 4JPIB 3REVA 1OS0A 3D34A 4FP8L 1XH2A 5DVMA 5E2VL 1ELRA 5EIIG 3QUZD 3FT3A 1C9SA 2WLYA 4RFOL 1ZAGA 2HH0L 1M71B 5JR1L 4QWWC 5IJKC 4MZNE 1GPOH 4TRQA 3QXAA 1MCNA 3R1GH 4Y16C 4KZ0A 5TDOB 2AW6A 3HS0B 3H85A 1FNEB 3NA9H 4YR6A 1ZWIB 2L6BA 3ZY7A 3FS9A 2R02A 3DPBB 4E42A 1RSYA 2ZX7A 3I84A 1MHPL 3HS9A 1FNHA 1ODUA 5ID1A 5HGDA 4JFDD 4OCYL 5J1SC 5HDRA 4ZQKA 3SDCA 3HHSB 5JIKA 2OCCE 1U42A 5CJXC 3PWNA 1V7NH 2OXHA 3JVGC 3ULUF 3BVNA 1E4JA 2CGRL 3N1QC 3I6GA 3VDBA 1U9KA 3WKMH 3C87A 3QISA 3ZQ9A 3U6XS 2H1XA 2N3JA 1AD0B 3G04B 2OL3H 5BRZD 1ZLUH 1AKPA 4I3GA 4P2YA 4XRCB 5EN2B 1SXSA 4WI8A 1V7ML 1KNOA 4OCMC 4XMPH 5DJDA 3QUKB 4XZUA 2NXZB 1KFAH 4AL8C 3VDAA 4N1CA 2WCPA 4HJJL 3ABLB 4FNUA 4JN2A 4TUOA 2CJTA 3VH8G 5D2LF 2OAAA 1Y1UA 2V9RA 1SEBB 3DX6A 2GTZA 3CDZA 1CXLA 4N4YB 4U1KA 3EYFA 3J7HA 2BJML 5F6HI 1T1ZB 2PPCA 3QA3B 3K6SB 4R9HA 2F19L 1XV8A 4P3DB 4IHQA 2K6YA 3R0NA 2J4WL 5TF0A 2EIZA 3X3FL 1QLFB 1RZQA 4TULL 5I15H 3BUAA 1JXGA 4NM4L 4XXDB 1EJFA 3C60D 2W38A 2YEZA 1XCQB 5SX5H 3BD4A 2IGFL 1WV7T 1F4XL 5F96H 4KY1H 3K0WA 4NO3A 3NMEA 2CWRA 1EO8L 4AIZB 5MEQB 2G9KA 2XKUA 5H37A 3RPIB 4RX4A 3KM2A 3SJVB 4WJG3 5HYQB 3MU3A 3RWCA 2ERJB 2ILLA 4DKFH 3UZEA 3MBED 1WAEA 1HZHH 2K9UA 3OR6B 5GGSA 3A06A 3RWIA 3BWUC 4I4WB 4HXIA 5F9AC 3RGVD 4UQ2A 1JPTH 4JFWA 4RMRA 5EEUA 2YEVB 1YQVL 3KVPA 3F28A 3JQ0A 1AQDA 1TMQA 4MA8H 2CBQA 4FYTA 4U6XA 3IDXH 2LSUA 5GGUB 3EOBB 5T1KB 3EJZD 4YHNA 3N42B 2CLRA 1E5AA 2L7QA 1IGCL 5GRWA 5TDPB 5TJWK 1S7WB 1T5WB 3CFDB 4EF3A 1CGSH 1TITA 2AK1H 2CIIA 4Y7OC 3ARFD 3RRNB 1KB5A 2DYPB 1TNZA 3N44B 5AW1B 4P23A 2AJVL 1PNDA 1AP7A 4J4PD 5BZWB 4M8RA 5JOFA 3QG6B 1BQHA 5GGTH 1FGVL 1IGIL 5SWSD 3CC5A 2DWYA 2OMYA 2DJ4A 1KPRA 5EZIL 4A3VA 1HSAA 1DVFA 3AREA 2J6EH 1EPFA 3FQUB 5FV1L 4DZ8A 1YEEH 1U30A 1WISA 3VD5A 3L1OL 2R70A 3DYPA 4IBYA 4W9JC 4Z7NB 3ZDXE 5HYJB 3HE7D 1EJOH 5KVDL 1IVLA 4LRNL 2DCPA 1I53A 1SBBA 3H9HA 2CMRH 1R0AL 4NQEE 4Y5YA 1I3UA 3TT3H 4F7EA 3OC8A 5JHDD 1DUZA 4N0FB 3C5RA 1UFUA 1ZSDB 2O5YL 1KGCD 4LCVA 4H25A 4HHGA 4GA1A 4JFFB 3UCQA 5DXWA 4JJOA 3IEAA 1VRSA 2A3TA 3WFEH 3LRKA 2IPTH 3I3EA 4JZOB 3RFZA 4L18A 5FQ8A 1MELA 1S7VA 3GSRA 5G04J 3GMPB 3EBGA 3KYMA 1G3NB 1BVKA 5JXEC 2AJXH 2I9TA 4ODWB 1DCLA 3WSQH 4DO4A 2ZD0A 4P99A 3MRMA 3UC2A 3TEWA 3EU5A 2HFTA 4HNAD 2VC2L 2PTTB 3UKUG 1AJ7L 1Q9LA 1GW6A 5IB2B 4I9WD 5DMGC 3MXVH 5ADOL 3BUQA 4NKIH 3SE4A 1EWHA 5F7NC 5KVFL 5INCB 3L5WA 4F6RD 2R1YA 1NA8A 2C8NA 2R2BA 3ES6A 3NZ8B 4PJHB 4I48B 1NBYA 2H6PB 5IT2H 1TJXA 4Z7QF 4KAQH 1AI1H 4MZ2A 1BECA 2D4DA 2G9HA 2FUTA 5CGYD 4L29B 5A43C 1J8SA 2ENQA 3ESUF 5JQIB 4PJDE 4LCYB 2WUBL 5CJQH 1IV8A 3MREB 3BH9A 1INZA 1AO7D 1AXIB 1TO5A 5JVIE 2NLJB 1Z9SA 1QATA 2NCMA 3MJ9A 4KI5D 5IBLD 1NDGB 3KYNB 4XBEL 2HUEA 3N21A 4FQQA 3MX0B 3KNBA 2YHCA 3LXCA 2WWOA 3MN8A 2RKKA 3L3GA 3DBKA 1ETZA 3NT0A 1ZGLB 2UY7B 2R0KL 1Q94A 4PW9A 4ZYKB 5L7XL 4M65A 4JM2F 1M2VB 3BIKB 1BZ7A 1PZCA 1QSEA 1RPQA 4EE2A 2F9BT 1LGVA 4K03A 4GSQA 3T77A 2YFOA 4HW6A 1CVSC 3BUIA 1KPVB 2B5IB 4JFPB 1A7RH 5ISZB 2G3NA 2VABB 2E4FA 3ATAA 5AOKA 4QTHB 5TE4H 3LV3B 1AZZC 4U3SA 4AGQA 1ZVSA 2VDMB 3QJHA 5I74C 3DSNA 4CA4A 1HK6A 1ND0A 1U8OA 3P2BA 1V05A 2BOBB 5EMYA 3FT2A 3N41B 3N44F 2BUGA 4N87A 2X0UA 4XOBA 4ZUWB 1A7QL 1OB1B 3BUYB 4LO9A 4D8PB 3DK0A 2OBGA 2B7DT 1CYGA 3MNZB 4NKIL 4QRPA 4XHJD 4GS7B 2YO3A 3UZVA 1HL4A 4A37A 4FXGC 1KBWA 4G6KH 3HYMB 1V54B 1QFWL 3WUZA 5D7HA 4GP5B 4MKTA 5L88H 1PLGL 4KH9A 1QI4A 5ICYB 3ZHEB 4PJXA 4JPVL 4PGBA 4LEXL 3SY2A 1IKNA 3U7WL 2PCFA 5DJAB 3K4AA 5C1MB 3WN5B 1UJ3C 4N8VG 1D5MA 5ESQB 2L6JA 3P73A 5D8JL 1NBQA 5TFSL 4XBEH 2HCZX 3E2HB 1BD2E 2XKSA 4QGTA 2ICCA 5KJ7E 2HZHA 2NZ9D 2GCYA 4AQ8C 5L6YL 1FYTA 1EGJH 4JQIH 1SLXA 1KTRL 4QMEA 1WFIA 4XGZA 3C2AH 5T33H 5EDSA 2QQKL 3FPYA 4HXAH 1E90A 1GMIA 3MJ7B 1IAOB 4BH8B 1Q0HA 1QSFB 1R3IL 4HX1B 4DK5A 3HXFA 2ATKB 2BNQE 3MV7E 4G8GE 4YHNB 4MS8D 2MQ3A 4APFA 1S7XA 1QRNA 3OHXC 4DRXE 4I1OB 5H2BA 2G9HB 3VXPA 4U0ZA 2XN9D 3HVNA 3H0TA 4KJYA 2OXHB 3TIDA 3TZVA 1O9WA 1ZA6A 1RJZA 4M6AA 2BK8A 2YPVA 2WB7A 3P30L 5D2MC 5AAOA 2X6UA 2YPVL 5FK9B 3FRUA 4F80A 5FTPA 1KENH 1XGRB 1KZPA 2CLVA 2FX8H 1J0YA 2OKMA 2ZUTA 1R3HB 3DI3B 1WQVT 3S7DA 2WNWA 4NNXA 4BZ2A 1L9PA 4R7XA 2B59A 2VLJD 3L3DB 3QORA 4LE8A 4DP9X 5KVEL 5LUMA 5IY5B 2C4XA 3MLWH 3PV6A 1EO8H 5AN8A 2CHXA 2ZX5A 1AC0A 3W0WB 4BGLA 5DJ6A 2CDEA 1SA4A 2WWKT 5D2NC 3AC0A 4WTZA 1SQ2N 3OB8A 3QRGH 3D87B 5AG8A 1V10A 1ZHLB 1HZHL 2B1HH 5EU3B 4HFGA 2X1WL 5GJTL 1QQDA 4NP4H 4QHKJ 5F7BA 1OGAD 2UVFA 1OGAB 5CBEB 4YHMH 5ECGA 4Q2ZA 2E59A 3Q78A 2CFUA 2Q86A 3FB7B 4XB8A 2WLJA 4JZOA 3SBQA 3WEXA 4F57H 3RFZB 2EIZB 5LLIC 4YZWA 3RNQB 3HS8A 1Z0NA 4I2XE 4Y4HB 4FQXC 3ZDWA 1TCRA 4D0BB 1FVDB 1MI5E 1S5IH 5CEYB 4F1ZA 3K6SA 4QRBA 4N26A 1LK2B 3NTCL 3WXVL 4XMWA 4G7YH 3ARFA 2HJKA 3FCBA 1Q0XH 4JHZA 4WW2B 2IALB 4KK9D 1N5YH 2C9PA 1F4WL 4PJXF 1NTDA 1YC7A 2G75B 4XNXH 5EF0A 2L8AA 4JY6A 4Q9BA 4HD5A 3QR0A 1SZAA 5F97E 5E2VH 4HOSA 4GINA 1TDQA 1TIUA 2RD0A 4IMLA 3EW3B 1MAKA 3R06B 2BVQB 3ZKMD 2H3NB 4IKJA 3D9PA 3LRSB 4DO6A 1J10A 3HW2A 2XCMC 1A5FH 1JK9B 3IKCB 5IW6A 3RDJA 3BCFA 5K5YA 2XV3A 3TBTA 1MCSA 3RX5A 1PKQA 1XF4B 3L7EA 3ZI0A 1QSFD 2PNDA 4C4KT 1YEHH 4D0DA 4KVOA 3JZYA 4GT7A 3DTXB 2ZYIA 5DPEE 4J3OH 4R4FL 2XBTA 1SC5A 1P9MA 2WNKA 4P57A 5DCCA 4Z5RA 4M93C 1NGWA 3VI4A 3MREA 3KS0J 15C8L 1CDUA 4GAYA 4IRZH 4MNQD 4UTAL 3HE7C 4Z7UE 3V4PB 4R0LC 4K2UH 1D5IL 3LY7A 1XIWC 5DEJA 1UWEL 25C8H 1Q1JH 4F7MB 3S7JA 2QGBA 3BEWA 2MYOA 3MFGB 5ID0B 4ZUUB 4ZMAT 1S3KH 3LS5L 3QW9A 1AD9A 2YZ8A 3TH2T 2PCYA 2BHYA 2XYCA 4XXCA 2QTEA 5CMWA 3UABA 5C8JB 4HDIB 4LGPB 3G08B 1DJSA 3X17A 1OAKL 4HS3A 4JFPA 1I3GL 1ORSA 1Z3RA 4JFZL 4PJ7E 1EJ6A 3CFCL 3V7AG 1ETA1 1TYRA 2APBA 4BK5C 1W8EA 5KW9H 3RDTB 3DXKG 4KVCH 3RLSA 5HXMA 1UZ8A 4JG1H 3F6JA 1CBVH 5I5IA 4JN2B 4TUOB 2EEBA 4YL9A 4IMKA 3CHOA 3SSGA 5I1AA 1GVIA 4JRYB 1RHFA 2VLLA 1WZLA 1Y1DA 2PXYA 3FQUA 4TULH 5JNYA 3MS3A 3WFBH 1E9PA 4M3HA 5JOPD 1ASQA 2C3GA 3NZSA 1Z5SC 3LN5A 1I7TB 3A47A 5DUPL 2QZQA 2R69L 1CGVA 2E7BA 5DR5H 3WMQA 3ZE2B 5BV0A 1G6RA 3P54A 3MGTB 1HXMB 4FEIA 1G7JB 2P49B 3V5KB 2OMUA 1YN6A 2HFEA 3MV8E 5FA3A 1N4SA 3MAWA 3UEQA 1H2TC 1IKOP 5SWSE 2EDRA 1DZ0A 2IDFA 2ZWYA 1KKKA 1V3LA 2UX7A 4EIGB 3O4LA 3ZL1A 3FMGL 1AS6A 2OJEA 4B95C 1NUFA 3UJTL 2OULB 2XNAB 3PL6B 4AITA 4G1TA 3BG1B 4PBDA 1MVUB 5FM8A 3EJYC 3PG2A 5JO5B 1PQZA 4APOA 1RV6X 1WC7A 3L13A 3UM0A 4BFIB 3STZA 3U30C 2CDFA 3FUJA 4L37B 1HNFA 1TEGA 2PP9A 3C5ZD 5BUZA 1ZHKA 1LD7A 4AIFA 3OKOA 3DBXB 3B7UX 1MREL 3GUTA 4F37F 3MJGX 1JUFB 3WNMA 2EH8L 3O48A 4CJ1A 1W72H 1KELL 5KSAA 3LKPA 5AB9A 2D0FA 2P5WD 4O9HH 2MOGA 3LOWA 2EIEA 4Z7QE 1UM6L 4JG9A 3FUDA 1CF1A 2V0PA 5JR1H 3D2UA 4MXJE 2P5ED 3CFJA 4RSVA 1SM3L 3QCTL 1FIGH 2VQ1A 4XC1L 3UAAA 4UQYA 3D9KA 2V5MA 5DEGA 2Z4TA 4NRHB 1BW8A 2GIMA 3ARBD 1FP5A 4K55A 5HHOB 5CN2A 1CXFA 1DVQA 5KBKA 2WXIA 4AEFA 3RG1C 4CNIA 4FFVD 4A7UA 1RK0B 5JQ6H 1WFNA 1FZMA 4H4NA 1PSKH 1WG3A 1AFVH 3FSAA 1AZCA 3ZU7B 1UOVA 2WWMC 4N8VA 1D5XA 3QRBA 4MCZA 2HE0A 1I9IH 4BUHA 3LNHA 1LNBE 2JXMB 3F62A 2VMFA 4QHNA 1JGLH 1J87A 4OGXL 4PLOB 4ZO9A 1RUQH 5L4IA 5I0WA 5FUZH 1E2VA 2KDYA 1OP9A 5DBKA 4AL8L 1IEHA 3LRHA 3G2UA 4Y8AA 1HDMA 3AU1B 2VERA 1DUYB 2EC8A 1UZGA 3MLVH 2ITDA 3C5SB 3L4VA 1ONOA 2PMZA 4PREA 1GGTA 5DO8A 3SGEH 5GISL 1WA0X 4PYGA 4ZUWA 5KW9L 1FO0B 1CXIA 1T7VA 1EYHA 3RBGA 4OYSA 3HRZA 5EORL 2XTJB 4PB9L 4W6XB 5FZSA 2ZXBA 4LQ1A 4XMKH 4LUNU 5GS2D 4JFQB 2V0AA 3SDDA 5C0FB 5F1NB 5LNEA 4OT1L 5GPRA 3JUEA 1D7CA 3NFNA 5AZ2L 2LTQB 3D51A 3EJZC 3QO1B 2WC7A 2C3HA 2CR3A 4U33A 3D85D 5KZCB 2A74B 4LLQB 4EZMA 4GZ6A 2EXYD 4ETQA 2UWJG 2EQDA 2Y72A 2P9IG 1TNMA 3VFWA 4DGVL 4UUJB 4HLLA 4YGVB 4ZDHB 1N64L 5DJXA 4K3GA 4IRJA 1NDGA 4PGDB 1JDDA 5B38G 1EF1C 2XXMB 4HRLA 5SV3A 4PJGA 1TMNE 4QT5B 2J73A 1LO2L 4LDCA 1ERNA 3LIZL 5D72H 3VI4B 3HNTH 2XKNB 1QFUL 2B16A 5FOBB 2MTPA 2JKWA 3B4NA 3KJ6H 4F9PC 4WUUA 4LLAA 2Y2TA 2UWEB 5JAZA 5IHUH 3G6DL 1NLBH 1ZDPE 5HJDA 3SQBB 4EI5B 4W9EC 1U8MA 3VG0L 1A1NA 2J12B 3HNVL 4FI8A 1JL8A 4NM8L 1P7HL 3SB3A 3C8HA 3VVWA 2NXYB 1VADB 3VTXA 1S9YB 2AQPA 4O2FB 1L5JA 2GSIA 1BZ9B 1ROCA 2BO0A 1KIQB 5DWUL 2HVBA 1M7IA 2WHZA 4K7PH 4R83A 4L9LC 1J9QA 4HS3B 3ZKNC 3KLHC 2BC4B 4XZ4A 2VSYA 2A4EA 3WTVA 1VEPA 2X6JA 2NXZD 5J08A 3ASOE 3D12B 1GRWA 1DBBL 1R5VA 2V8MA 4APXA 6PAZA 2HJKB 4FFYL 2XG4A 4WHTB 4GQPH 2HFFB 3OMNB 5GS1C 2MWCA 5D1QB 5A2IH 3CMOH 3QJFB 4P46A 3PWUA 2CIKA 2ZYHA 1FFNB 2XX0A 3FTSA 4PGEB 2OJ1A 3ZJAA 1OWNA 3EHNA 2WY3B 2RFXA 1CDBA 2E46A 3EOTL 1NPJA 3D07A 3L45A 2QDWA 2WCSA 1D2PA 1M56B 4JFDB 4DN3H 2PPDA 4EAEA 3ULUH 1A1MB 3ZT6A 2R27A 2BFVH 3WNKA 1UB6A 4F15B 4N6RB 4OJFH 4QF1B 2RJIA 4MQTB 4DHLA 3VD9A 4Z5RB 4RRPM 3MLSL 1DQLL 4L9LB 2EVIA 4GU5A 5I6XC 3K1KC 1FJOA 3PWPB 5I17B 3HVDA 2Y2YA 3ZHLA 2CXKA 3H54A 1CU4H 3UAEA 4P4KB 3FQXB 3HI1B 2FQGA 5HI4D 5DO2D 2WVUA 5A40E 4OFIA 5B3SB 3D9IA 3WFZA 1VFUA 2R69H 2GI0A 1CR9L 2GI7A 4G59C 2IPKB 3U1PA 1FFQA 3ASFA 3UADA 4UQ2B 5D8JH 1ZT4A 4IDJH 3TIEB 3OZ9H 4O51A 4Z7OE 3BAKA 5DVLA 2UWEF 5I75C 3DROA 4GSDH 5T3XH 4W9CC 5DK2A 4G7QB 5L6YH 3PXHA 5T3RA 3QWRD 4LP8A 3UTTA 2EYTB 4PG2C 3E8UH 1FG2A 3FU9A 3RGBA 4G8IA 1D5ZA 4F53A 1RMFL 2WM9A 3S4SA 1KTLB 3I85A 5F7DB 5I30L 1J86A 1JFQL 2BVOA 2OMVA 5CAYB 2IADA 1UENA 4FQIH 3FU3A 5E94B 3ZI6A 1P5VB 2J5LC 3SCMD 1SBSH 3RJDA 1DZBA 3MV8D 5J3HC 4S0TD 1BGXL 2Z93B 3P9LB 1N5YL 1P7KB 4HUCA 2WKOF 2P5EB 1ADQL 4LLYB 4QJ3B 1KEML 1L3FE 3HAEH 4JO1H 1K5HA 1BAFH 2A6IB 2ZGDA 3HC4H 1SHMA 2E27L 2CK0H 4E9QA 5H4YA 1OE3A 4XMUA 5JMPA 4M7JL 3U2JA 1UT2A 3NCMA 3LZLA 5IVNA 4K73A 2LV4A 5I6XB 4JGUA 4MXQC 3C5ZB 3ZGHA 5AW7B 5EN2A 3TWSA 5AW6B 4HHWA 2Z3FA 5EZJB 2WZPD 3MO1A 3LIZA 4OM1L 5DC4B 4YDNA 1PZDA 2FJGA 1YEIL 3CFQA 4OSUH 3S36X 5BRZE 2Q8AH 4JRXB 4UZSA 2CRZA 1MWAA 5J8OA 4QHLA 4OGAC 4U1LA 3V4UH 2VGLM 3PL6D 1FO0L 4GTVA 1HILB 3LEXB 2XQYA 3ARBA 1AO7A 4JZJC 1FSKC 2VLKE 2BP0B 4L8DB 2VN3A 1GGCL 1T4WA 5KYXB 1TZGL 3IEGA 1NGPL 4HKZA 1PCSA 2NNFA 3MUY1 2BZDA 5CO1A 5FYLE 3CUPB 5FFLA 2JVUA 4X7TB 3V0HA 3OXFA 4P2OA 4PV8B 3QNYB 2VLRB 1E30A 4NHCL 4CKVX 4NQSB 3SY0B 1IUZA 4DP5X 3LQAH 3FUKA 1KFGA 5IKCB 1WFUA 1J9SA 1PLGH 4LKCA 1SNRA 3MNMA 4PJEF 3ZGIA 2BHFA 3QCVL 3FF8A 1P4BH 1PTZA 5C8JA 3SD5A 2VTFA 4JFHE 5DTFA 1R5IA 5FQ6A 2PWGA 4DLOA 1E9OA 1FLTX 2Z31A 5L4JA 3IPBA 3QNXA 3H9YA 1X4YA 3EOAA 3GMRA 4PCSA 5JPMB 1CMOA 4QRPD 3HI5L 2E74C 4B93B 1FN4B 5EU6B 5EO9B 2OR9H 4KBPA 3TV3L 1BMWA 1OP5K 1D5ZB 2CMRL 2QYJA 4GRLC 1R0AH 4U1HA 4C83B 3NIFE 3A24A 3IPFA 4JE0A 4AQEA 4P2QD 2R39A 5LAPA 1XNFA 5JA4D 4Y19E 3JZ7A 3CQCB 2A1WL 5DJZB 2SEBB 4X6DE 1DE4B 3LNIA 4ZAKD 3GTTA 4WFGD 1A1OA 3BUBA 2AXHA 2WLLB 1PJWA 2IH3B 5BNWA 3DMMD 1HSAB 4TVSa 4P5MB 4UIMA 4G9FB 1Q9OA 1J7VR 2HFGL 4JJ5A 5CXPA 4GRWE 4ZXBC 4FQHA 4P23D 4F8NA 1R5VB 1NGQH 3QWOA 4N28A 1GCYA 4GXVH 5JW4Q 5F9JB 3ETBF 2IAMA 4HVBA 3ARXA 3QYCA 4Q58C 5I8OL 3CWGA 3NYKA 1HWHB 1DDTA 3U7AA 5JUEL 3RB7A 5GGRY 5EBMB 4BKLA 4LCUA 1IQRA 1QSZA 4Y0GA 4B89A 1J5HA 4P9HC 5DMGD 3BLKA 5LBSA 5K9KA 1EXUB 1LDPL 4H8WH 3TCTA 5JW4N 2EDOA 3RIAF 3PS6A 3PWPA 4WWKC 1A1MA 3AY4C 1KR6A 4DX7D 2MFNA 3FP3A 2F8VA 1CIDA 2VTBA 2Y7NA 1YPZE 3U2SB 4I7ZC 1SXZA 3WMPA 5CKGA 1TNYA 1DBAL 1R19A 4TNVF 4DKEH 1F4XH 1N7MH 2ZXWE 3PWVA 3QEGL 4MMYA 4EPSA 1CL7H 2HT2C 1EV2E 2QTVA 3K2IA 1JVSA 2XZAH 5F9WC 5K39A 4FFVC 4UTCA 3OZ9L 4N1EA 2AVFA 4Y16D 3JSZA 3RHWF 1JPTL 2OSXA 4LDLB 3SY6A 1H2VC 3VYPA 4UBDD 3MSFA 2I07A 4Y2LA 4AYSA 4X98A 4PWKA 2DMBA 4X8QA 3ULAB 4ZHBA 1ZXKA 4AJVA 1CICC 4NUPA 3GBLA 3FHAA 1JPSL 4E5XA 1KPRB 2EDHA 1F2QA 3QG7H 3QNZB 5KG9B 2P45B 3ANLA 3PVLA 4JREB 4P9ML 5DMJB 5DRNB 2NY4B 3HR5A 5J13B 5SWZA 4BJLA 1HHGA 3P77B 3ARED 5T3ZD 4BETA 3FB5A 3F00A 3ASNE 4G8IB 5GS1B 1JYVA 1ZRUA 2KDGA 1R24B 4IDJL 4F7EB 3OSVA 5SWSA 4M4RA 1BMGA 4NPKA 1M6OB 3O3AA 4PDXA 3MCLH 3D52A 4HKJB 2X1QA 3SPJA 2WXJA 2J1KA 4P2AA 2A7OA 4LP4A 4ZMPA 3BZ4B 3UJIL 4S1QL 3ZHXA 3T2PA 1WCBA 3DGCR 3QIUA 4TSCH 2IO3C 1HOEA 4FFWC 4HJ0C 5CECB 3ZTNL 5AL8A 1FDLH 3ZDYE 2FJGB 2J1XA 1MJJB 5FT9A 3ZO0A 2PW1A 4Z3TA 3KLDA 2P9SG 3GGWB 1MWOA 3K4DA 4WQOA 5DHEA 1QBLH 1N6QL 1RZIA 2NY3B 1MCHA 4DAGH 2QC9A 3D05A 1R4XA 1XO8A 3JT2A 4DUVA 2DQ6A 4GZ3A 4LB8A 3PDOA 4NKDB 3V55A 1CB4A 3OKKB 4LBAA 4QF1A 5MENB 2J25A 3FQRA 1TVHA 1Q9LB 1CWVA 4IGBA 4RZCB 4HH8A 4LLUA 4MZIA 1S78D 1KGCE 3QIBC 3L6FB 3KXFB 4XAWH 4A63B 3B7YA 5JHDE 1ZLVK 4Z7OF 1JF6A 4Y2DC 4K07A 2IOMA 3IDMB 4HCFA 2IFUA 1OW0A 3FB6B 2LVCA 1RK1B 3WTSA 1S7RA 5F8RC 1IEBB 1MJUL 4ODVH 3BP5A 2I9LB 3IE4A 1FG2B 4BH7B 2KH2B 3K71B 1G9HA 2V9QA 1U8NA 2C9VA 1EFXB 1UKSA 4N2EA 3L9YA 3VGHA 1JCSA 5TF1L 3HC2A 4CVXB 2BVOB 2OMVB 5HDBE 1MH5A 1UJJA 2R9HC 4RQQB 3UPRB 4M03A 4QFVA 1UQSB 3GHPA 1NEZG 4MD5A 2F8XK 2XN9E 5AQ9A 5L0QC 1RJLA 1QUNB 4OGAD 3MCKA 1XXDC 2OTUB 1HH8A 4ZNEE 2QVTA 5E8DL 1R17A 2TLXA 3FHEA 3P4NA 1HC1A 2I69A 1UWFA 4G8FA 3ULUL 1MLBB 5I5MA 3GWJA 4EI0A 4FFZH 3ULVC 2A5EA 3A5VA 2CCLA 3BWUF 4BRJA 4F37K 4G9FD 1K4CB 1MFBH 2UZPA 5FUZL 3UT7A 5HHPB 4JM0A 5HDLA 1IKFL 4FXGB 1IC5H 4UT6L 1YY9C 5LJYH 2DAVA 4DK6A 4F2MA 4NP9A 3L9EA 2VSCA 3SOBL 1THCA 4XC1H 3EO0A 5F7EL 1P2CB 4C55A 4Z0BL 1BBDL 3GRWA 4KK9C 3TV8A 1V55E 1R33A 3C6LB 3ZDYF 1LP9A 1D6VH 5EN5D 4A6YH 2CJ3A 1WWAX 1G7HA 1IGJB 4AG4L 1CL7I 1XGTB 4K3DH 2DDQH 1NAKH 1A6WL 1BU9A 4FTVB 1OSPL 3UT8A 5IB1A 3ZYKA 4GXUN 3QOUA 2BSEA 2VRQA 3I9IA 2H6GA 2HX8A 1W0VB 3NQIA 4OLYH 4TNEA 3Q79A 4KI1A 2W07A 3I6SA 5KVGH 4WSJA 5IBLC 2CXGA 3PAUA 3RVXD 4OAUC 1RFDL 1FBIH 1L9NA 3U0WL 5ALBH 4DPRA 4H13C 4HS8L 4HWZB 1HYSD 3UTPE 2YINA 1QBBA 3CFIC 4PMEA 3MA9H 4QY8A 4P59L 5DA4A 4QRAA 3MRQB 1CD1A 1SQMA 2H6IA 1WEJH 3I5PA 4NX0A 3DJTA 5J1AA 1BG1A 2IAMD 4IU2A 2IG2L 4Z7VB 3GSQB 4DSYA 25C8L 1R3KB 4OQ1A 5AZ2H 5FYJU 3O9WB 4Y9BA 2ZICA 2B1AL 4H5SA 2Y4TA 3HMXH 5TMNE 4P23C 5BQ7B 3BP5B 3KPRA 2VR8A 3CVNA 2K8MA 9CGTA 1VDYA 4HDIA 3DEOA 1LWJA 1CLZH 5D2NB 4R90L 4YDEA 5TTRA 1TJMA 4L1SA 5A2AA 4F9PA 4G8GD 1N54A 1ZU2A 2AABL 5HY9A 3I6GB 1EX0A 1LK2A 4JRXD 5CLTA 1FFOB 4TQ8A 3D0VB 5ETUA 2EDQA 3M6DA 5J89A 4DX5D 1AS8A 4A03A 5DUBA 1JPST 4IN3B 4L0ZA 2ENJA 3QULA 5IHZB 2RB8A 2WINA 1T1WA 1D5BA 2YGVA 5GS0L 1NKRA 2F54E 3RJOA 3T73A 1FE8L 1GJWA 3ALXA 4F7KA 1XTLA 2GTWA 4JPSA 1ROWA 2GBUA 4TNWF 5ELIA 4X8XA 1JTOA 3SDXF 3B6SA 1MAJA 1PZAA 3KPPB 4AV5A 1EHKB 1ANUA 1C12B 3UM3A 1QNFA 3MV8B 2Z8VC 4JM2C 3NK3A 4NKDA 4P3CL 4W6WB 4RMVA 4ZOAA 3S34L 5JO5A 3DTXA 3LY6A 3PJSA 4IMLB 4Q74A 3SGDI 3WFHA 5IFHL 3C6LA 3Q8CA 2O7GA 4JG1L 5DRXA 3BAIA 3VFRB 2K8QA 3NFNB 1GGBH 5AKTA 4YXLH 4MHHI 3FFCD 4UT6H 2GC4C 3LD8C 2R2LA 1WBXB 3MRHA 2VQXA 4JO2H 1BVLA 1CDYA 2QADB 5D1QE 2Q3AA 5FR3A 1VFAB 4LRIC 3FULA 3D2UD 1JGUH 4R2GD 4JVSA 4J28A 1SPDA 3VW3L 1KJ3L 1N18A 1YN6B 2HFEB 2WXPA 3TIDB 1UM6H 3EIJA 4HOXA 3CH1A 4Y7MA 1MI5D 4JBSA 5DHVB 3IJEA 3CFJB 1VEMA 2FHBA 4EBAA 2OQJA 2Y9RT 1JWSB 1R3LA 3DHJA 3L2NA 5TLNA 2J49A 1A8ZA 2FD6H 2ORBH 1FZJB 3IN0A 1SZ9A 4KO6A 4PJGB 4XI9A 5LQBL 2X3AA 5EU7C 1LEKA 3NCFB 1ONPA 1INDH 1KBGL 1ZVHA 5IMLB 2DZNA 2WTOA 1VESA 2R2HB 4LASL 1R46A 2X89D 4MD5B 3NQXA 5C09B 2ZYRA 2HA1A 3BCDA 2GJZB 1JPFA 4N5QA 2JJVA 3L3HB 3L5XH 3PQYE 4G23A 5M72A 5AVTB 3QWNA 1GMEA 3GIVA 2LSVA 4FLBA 4PIRF 4BE5A 3ANMA 4YXHL 3ARVA 4RLYA 3QDJE 4A2EA 4UMGA 3EHRA 3SZKC 6TMNE 3ONLA 3T2NH 1YJDH 4D7BA 4WI3A 3IU4L 1KN4H 4G43B 4HAGA 4P48A 3U4KA 4ZX5A 4KBQA 4ZO7A 1I8AA 3FO1B 4ECNA 5DC2A 3LH2L 4JY5H 4LVHB 4ZNCD 2V4LA 2P9RA 4LLMA 4UDUB 4EKJA 3IGFA 2L04A 1H3GA 1OPOA 1OALA 3C5SA 1Y7VA 4AY5A 5F1NA 1TEFA 5CZXD 4O02H 1K9TA 3O6KL 3NQZB 3EGSB 3RTLA 4XVSL 4G8FB 4OZ4B 2E0IA 2FX8L 1OCZB 5F7EH 3SDYH 1DBAH 4OGYL 3D33A 4LEOA 4YMPA 3NJFA 2FB4L 4V1DD 5C0BA 4U49A 4R4FH 5AKRA 5JW3H 2B3IA 3A0OA 1DN0B 5DZVA 4LMQE 1HQ4A 3IK2A 4LL1A 4TUMA 2CA3A 2PCPA 3DGGA 4EN3C 5DR5L 2GTQA 3MLUL 1O5PA 3ZNGA 1MI5B 1EEYB 5I74B 2NXYD 3VH8A 3AWFA 1TTFA 3RP1A 4IKIA 1PKOA 2I60L 3FB8A 3IB4A 1SW6A 1RUKL 2ZWSA 1J88A 3D2UB 1H6OA 4N2HA 5T33L 4AGNA 3SYQA 3PGCA 4WSGA 4FC8A 4TVPL 4AVKA 2DWDA 5C6TL 4MCNA 1EFXA 1FV1B 4E9YA 3AT9A 3EUDA 4PVMA 3A4EA 4HCRH 3SKMB 3OKNA 1Q2ZA 4MX7A 4GXUM 2UXGA 4QXTA 4RNRB 4GPVA 3NF1A 4LLUB 3RTQB 5FQ7A 3ASOB 1CGTA 4HWNA 1QTPA 3NTCH 5DJ0B 4DQAA 2ITFA 3QI9A 4ABQA 4WTWA 2PW2B 2F5BL 4K89A 5JHLL 3G2SA 3PZ2A 1BFSA 3L48A 4DZBA 1DJZA 1KENL 4PV9A 4RMSA 5GHWH 1NFIB 4HISA 3KLAB 4AY0A 1EBPA 3QFDB 5F89A 2AJUL 4DX1A 5ENWA 4PJGF 1TKWA 1RPUA 3PRZA 4JKPH 1NMCC 4KK6C 4NKMA 4AQZA 2R0WH 4OZFA 2YQ2A 1CXKA 1DR9A 4WV1B 3RIAK 1RL1A 2ENYA 1MIML 2G2RA 2FYYB 1UD8A 3BN3B 3MRKA 1P4LB 3VRIA 4KQ4L 1ILUA 4OFYD 4G6FB 3EHQA 2BKGA 4JR9L 5JIQA 4G8GB 4Y5YB 1SY6L 1XHHA 2DV6A 1BI7B 3FU8A 3WY2A 4LSRL 4UANA 2WANA 2Q0ZX 1CTMA 1U8QA 4LIQE 3VNZA 2ZCLL 2F53D 1EXGA 2EINB 3T9WA 3SDCC 2J88H 3ZL4H 1TJCA 4Y1AB 3QH3A 4F7PB 4JRXE 4I0PA 2DIBA 4MJ5A 1OCRB 4RMWA 5KVDE 4KDTC 2NT1A 4Q4IA 4KMLB 1CFQB 4M1GH 4EKXA 3O2DL 3WJLA 1A25A 4ONFL 5GRJL 3QRGL 2WKLA 4LSUL 4YVNA 4CADB 4PHXA 3KEDA 4HUUA 5F0JB 1HKFA 5EG6C 1KULA 4TNFA 1UH4A 3VFUA 4F7TB 5MI0B 2C4FU 4XVTH 2AAAA 1HHIB 5IQ7L 2DVWA 3DO2A 1CD0A 1S7VB 3GSRB 3QORD 5AYUL 3UGUA 1TQBC 4ZW6A 5JIPA 3K3QA 2EVGA 2J6WA 3SF4A 2X10A 3FW6A 5FHBH 3ELQA 2BP8B 1OAZH 4BYHA 4XCYB 5AVQB 1OT4A 1MNUH 2APXA 3TBVB 1RK1A 2HFGH 1WG0A 1QLRA 4QGYA 1FFPB 4FTVD 3FTYA 1B2WH 2XN9A 5A6CA 4NLAA 1U8KB 5E2TL 1YN7A 3SY0A 1X5AA 4A67A 5JZ7C 4XCNB 3LPFA 4OF3A 1ZA6B 1TJHH 2XENA 4XBGA 4DQOH 5A2BA 2H6HA 3KD4A 5AW5B 4K8RD 2P1YA 4Y1TA 4AENA 2FNWA 1RI8A 5GS0D 4G1MB 1JOIA 1OZTG 5CD5C 4NHUB 5C2UB 2DEXX 4OKVB 1P5UB 1Z32X 4GP8B 3GSNH 4EPZA 4H88L 2J8HA 1DFXA 1J8HE 4GQRA 3AUVA 4HOWA 1FL3B 2VABA 3THMH 2P52A 5B1JA 4FHJA 1GZHA 3DSXA 5DJ8B 2EUVA 3Q44A 1L9TA 4H20H 1ZMYA 3ASDA 1FCGA 2VM9A 1XCWA 3DMMA 3ZZ1A 4LEEA 4YSEA 2EIKE 4WWID 3ULVL 5CRUA 2FULA 2KCKA 3NIGB 5A2CA 5C70A 3AGWA 4ZUSB 5ACZB 3CVQA 4N2LA 2N0KA 5HQDA 3QWWA 4ZUVB 5C7XL 1ONQA 4J8DA 4L8DA 3U64A 1IM3B 2F5AH 2YD2A 3STLB 1N9AA 3UBFA 5BJTB 5KSAD 4B0ZA 3ZDZE 4JS7A 3IETA 1CF8L 4K94L 4RGOL 3MGOA 5E2TH 1SJHA 2V37A 2V5SA 4U1LB 3RDTD 3GS7A 4KRPB 3WN6A 5J11B 3MRCB 5G2NA 3GPSA 4O5LL 4GI6A 2H8PA 1CT8B 5E00A 1G87A 2G4EA 5T3ZH 2AJXL 2EC9U 1N0LA 1L3NA 2L7EA 3NCYS 3D9OA 6TLIA 5LX8A 5FWQA 5DD1H 1EHLH 2C4FT 1FHGA 2BERA 2AV7B 1OCOE 1ZV9A 4RDBA 3VFUB 3LXBA 2RAMA 3UTZA 1N4XL 2XETA 3MXVL 2UUDK 5C08B 1BIIB 2QY7A 1XGRA 3BPOC 4GKNA 3QI9B 1NICA 1QAWA 1FAIH 3ZDXB 5EIVA 1ETJA 4F58H 4ONFH 4JRYE 5GRJH 4KMTL 1H6FA 3S4SB 1GH7A 2IFFH 1UASA 3J5QB 2HPTA 3T2IE 2BP8A 4QNPF 4YJZL 4S1SH 5F6IB 2IGTA 1D3CA 3IN2A 2CLVB 1O1SA 4GAEA 1IM9D 1SN2A 2GSIB 1M2VA 4M1DH 4A55A 3P3SA 4AKQA 2YAOA 3ZGQA 2AI0H 1OP5H 1WWBX 3MLUH 4PQXA 4UWHA 4JM2A 4F92B 3HW7A 3MX0A 1GAFL 3Q5OA 3CLEL 3CVPA 1ESOA 2I7OA 3L5IA 4GSDL 5CHNB 4DZ8B 1NJ9A 1P4UA 1U8CB 2F8OA 4M6NL 5KJ4A 2AJUH 3LB6C 1INQA 3T6VA 2AFNA 1OOWA 4ZS6C 3CDGA 3V6ZB 4PVNA 4KVNL 5IOKA 5HI5D 3ENEA 3HRAA 3OF6A 4JEHA 2BNQB 4XWGH 5JORA 3LPGA 5C07A 4Q4EA 1E7VA 4N2KA 5CCGE 2AHIA 3RKDD 4JB8P 1A6ZB 1QZ1A 5FYLH 1P4LA 1OT1A 4LAJH 3UERA 3KLAA 4J2QA 4MTMA 5I73C 3TOPA 3DPDA 2YWYA 4MB4A 5I0YA 4JR9H 3CVWA 2RTTA 4MCYB 1M1XA 3EZJB 3BT2L 2PO6B 3IMTA 5TPWL 3WL9A 2ZU6B 3SQVA 1Q9OB 4GMJA 3NABH 1HQRA 3VRLF 4TNLA 1N0RA 3CBRA 1NIAA 2GUOB 3MNZA 4QCIB 1V8HA 3WTWA 2Z6FA 3MRKB 3SCMA 1XCTB 3PU7A 3RWGA 3MYVA 3KWUA 3EGXB 1HO8A 1LO4H 3AB0B 1UH2A 4HB5A 3FC8A 4KNUA 4KY1L 1OPGL 1KTOA 5I1IH 1X3DA 4XVJL 5GRXG 4JFYA 5J6HB 3HLAB 3IETB 5FK9A 4CZ2D 3ARYA 1MHPH 4HUUB 3JWOC 3WKYA 1GSMA 2DRUA 1T04B 4XMXA 3AVEA 1PIGA 4Y5XC 1EVUA 4LASH 2C1OA 3TEZA 1QR1A 1SLWA 1HZKA 2C2LA 3QFJB 1HIML 3E8UL 5C0RL 1XGZA 3VU1A 2X4TB 3KPQB 3FWVA 1CYXA 2Y69B 3KPRE 4L05A 4AYMC 5JIDA 1BXVA 1NGPH 3ARQA 2DQGL 2DW5A 3ISYA 3K6OA 4GRWF 3O0RH 4RIRA 4JD2G 1AY1L 4EN3B 3RWJB 4MBRA 2EIBA 2GSGB 2M26A 3O45A 2DTSA 4YXHH 3H3BC 3LRMA 1ZHBB 3CPLB 3RUGB 3WNIA 4IBTA 5AW0B 4ZXBD 2GK2A 3BMVA 3VSTA 1ACZA 4OLXL 1AIFB 3V5DB 5CBOA 2AQ3A 1YJDL 3NCWA 5B7FA 2YXVA 2OCCB 4FP8H 3TFKC 3DJZA 4OH2A 5KSBB 1H3XA 2AC0A 2VDRH 3GJFA 3K81A 3WGUB 2LAHA 3ZT5A 2ODIA 1AQHA 4CVUA 4WU5B 3C60A 1MJ8H 2YUVA 2IDQA 3K1DA 4GO8A 3W2DH 5C0CB 2VYIA 4ZAKB 2B9BA 4Y2NA 5B1CA 4JRLA 4FZ8L 3Q9QA 3H2QA 3IGKA 3VMOA 2FRGP 4HS6B 1P0SE 4NKMB 4U07A 1U92A 3MNVB 5B8CA 2EZ0D 2ISDA 5ABDE 2B3RA 1E2WA 1MKFA 1XGYH 3EH5B 2IQAB 4PD4K 4DOHB 5HNFA 1M57B 2A74C 2AK4D 2RCSH 5DQJA 2IDTA 2AEWA 2VLJA 1MCJA 5GRVK 2ZOLB 4LL4A 1NC2A 2CKBA 4HG4K 3T8FA 3VJ6A 3J07A 4W6YB 1E4WH 1X4XA 3FNKA 2J4BA 4WDIB 1OARL 3FYEB 1G7JA 4PJFB 3U0PA 4ZZFA 3FQ1A 2RHEA 3O2DA 3BUTA 2FJHA 3T3MF 5IHHA 4APQC 4DO5A 3FO9A 3ZPJA 4N0UE 1DHKA 2QQLH 1I8IB 4FQXB 1CBJA 3CUPA 3LN5B 3N40P 4XXDA 5GISH 3FT9A 2N1KA 2RIKA 2OFQA 3SDCD 3RL2A 2C3WA 5CD5D 2X2YA 2VRKA 2O93L 3EIQC 4I1RA 3GMNB 4CJ0A 5IEKB 2H0EA 2ALWA 1K5NB 3C12A 1GGUA 4H0GA 2BCMA 4KK5C 4MFHA 4DFHA 2JCCA 2Y0BG 3KLLA 1CU4L 2MNUA 3MSAA 3FH7A 3S6CA 1ZV2A 5DJCA 5J5EA 3M88A 2YUZA 4Z77A 4O1PA 4JA7A 1ZE3C 2D31B 3OPZH 3K71A 1IZKA 1OGSA 3W9DA 4PGDA 5I8CA 4QO1A 5A3ID 1LO5A 3CX2A 4YHKL 1AQDB 1R75A 1HAUA 4B5EA 5EEZA 3QUYC 1S7RB 2LLNA 3ZHZA 1OWLA 3TBSA 2MPAH 4TSAH 3GXTA 3AUAA 4G7VH 4G11A 3I75A 4MD4B 3CC1A 4N86A 4F93B 3O6ML 5E6IA 2KZKA 1CS6A 3F3HA 1KJ2H 3Q06A 5E9DB 2WMOA 4TTGA 5DD6B 3KL5A 4RFEA 2H26A 3IHYA 5CGMA 5I19L 5BVJA 3GUTB 3UM1A 3QIUC 1ORSB 1RUAL 1MCQA 4QHUA 5JXAL 2NNCA 3EH4B 1OSZA 3TPUA 3UBXB 4KVCL 3DSWA 1S7QA 1HL5A 4Y9FA 2WP3O 1T5XB 3NCJH 5E1AA 4OCLC 4MJHA 2EDYA 1BFVL 4E41D 3DJ9A 2PP7A 1MLCB 3FMGH 4FHBD 4NQTA 4GCNA 2ENPA 4FF9A 5CP3A 5DQDL 5HVHB 1WH0A 4B50A 4U1NA 3UX9B 4LCIH 4QXGH 3VQ1C 3L5JA 4I87A 5LWYL 3FU5A 2Y1YA 3M8OH 3LEYL 2H32H 5FLVA 2F18A 1K8IA 2Z31D 4JFFD 4NT6A 1RZJC 5IW1A 2WTPA 4IBQA 4WUUE 2B6CA 1QR4A 2W80C 4YIQA 1T4KA 2NY2B 2ZOTA 1KGXA 5FPIA 2L0DA 3WIFA 4HT1L 5GZOD 1MJ8L 1KBGH 4BSXA 2OTUA 1BQUA 4AR9A 5JC1A 1SN0A 3CVCA 3QUMA 4QHNB 3TCXA 1O1TA 1AXTL 3LN9A 4AGLA 1HXIA 4PRDB 4ZK8A 1NI1A 2DEWX 2GHZA 3WFBL 3TJHD 4FJYA 5F1SA 5JDSA 1A7PH 2ETAA 1YVLA 3MJ6A 4A7TA 2FTAA 3CBKB 5J11C 3DTDA 4J8RA 5IVZA 2BS8A 4GRLB 1BJ1H 4Z3FA 1T6BX 3PPEA 4HS8H 5I28A 3MGTA 2YN5A 4N0CD 5T3ZE 3GHBH 4ADIA 1UN9A 1XF1A 5D5ME 1W0YT 5A23A 2XWZA 2QJ1A 3HB3B 3SKUD 2FQDA 1HH6A 1IAII 3K74B 1K6QL 2J4DA 1PE8A 3VGDA 3SI5A 3VD2A 1BVLB 1UD2A 1OARH 4L9PA 5A1AA 2ILRA 4H0IA 4HBQA 3NVQA 1NAMB 4NQEB 3A22A 4JHUA 5CM1A 1WP6A 4MNQA 1BFVH 5KYYB 4PRIA 1TN7A 4HBCH 2G3XA 3A14A 4BK4A 4ETQB 3CFUA 4YHPA 3T65B 3Q43A 2AVGA 2GIYA 2JJSA 3P11L 4ZOEA 2MAPA 4EN2A 1UWGH 3BRDA 3L5HA 4GB9A 3ZQWA 3QKYA 5IUSA 1AXSA 2DEYX 2CLZB 2HLFD 3WNNA 4A7GF 1A6ZA 1IBGH 1PLAA 1IQDB 1KELH 4L4VA 1FG9C 2VGXA 2ADFL 2Q2EB 3O6FC 4OJEH 2VDOH 4AX3A 3ISWA 1H3TA 2IMMA 2WXGA 3GJFB 3OKDB 3B7RL 3DSSA 4MCYA 2FAUA 1S8DB 4FXGA 3MCKB 2EUZA 1N19A 2DQIL 2EKSB 5ALBL 4D3CH 2ARJB 3AG4B 3GBNH 5FQ4A 3OKEA 3MV7A 3VFPA 1SHWA 3SBTB 4TSAL 3EO0B 1MH5B 1A21A 4YDLB 5DMIL 4HKJA 3JBG7 3FUHA 1HDMB 3N40F 2JLBA 2HWZL 3QDGB 3FUMA 3ZRHA 3GXUB 3HC3H 3PXLA 1FRGL 4HMEA 4RAUA 5I18L 2PCXA 3FRPA 2O5NA 3DVIA 5HHVL 5IZ7A 1B0WA 1ORQA 1DBKL 4QRQB 3IJHA 1GYVA 3SJVE 4M6OL 4HUKB 2YWZA 1T4KB 4DEPC 5AW2B 1P7QB 4NQCA 3L1GA 1PAMA 2IDUA 3HCVB 2IAMC 3CVHB 4NENA 5AZUA 3ASGA 4LPVA 1HKLH 5DJXB 4ODSH 4J6RL 4R5XA 1DQKA 3TT1H 2RQEA 5KJLA 5IJKA 1WTGT 4KTEH 3ZXSA 3RKDC 2QQLL 1JI2A 4AMXA 5MENA 2A74A 4LLQA 3QIWD 2PNNA 1QBAA 5JMRA 1AGEB 1XB3A 1FIEA 1FLRH 2J55A 4IOSA 5G4NA 4WWKA 1L0PA 2XLLA 2ZTBA 3UTMA 3QO1A 1CLOH 4NC0B 1UWYA 4JHVA 4PLKD 4W9FC 1PJ9A 2DWTA 3HLAA 1O5MA 2C9RA 3A6OA 3KDMA 1OF2A 3FPXA 3MROB 4JL2A 2W0FB 2DJMA 2XWCA 1QVOB 5CHEE 4EQFA 1E5YA 4Y5YC 3OR7A 2P9LG 3Q2CA 3QHFH 1YMMB 5CFAA 2OL3B 3PJLA 3A4AA 2RR3A 5JOEA 5FYKL 4TNVK 3MV9E 4PLJC 5I6LA 2R56L 2FWSA 4G71B 1AZRA 1B88A 5B39B 1RZKC 1PYWB 2LVEA 4TSCL 2Y1EA 5HY9B 1KB9K 2JLPA 3HI6L 4D94A 4UCFA 4KX8A 1RVFH 3LVEA 4HS6A 4XC3L 2WIIA 2ZG3A 1INQB 2OM5A 4QKXB 1GGIH 3HDXA 3OAWA 1YO4A 3T87A 4FQQB 1FQ9C 1QPKA 3IGLA 1S46A 4FXTA 4NQCD 4FNLL 4ATTA 4EQ3A 5K9JH 4A04A 3B9VA 3NSFA 2P5WE 3QCVH 3T9KA 2WSPA 4I3SH 1HYTA 3TC9A 2KZTB 2BNUA 4BZ2H 5I1KH 1LEIA 5ICXB 2AKRA 5LG6A 2GW1A 3G2VA 1G7MA 1XGUB 2CBPA 2P46B 4FDWA 3TVMB 4HAKA 3VGBA 3B2VL 1G7LB 3NCBB 5F1KC 3VXUA 5D1XB 3S3DB 1LMKA 1SJXA 4HK3N 4Y2DB 4ZTPH 2E47A 2QKIB 3C09B 2A9DA 2FX9H 1GAFH 2EO7A 5LAXA 3BWAA 3LKQA 4WNQA 1CC3A 1GZHC 1YMHB 3LHAA 2YOAA 1L9MA 5CEYA 4N0UB 1A4AA 5AJLA 1TZGH 4ZX3A 4LSQH 4PJFA 3U0PB 1A2YA 4JW1A 4GUQA 5I8EA 3QWQB 4IU3B 1JHKH 4OLZH 5JHBA 1L7IH 3ZL2A 1J0HA 3ZOAA 3BQOA 3DUHA 4PJEE 1T04A 2JMRA 2BPBA 4PGCB 1HESA 1T83C 3DO4A 3N3EA 1BM3H 4AR1A 3BXNB 4X9YA 3WEMA 4EIZC 3LD8B 1B4TA 3P7WE 3FZUC 3QIWB 4O5LH 2DKUA 3LN4A 4U8HA 4Z8FL 1A7RL 3D85A 2J07A 1I7UB 4V2CB 4LKCB 4M48L 3DX9B 5MEOA 4UMSA 1L9OA 4NZ8A 3C5XA 5DK0B 3DSVA 2WNXA 3ZN6A 3MJ8B 1IJ9A 4TQPA 5HYIA 3ULVH 2QKSA 2ADGB 1TU2A 3RRQA 1H3PH 3P02A 4CVZB 3P7QE 1JN6A 2V5TA 2P5PA 4JO1L 3NCYP 3D4GA 5E5RB 3W82A 1IL1A 5C0CE 4OZIE 3AS2A 4C56D 3RIFK 3KR3L 5B4MD 1QZ2A 4FLSA 3KEZA 3D4YA 4LGSB 5KS9E 1UCBH 4UI9K 1XIWD 1NA0A 1ZVSB 3QJHB 4OZGF 3MI6A 5D55A 5CJXA 1BQHB 1A6UL 2B0SL 4G5AA 4B0MM 2OEWA 1HCFX 4IBVA 3P3TA 1BHGA 4U0QB 1N7ML 3ALPA 1NFKA 3VXPB 3WNOA 1H0AA 3CCHB 2EH7L 3ZTJH 4P49A 4YDJB 3AT8A 1DE4A 1NCDH 3P4LA 3RUGE 1X9LA 4Y6PA 5E7FA 1Q94B 1KMGA 5D7JA 5C07D 3RZCD 5DD1L 3BT0A 1QEXA 5CILL 4PJ5A 3RX8A 4YSSA 3S0PA 3U4EB 5L2KD 3HRPA 5C2YA 3BSZA 1A4BA 4NSKB 3RA7H 1CD9B 3BKMH 4FLRA 1RU9L 1YUHA 4QPEA 1BM3L 2DLIA 1OV8A 4PCKA 4WI7A 2JCWA 3Q0HA 2GRLA 4TLSA 1U3YA 3HZKB 1QOKA 2P5EA 2XU9A 1N0XH 1TCRB 3DRTA 1TSHA 3BUYA 5ICYA 3Q2WA 3L4CA 4AXWB 4QRRE 4U2YA 4QLRA 1A17A 4JANA 3X1NA 3GI8H 4D9QD 3WXXA 3QPKA 1KZYA 4ZUVA 1HHIA 1F18A 1G7QA 1SJVA 2ZSVB 3ARBC 3MOBH 4JZJA 4P0DA 4XP4H 2K4WA 1ASPA 4QRRB 3L7EB 4LRNH 3STLA 3LKNA 2GK0B 4GUPA 4OIFA 2Y6SD 5BJTA 3SSBA 5DULA 4XNMA 3GGWA 4LAQH 4ODUA 4P5SA 4TNWK 3B3IA 5FHAL 5FYJE 2PWFA 3KS2A 3AROA 3QJOA 4W1TA 3P3UA 3B56A 2OR9L 4HGKC 2Q7NA 3D9AH 4YC2C 1H8OA 2CGZA 5EYLA 4UQXA 3TYFA 1RUPH 1OR7A 5B1AB 2ZUYA 4YXKH 4N66E 2JQAA 3RPKA 4ZSOA 4Z95H 2OCJA 4ESKA 5C0EB 2BWDA 4LVEA 1OAXH 4CRWA 5JJTA 4R2GB 1I1AA 4GBXA 1ETZB 3T04D 1ZGLA 3UTSD 5CCMA 3OGCB 4EUPH 2OX5A 4LZKA 4WW2F 2CHDA 3AG4E 1UM5H 2YD0A 2XG5A 4PV8A 4RISH 3WIIL 4J8FA 5H2BB 2EKSA 2ZXGA 1BXUA 4HJJH 35C8H 2G2RB 2VSKB 2WO3B 1P1ZA 1U3HA 5DD3H 2O6EA 5DJZA 4PRNA 5IG7A 1MRCH 1YPZA 2WV3A 4UTBH 4KAQL 3DNZA 4X6CF 3IFLL 3MODH 5DUJA 3ECUA 3TO4D 1CXHA 1AMXA 1P7KA 5D2LA 8TLNE 2KZ1B 2P9PG 1AXSB 1FL3A 1YECH 4O02L 3QQ3A 4JRWA 2VIRA 4WRLA 3BC9A 1EAOA 2UY1A 2E9IA 5KBNC 3K2UH 1RIUH 2FWOB 4RGMC 5CINH 3WXWH 2DQMA 2PUQT 4NHUA 3TWYA 1TKWB 4XNAA 1BOGB 3B5HA 3KVQA 4KJWD 2Y3NA 1K2DA 1MHEB 2I24N 4NQQA 1E3XA 2GJ6E 5JHDA 4KX7A 1O7DE 5DFAA 3ZRCC 3LPOA 1SDYA 2Y36L 4R2GC 4UM8A 4YPJA 4B53A 2PPFA 3NIFF 4C59B 4F33B 4PJEB 3KGRA 5A7DB 2K7PA 4U6TA 1E9QB 1LWRA 1NWOA 4U7EB 1XL6A 5KUMA 2TRYA 3QH3B 4X6DF 4HWUA 4LLDA 5KBMA 3CK0H 4IIQC 3ZKXC 4J5VA 4I1MA 1XMEB 3R4RA 3TVMA 4FMFA 5CCKH 3ZUVB 2ZF8A 1AHKA 4GRLA 4Y4FC 2PR9A 4AYEC 4DUXA 4D9LH 4N0YL 4XHJC 2CH8A 4ORGB 1SVCP 4FLOA 5KBPA 1MG2C 3AG3E 1CGSL 1IAOA 3L4YA 4OTXL 3FBQA 4AYID 4BH8A 4F7PA 5I2IA 1HE8A 4KK8D 2FIKA 4AM0Q 2ZGGA 4OD2A 5IMMB 3V6OE 3US1A 4X5QA 3TWVA 1NUDA 3IRZA 3BP4B 5FO9B 1N6UA 4HHAB 5CLZA 2DQDH 3V4VB 4AM9A 5GGTL 5CEXB 4PJ9B 1C8PA 3PWJA 5DVOA 2YC1A 4FQ1H 3CV5A 2G30A 4HXBL 3FN3A 3MLZH 4IK7A 2J6EL 1QFPA 5ENTD 1VACB 1JGUL 3BGMB 4WJ5B 5CF3A 1E8WA 5KBLA 2VDOL 3SE9L 5F3FA 1WZAA 2A9ML 3PWNB 4YBQC 2AERT 2D0GA 2XA3A 3BPCA 4GAJL 5FGBA 1J8HB 4MGXA 2C7UB 1FFRA 2XKNA 3MXWH 2FI7A 1ECZA 5ESAA 4A1RA 1A0QH 5JPNA 4V11A 1QSEE 2NUTB 1OTTC 2X4NB 4G42A 5F89B 1KLUB 1WD9A 1U6AH 1SOXA 5JBIA 2XWTB 3BVUA 3EOTH 3UEZA 4CSPA 3C8KB 2X4RB 3OX8A 4UAHA 4CVZA 1VKXB 2Y1FA 1LXMA 3A23A 2DIAA 1JRHL 1X9UA 3BSZH 3IDXL 2IU1A 5DS2A 1T21A 4AXHA 5I18H 2FHFA 1YUHB 5J57B 3PHQB 4MWFA 3N9GL 1HZLA 1KB5H 4EBAG 3NQKA 1KJOA 3Q7AA 2BC4A 4EIUA 4ELME 1IMHC 3FSVA 3L8QA 4ZFQA 5T3XD 3HNVH 3NCJL 1UOKA 1HOCA 1KCWA 3DGDA 2V9UA 4AC2A 3LDBC 4APXB 3N85H 4FNTA 2BWQA 1JHTB 5IJBC 3V79C 1RP8A 4IU3A 4RDQG 5DWUH 1B2YA 1S4IA 5LB1A 1NBZB 3G6JA 3I6KA 4UQZA 2DMCA 2DLHA 2DQFA 2XI9A 5IQMA 3R9AB 3RO2A 1G7MB 4BWRA 3LZOA 3QUYB 3IHVA 3R8BB 3L4WA 5DWPA 5I16B 2EXTA 4BTBA 5FIEA 3HZMB 2J4WH 1KCVL 4TLTA 4UOJA 2BIPA 3RWEA 5DLLA 1IC7H 2OMWB 5I24A 1E4KA 5LXGH 3FQWB 1FH2A 3TXNA 1NMAH 2A2QT 5G04C 3BP7A 4MAZA 3KYKH 5H37G 4FABL 4LKXA 2JQZA 1L0YA 3NN8A 1HX8A 2IY0C 1N3NA 4J7WA 3PUCA 3DXAB 3KJ4C 2EINE 3CXHK 3WEAA 5ITFA 4ATWA 5DU7A 1KBKA 2WSDA 1J18A 2HLFC 2YS4A 1DQIA 1IGML 3ESVF 4AH2A 4DN3L 5FB8A 3DPBA 3UIZA 4FI7A 2KQMA 4Y2OB 4AQOA 2XFXB 4DOHE 2CRIA 4P3CH 3ANNA 2XX1A 1OHQA 4YGVA 1DO5A 3D50A 4N5ED 3LKRA 1ZHKB 5DFWH 2EYRB 3L2MA 1SLVA 3TYGL 4DT2A 4ZW3A 1ZANL 3SO8A 4X42A 2MPVA 4DTGL 2NW2A 2AP2A 2WYTA 3QNKA 4DP7X 4Z7WE 2BSRB 5GGUA 4PCYA 4WCYH 5BMFH 4BKSC 1BAWA 4JPIA 1ZWIA 4E42B 3ZE0F 1GOFA 1I1YB 2F1BA 3GSWB 4HCRL 3D9LA 4UQBA 4NKOA 3X13A 3EDDA 4TV3A 4ERSH 4JO3L 3CZNA 1NL0H 2XGOA 1ET7A 4IDLA 2H9GA 5HHME 2BRRH 1A3LL 3GRBA 4PMFA 1DSWA 4LOUC 4XPFL 4AM0A 3I75B 5HYJA 4J12A 1PSKL 2WO4A 2VXVL 4MLSA 4PSRA 1KDJA 3F7LA 4KKZA 1FGNL 3PLYA 1E2ZA 4FQLH 1IFHH 2VGYA 5DZOA 4ZAKC 1FNGA 5D7SH 3MCG1 5G05J 4WHYG 3UTTE 4CVXA 3L3JA 4GW1B 1MLBA 1IAIL 4HZAA 1FHNA 3HRZB 2R56H 1MVFA 2GROB 3QG6A 1RSFA 2DQIH 2K45A 2HKHH 2XA8L 3IMUA 1KCBA 2ZUWA 2WAHA 2JK5B 1E6JH 4GKZB 4XX5A 2ZJSL 4XCCH 1I8KB 3APDA 2DWXA 4KMOA 2EO9A 3SODB 3IXAB 2QPFA 1L0QA 2Y7QB 3MRJA 4MA7H 3N04A 4NT6B 2WZ5A 1XFPA 5IW1B 3ME0A 1SMOA 3TO2B 4F8TA 2W60B 3QUMB 1D2OA 3E80A 4G72B 2IG2H 3RWIB 1JGDA 4G9DB 3W56A 1WGOA 4OU3A 1J1OL 1D5BB 1HSBB 1YAZA 4GQ9H 1YEFH 3Q1SL 1MY7A 3OC5A 4X4KA 4PJEA 4QT5A 3GPEA 4K8RC 1KYFA 2IQCA 3HN3A 4FFWD 3BPLC 4HJ0D 1DVPA 2VDNH 2H4EA 2KXPC 3VXME 2GABA 3L6FA 1DLFL 1KTDB 1YNLL 5AL0A 3MGBA 4X8GA 4XOEA 2VDKB 5L2KE 2YKLH 3UL4A 4D9WA 1AKJB 2R1XB 5KSUA 3DSFL 4FTVA 3DRAA 2BMKA 1F1GA 4FHKA 4I6JA 2LO6A 2F7OA 5KSAB 3Q48A 4V33A 5F0LB 3E6FB 4DGYL 2C9XA 5JA9A 1AHWB 3QDJB 4CUCA 4KZEL 3NAWA 5DA0B 4LSPH 3EG9A 3T71A 1MCDA 1LO5B 2H26B 1I9JL 3C60B 1KTKE 2GKIA 3RQ3A 4F5CE 4R97B 3C3QA 1PZ5B 1VGEL 3K6IA 3AREC 1E6JL 3FRUB 3GC3A 4PLKC 3P1UA 4GTPA 2BM3A 2G2NA 4NN7C 4KHTH 3RWJA 2WMPA 3GMQA 3CV0A 1Q4NX 5C0NC 3IE9A 1Z6TA 3BHBA 4AYDC 2KPNA 1M7IB 2XG5B 2JI2A 4N8VB 2HXAA 3BZDA 5JXED 4XRCA 2ED9A 3NSJA 4WW1B 1KBBA 3CX5J 4WNDA 2IBBA 2O6CA 3P4NB 5TDNA 3IBEA 1KYDA 3NJLA 3EFOA 4PRPB 4ZN6A 2H2PD 1ZLUK 3QXDB 4E36A 3KM1A 4NUGH 4U95D 5MHSD 4WZ9A 1WHPA 4XODA 3OSKA 4LLDB 2GRRB 2Z35A 2Q2LA 5H4ZA 1MN4A 2XYBA 1MCRA 4DKTA 1EAJA 2MHKA 3RZCA 3S88H 3ZYJA 3GNMH 4NQVB 1OGTB 2Y1ZA 5EV7A 2XPIA 3MZLB 3ZXAC 2RJMA 1G5GA 3ARGD 3WN5A 2VM4A 4OGZA 4AZUA 5I1IL 2W0PA 3A6BH 3ECBB 1X3WA 1OCWL 4FKKA 2WLLA 1DEEA 3PF2A 5J1TC 3INOA 4KXZH 5IOPA 1OWPA 4AEZC 1VAHA 3MNVA 4LPTA 4WDIA 2V2WB 3T09A 5B8CB 3BRGC 2A77H 2WBKA 3MV8A 2R4RH 4QXUH 5F7WC 1BBJB 2XVKA 2BTDA 2ZCHH 4HA1A 2N1TE 3QDME 4L8SA 1K8IB 4U7SA 2IFGA 2WWKO 3OGOE 4WGVB 4PJIB 3S3JA 3UIPC 1EEUA 2LE9A 2QSVA 3SZ7A 3D18A 1JWFA 5CEZE 4FXKA 2PO6C 3VI4F 1J1XL 3VGFA 5B1BB 3U1SL 3O41B 1CPUA 3VI3E 4W9HC 3A4DA 2F54B 3AT0A 1I8LC 3GXPA 6FABH 2JIXB 4NWUL 2B14A 4YO0A 1HH6B 1J1PL 5GXBB 3DX8A 4L8CB 3IDNB 2UXTA 3NG5A 3O3DA 5KSBF 2VLRD 3M45A 5IFJA 4TM9A 3BGMA 4WJ5A 3APNA 3FK3A 3ZIYA 1I3RA 1T3FB 4DPBX 3CPLA 4FU3A 3RUGA 2EDFA 1MFBL 1WVZA 3NCXA 4H8WL 7PAZA 4UT9L 2PF6A 2A9BA 4NZUL 2F53B 4WGWB 2AI0L 3RILA 4UTBA 5C7XH 1NFDA 3BJ91 1HVXA 5TF1H 2BIIA 3M07A 1HN1A 3H53A 3MACL 1E8ZA 5FYKU 4MRUA 1G9MC 3GTVA 3W9DB 3TVMC 3PWLB 1FJ1A 3ILDA 3MUGA 5FOJA 2FSEB 4PG2A 4GW1A 4F8LA 1JZ3A 3MCXA 1HINH 3IXTB 4AEHH 4HSCX 5CKAA 1J05A 4OAWA 1ZPUA 1XH0A 2DL9A 4CC1A 5AAPA 3K4ZA 32C2A 3OAYK 1HG5A 3O6MH 4QRTA 3TURA 1VJSA 4U8YD 1QWNA 2NY0D 3ESLA 1FVCA 3OAUH 2IAAC 2WBWB 3MA7A 4Q2ZB 4UM8B 2YSSB 1K1AA 1X5LA 3NABL 1ASOA 5IB3B 3WHXA 1Z0MA 4JFED 4KKAC 4GEJA 2B9AA 4ONGH 2KCVA 3PZ4A 5FUOL 3OB0K 5C0AE 3O0RL 1UA7A 2BRQA 3GMPA 3V6OA 3IF1A 1HX0A 2ZXQA 2I9TB 2PQRA 2JH2A 4MCMA 1YNKH 3E6HB 4UILH 2FQFA 1IE4A 3ZW3A 1DQJB 4RDQF 3ABMB 4ZFZA 1EO5A 4HU8A 2EDWA 3CVLA 4BFBD 1NCCL 4HUXB 3DOIA 1IAIM 4QRSA 2DL2A 4GS7C 3IFPA 2Z7ZA 2WXHA 4YDIH 2EACA 1RXLA 1MJJA 3S7GA 5CEZH 2VN7A 2HJLA 1WIPA 2HB0A 7TLNA 1FCHA 3AM8A 4XCEA 3PWJB 3SKJH 1RJZB 4OJDH 3TJPA 2FZ3A 3KHQA 5AB0A 4MMXC 1AR1D 1MDTA 4F57L 5HNHA 3B9KC 4Z6AT 4J6IA 3KPLA 2R0KH 1M9SA 2CD0A 4GW5B 4E9WA 3V0AC 1PKQB 3WFEL 1VACA 4YHLH 3ZTNH 4UOZA 3PREA 1KWGA 3QJTB 3P9MB 2Z92A 4CGWA 4WUUD 1BEYL 3QIBD 2AEIT 3HHRB 3R06A 4IW4C 5IHLB 3MJ7A 5A2FA 1WAAA 1FJWA 1INEL 2R03A 3KW8A 3L3GB 3MFFB 4FNRA 1EHNA 4XPBH 2DYRB 3L54A 1JD7A 1PEZA 4M29A 1BZQK 1TJIL 4TN9A 4WV1A 4I1AA 5HPMA 4WKXA 5KBAA 4AGPA 1MFCL 1C08A 2LAAA 3EJYD 5CWSA 4DFIA 1IC1A 4N2CA 3WTYA 1X5ZA 2OXGB 4G1MA 1F6LL 2I9LA 1WAAE 3EUUA 1FAIL 3GO1H 4PRHE 2IPUK 4Q8BA 1QSVA 2Q1EA 1KZOA 3FT4A 1UACH 3H3PL 2TAAA 5K1NA 3SE8H 4CGVA 1RQ5A 3LH9A 3ISRA 3FFCE 2EO1A 3PV6B 1AH1A 4FNSA 4HG4J 2PQNA 4PPTA 5I6NA 32C2B 5ANLA 4QRTB 4B7IA 2ZPKL 4G5ZL 4PJ5B 3V31A 4WHYH 1ZHLA 2XHEA 1EFQA 4LU5L 1SFDA 1KN2L 1ONQB 2HT3D 2Q7FA 2AGJH 1E4XH 3GI9H 1CURA 5MENE 4X4XB 5EBMA 4BKLB 1ITCA 1NIBA 2ESVA 3WMSA 5DLML 1E7UA 3C09C 1F8TH 3MNDA 1JGEA 4GI9A 3QEGH 3G5VB 2Y4UA 2BZ7A 4PB0H 3JTBA 5J12C 3TJEH 4HOUA 5D70L 4HJEA 3RU8H 4UOQA 1JCRA 3R0MA 3S7FA 4PV1C 5DD3L 4EIBA 4NQDD 2LGNA 2PLTA 3H9ZA 4JQXA 1KCRL 1DO6A 2G0LA 2Y4SA 1KOAA 1TJHL 3GMMB 3MODL 2E56A 3H4HA 4LK4A 5DC0A 1DCEA 4DQOL 2BS71 3AU5A 1TJFA 3D39D 1VF5C 3L3KB 3KPOA 4NI6A 4JDZB 3QUXD 4KGJA 3NACH 2QSQA 5C6WH 3NGBC 3P2DA 4X7TA 4Y2OA 2J9QA 2I5YL 1N4PA 1EAPA 3M1BB 5DMKA 2DQEH 1Z3YA 3RAUA 1CFQA 5DI8A 4GKLA 3F2PA 3ABGA 3UP1A 4GSUA 2W8CA 3GRWH 3QDJD 3THML 3U30B 4L1DA 1FH5L 1TMCB 2ADIA 1K85A 1YG9A 5K9OA 1E6OH 2BNRA 4HD9A 4KROD 3SE8L 3KL3A 4MQ7A 2CCWA 1TU2B 5EIBE 4L4TD 2EIJE 4I4WA 1EDUA 3BEVB 2YA2A 4XWOC 3UAJD 2ZG1A 3NAAL 1N9PA 2VDKL 3MCYA 2J21A 4XT1C 5F7LB 1AR1B 3T08A 4K5MA 1I9EA 3QNZA 3ETBJ 3N91A 2EE2A 3D85B 4WY7L 3KDMB 3MTRA 4YR6B 1QF1A 3SGKA 3L3IA 2BSED 4OUUA 4OLZL 1HXYB 5HYSB 2YAMA 1AHWA 5EU6A 1CJYA 1Y18A 2ADGA 3D6GA 4KRLB 4PRAA 1GZQB 2CO2A 4XH2A 3CLFL 4YDVA 4XEIG 1WBYB 1KYOK 4M8UA 3NSXA 4HUVB 1OGTA 3GW4A 2DIJA 4QIRA 3IU3B 4PG9A 3MRBA 1QI3A 3WENA 1U2VG 3VXOA 2WLMA 4R26H 1WS7A 2DOCA 3LQAL 2FEEL 4N5PE 5AQ7A 1TG8A 2WK2A 4GO9A 3CQPA 3P7TE 4LP5A 3CIQA 2A83B 1AC6A 2D9QB 2JTDA 4WW1A 2X28A 4NQVA 1JBJA 4L3ED 5DFVC 3NJVA 3APFA 5D1XA 5HRYA 4NAMA 4QRQA 1B0GA 2YHEA 4ZUSA 4AV7A 3N43F 4N24A 4K9EC 1H3LA 5ICXA 2OLDA 1YMHA 1OAYL 2NTFA 4P2QE 4AV4A 4ILIA 3ZZSA 4NDMB 3ZSSA 5F96L 5FX3A 5L8PE 2KLRA 3RVVD 4RA3A 3AS0A 1SYVA 2YZ1A 1UA6L 2EAEA 4YAQB 2O5ZL 4P2RB 4UB0L 5EU5B 5HHOD 5ACZA 2HG0A 3MEKA 3JWNH 3O4OB 3V0JA 2VDKH 1AO7E 4L1BA 1Z3GL 5CN3A 2SODB 3ARGC 4N9GA 3OXRB 3UJJL 2OMTB 3DBSA 3X1GA 3ZT7A 3APMA 3LS4H 2VDNB 1HH9B 4F7CB 2HJLB 1LO0H 2F1EA 4J3BA 1NCAH 4ILGA 4PJHF 3NOCD 4DGIH 3B3IB 3SDAC 3UO8B 5ILTL 3BFOA 3BD3A 5C6TH 1JGVH 1VFBB 1WSST 4ZFOA 4UNUA 3L9TA 2J1YA 2R4SH 4KYOB 2H0FA 3O3DB 1A66A 4I48A 3NJHA 4Z3GA 2R29A 1S7WA 3CFDA 2WKGA 4RMQA 4EECA 1SXBA 4QTIH 4A7SA 3JT0A 1I85C 1I7ZA 3ZKSD 4NZFA 2BDNL 2JIXD 3TTSA 3WNLA 4AIZA 5MEQA 4X6FB 4MDJA 4YK4B 4MMXA 3MBWA 4U2ZA 4FTDA 1O7DC 2K0RA 3OR6A 3ROLB 4JO8A 1S64A 1YEEL 3B1UA 1RHHA 3MUGB 1NIDA 3LZFL 3V10A 1IEAA 3V7AE 4BIKA 5CJOH 1ETB1 1NSNH 5A6LA 3RY6A 1X9RA 1XSIA 4Y89A 4Y5VC 3UYRH 5C09A 2L4OA 3FYIB 1FGVH 5K1JA 2XN1A 3QJFA 1BOGA 2HT2D 4P46B 3CQFA 3KXFE 3R9MA 3RSEG 4U1KB 4KQ4H 4M56A 4OGYH 5BZDB 2XY2A 3A67L 2IADB 3O3EB 3LPZA 4QHMB 2D2CC 2OZ4L 4HPYL 4ZO6A 3QEQA 3URZA 4MLPA 3CVUA 2R0LH 5HGHA 1YYHA 5DEZA 4I6GA 4K3JL 4JRYD 1QKZH 3ZDXF 2GAZB 2YFNA 1KCSH 2Y1GA 1KCUH 1P7BA 2XGSA 1MCWW 3GXDA 2ICES 5DPFE 1UWGL 2W95A 4Y8DC 3VXMA 1RP3A 5I26A 2G3MA 2CDGB 3VFRA 3T2NL 3EDJA 2FWUA 3BKCH 5F7MC 2X4PA 3U36B 3RWHA 1CE1H 3NDZE 4OZ4A 4ZQHA 2WXFA 3RGVC 3UC0H 3LH2H 4ZSOB 1ADWA 4YN3A 2HJFB 1FLRL 1MVUA