2XPZA

Structure of native yeast lta4 hydrolase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
632
structure length
627
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords LEUKOTRIENE A-4 HYDROLASE
total genus 205
structure length 627
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpzA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpzA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpzA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpzA01
3EBGA 3T87A 4ZW8A 4P8QA 4OU3A 3MSFA 4MTWE 1LNCE 4MZNE 3T74A 3SE6A 4GAAA 1KL6A 4ZX5A 3FXSA 5JXNE 1THLA 3FTUA 3P7VE 1FJTA 2TLIA 3FUFA 1H19A 3FH5A 4XN7A 3FUNA 4KXAA 3DO1A 4ZW7A 1FJQA 4XN2A 2HPTA 7TLNA 1BQBA 3KEDA 5DYFA 3B7UX 5LG6A 3QNFA 3MDJA 1KS7A 2DQMA 3FH7A 5FSSA 5DLLA 4NZ8A 5AENA 4K5MA 3QJXA 3B7RL 3FU0A 4FYSA 1Y3GE 4XNBA 4HOMA 3NQXA 3FTYA 4J3BA 5L41E 3FU6A 3Q44A 3FUKA 3FUHA 3P7UE 4PW4A 8TLIA 3CHOA 4RVBA 1KEIA 4FKKA 5TLIA 2VJ8A 3FCQA 1OS0A 3FUDA 1PE5A 4TLIA 3FXPA 3B3BA 4K5LA 4XO3A 1L3FE 5JS3E 3CHSA 3FUEA 2TLXA 3P7TE 3NN7A 4QUOA 3FU3A 3U9WA 4PJ6A 2TMNE 4ZW5A 5LWDE 1LNAE 5FXNA 5TMNE 3FVPA 3FBOA 4KXDA 1Z9GE 3QGOA 4XMZA 5L3UE 4DPRA 2A7GE 3F2PA 4R5XA 4XMXA 5FSJA 5FSPA 6TMNE 3Q7JA 4FYTA 5HQDA 3T8VA 3FU5A 1PE8A 3B2XA 4QHPA 5LDSA 4K5PA 6TLIA 3FTVA 4XN9A 4XO5A 5LHDA 3LS7A 4ZQTA 4ZX3A 5DPFE 1U4GA 4FYQA 3CHQA 3FB0A 4TNLA 1TLIA 3T8FA 1KKKA 1GXWA 1ESPA 1KR6A 4D91A 1KJOA 4B52A 2XPYA 3PUUA 3T8HA 4XN5A 3FTXA 4ZW3A 3CHRA 3EBIA 3DO2A 4KX9A 1FJOA 1KJPA 1KTOA 4QIRA 5TLNA 1EZMA 5JSSE 4Z7IA 1Z5HA 3T2JE 4JBSA 4E36A 3B7SA 3MSNA 3B2PA 3FTZA 3P7SE 2HPOA 4FKHA 2R59A 3QH1A 3FUJA 4Q4EA 3FUIA 1FJVA 3FV4A 3MS3A 4KX8A 3NQZB 3DBKA 4TLNA 4KXBA 4XN8A 3SSBA 4FKEA 5L8PE 4F5CA 1SQMA 1NPCA 3FULA 3FTSA 3P7PE 5K7TA 3QH5A 3FHEA 8TLNE 3DO0A 4L2LA 5JVIE 1QF0A 2G4ZA 3Q43A 3TLIA 4ZX6A 3FH8A 4GERA 5JT9E 3P7WE 5FWQA 4QMEA 1QF2A 4K89A 5LIFE 3NQYB 1LNDE 4XMVA 3DNZA 4XNDA 2VQXA 4MWPE 2ZXGA 5C97A 3TMNE 5DPEE 5A3YA 2XPZA 5BPPA 1TLXA 4XMTA 4XMWA 3FORA 3T8CA 1LNBE 4MS6A 4M65A 3MSAA 1KROA 3B34A 4OI5E 1TMNE 4OW3A 1FJWA 4R5TA 3T8DA 4PVBA 4N5PE 1HS6A 4ZW6A 5J6SA 4TMNE 1FJ3A 3F28A 3FUMA 3P7QE 4XO4A 4R7LA 1Z1WA 5DLHA 2WHZA 4Q4IA 4RSYA 3T2IE 4D9WA 1LNFE 4QPEA 1LNEE 4X2UA 1GW6A 4KX7A 5AB2A 1ZDPE 4XNAA 4KXCA 1QF1A 1TLPE 2XQ0A 1PE7A 3CIAA 3B7TA 3EIMA 4K90A 1TRLA 4H57A 3B37A 4MXJE 3CHPA 3FTWA 3EBHA 4N66E 4N4EE 3T73A 3ZI6A 3FLFA 3T2HE 2WI0A 4XMUA 4XN4A 4ZX4A 1HYTA 4WZ9A 3N21A 3P7RE 4PU2A 2GTQA 5K1VA 5CU5A 4K5NA 5AB0A 3T8GA 1FJUA 4K5OA 4R5VA 7TLIA 4XN1A 4FYRA 4NAQA 2YD0A 3FGDA 2DQ6A 4MKTA
chains in the Genus database with same CATH superfamily
3HN5A 5AKTA 3L4TA 3BAXA 4EKJA 1T1YB 5E4OA 4OZIF 1VENA 2VSMB 2FE0A 1OKEA 25C8H 1QATA 4M4RA 4QLWA 3P7VE 3FUFA 4WSKA 2NT1A 3BO8B 2CZNA 5C0GB 1A4JB 1KCLA 2BP5M 2Y7QB 1MF2H 1DQKA 4UV4H 1PPIA 5SWZD 1HG2A 1PGRB 4I9XA 3U66A 1BBJB 4GBXB 3QH3A 2VR8A 5HHPB 3G2VA 4J3BA 3WHE1 3D06A 2IMNA 2R0WL 1CGTA 3IB4A 1V3JA 3T8MA 3RL1B 4ZMLA 1A66A 1FORH 1GGIH 3EH3B 3CHSA 4FQXC 1Z0NA 1X4ZA 2UY7B 4F15C 1YRKA 5FO7A 2XZCH 4WUKL 3F65A 3RK6A 2ZOKA 3GMMB 1ACCA 1ODAA 5IF0B 5A2BA 2W38A 4KKCC 2YBRB 5LBSH 2MTPA 3ZDZF 4H5SB 4F37F 4E41B 1DVFD 3LJNA 3VDAA 2EXWD 3QFGA 4RRPG 4K9EH 4K3EL 1R75A 4PV9A 5IY5B 2JJTA 2GROB 1O5PA 2HWZH 4GZ5A 5DJ2B 4TUMA 1RZIB 2FO4A 1S7UB 2C0MA 4I3SH 4YBQC 3TVMA 3WIFA 4OQ1A 3HRZC 5DMGD 2CBPA 5EBLA 4AQAA 5F1IA 1SW6A 2V3DA 2PM7A 3O0RH 4BQ8A 3DJTA 1O5MA 1F3RB 4NWTH 2JEKA 2YKLL 1TNMA 5JO5A 1ACYH 2B39A 2PTUA 2WLIA 1EJFA 2EDEA 3QJUB 4PJCA 1GGIL 4PJAF 4WEUD 2I9TA 2VQ1A 1W6WA 2A2QT 3FT9A 4HXAL 4P23C 3SDAD 1DJXA 4ZMAT 3VFNB 1T5WA 4MCYB 3HRAA 3QQ4A 43C9B 2HT3C 4PY7B 2PQNA 4KRPB 2QKIC 1HKLL 2WC7A 3WXVL 2RA1A 5LBSL 3ZUVB 4Y4FA 5D72H 1M6UA 1EK3A 3PJLA 1F8TL 2BCMA 3CSBA 5J6HB 2QBWA 5D1ZA 4NZUL 3TLRA 4TUUA 2UV3A 1TVDA 4FHJA 3OJ2C 3DTXA 3HMXA 3PJSA 3PYCA 4KKQA 4O5LH 2BFVH 1XH2A 2Z7WA 1NBZA 1X5JA 2BSRA 1CO1A 1FFPA 5FV2A 2Y4UA 1OO2A 4DETA 2EXYC 3BISA 4XZ4A 2KT6A 4P5TD 4LOUD 5DJCB 3C2SA 1UWEL 3UM0A 3MEKA 1A25A 4FC8A 2KBXA 5DJ6B 1RIHH 5I66A 5IB1B 3OXGA 3PDOA 4DW2L 4NUJB 1CZ8H 4MDRA 1F6AB 2M2DA 3SKJL 3MNZA 2PNDA 4PRAA 4XZUB 4A6YA 4AY5A 1WZ1L 4APXB 3TO4C 3D9KA 1X7QA 2VGXA 3M1OA 4CMHB 1JG9A 2I60L 5IJKC 2OCCE 1BFVL 5DD5L 3SOTA 2H9GA 4P5MB 4E5XG 1QW9A 2ZGGA 4AYEC 3BPNC 4CSZA 3SGEI 1DUYA 5CZKA 1PIGA 2DF3A 3VD4A 1KBKA 3UABA 2I6HA 3LH8A 3SF4A 2X6KA 4H2CA 3ECBA 3QQ9D 4CT4A 1VFBA 4MDIA 2WTOA 3IIEA 1K3ZD 1HXMB 5DZAA 3RAJL 1KIPB 3WJLC 4NQTA 1ED3B 4P2AA 5EF3A 3JT0A 4L3EA 4BE5A 1O1TA 1NPNA 2ETBA 2UXVA 2VLRE 2W5PA 3BIAX 4MJHA 4TQEL 1YVLA 2EH8H 1XF2A 3NN7A 2JCCA 3DIFB 4X0NA 2H7WA 5FXNA 2CHXA 4HZ1A 1C5BL 4BETA 2AF2A 4DPRA 4R5XA 2W94A 4G7VL 4FD0A 4MAUH 1TNBA 1JGUH 2FR4A 1YYCA 4LOFA 3TO4D 3GSUA 3AG3B 3FU7A 4JLRA 1WYJA 4F7EA 5ACZA 5C3IA 5D7JB 3AZUA 2QPSA 1EZSA 3A14A 2X70A 1TLIA 3VXUB 2DD8L 5D7HA 1KV7A 5IUSA 1HU8A 4G7RB 3BHBA 4B52A 4LG6A 1M56B 3OKNB 4G1TA 3T3MB 1XCTB 1U8JB 2V5SA 4I5BB 3ZQ9A 5HHQB 3TASA 1Z9SB 1FDLL 2A99A 4I88A 3CK0L 4G8FA 4UQ2A 5C07A 4YHKH 4WAFA 1Z66A 2K3TA 4X4YA 3M86A 4OV5A 2ENSA 3Q6FA 4W1TA 2NW3B 3DK2A 2HFFB 3TEXA 3SGDI 4WWKB 3X3FL 3AVEA 1TU2B 4FQ1H 3BZEA 3SY2A 4BH7A 1HWHB 5F7EL 2JJSA 2WBJA 3DO0A 5D2LA 1ZLEA 2XQYA 3N44F 2FDBP 4C4UA 4OB5L 1RKRA 3PWVB 1ZY9A 1CDHA 2E6PA 4IMLA 1TIUA 4PRNB 4U63A 5I6PA 4P4KD 2ZKYA 1SY6H 3X14A 3CLEH 3PDDA 4WHTB 2Q3AA 4RMQA 3D0AA 3EJTA 4K7PH 3TFKC 4BH7B 5I6LA 3QJFA 5DRXA 2OTUA 4XI5C 5D7JD 4HRLA 1OGPA 2L0IA 4ZUVB 2FQDA 4PHZA 4XBEH 3BSZH 5D71H 3J5QB 1IAOB 1IGCH 4N3AA 1KEMH 2EKSA 1SN0A 2DV6A 2R69L 2XKSA 3G08A 3QQ9C 4HEME 1FL3A 2XYCA 4E9LA 1QLEH 3BAJA 1U8OA 1URZA 2JF1A 1YMMD 3VGHA 4AG4L 4LFHD 5D2NC 1A6VH 4JFZL 1I7RB 2NY7L 4X6CF 2NYYD 4U6YA 4X6DE 4J3UA 4KI5D 2VSDA 1ILUA 4K3JH 5MHSD 1JGVL 4GRWF 4KUCD 4M62L 1G43A 1KTBA 4QOKE 5H2BA 1F90L 3WCYA 4WFFE 4XB7A 4MJIB 5C0BB 2WVUA 4UM8A 1RZ8B 1H19A 3D18B 3QNYA 4FNUA 3VM7A 3WMQA 1IBYA 3LTVA 1OGAE 5DEZA 5IW3A 5AENA 4H8WH 4TM9A 4PRHD 5CFHA 3EH4B 4XHJC 4R4ND 1EZVX 1NCHA 4PY8I 1S64A 3CK7A 3F58L 4YHPA 4M48H 4XMKH 3H9SA 5LJYH 1NEUA 3MRQB 3Q2WA 4M00A 4O2CB 3O9WA 2HMIC 4Z76B 2L6BA 1FV1A 4ZOAA 3MRLA 2GJJA 4HJ0D 1HXYB 1G1OA 4KKLC 4MZRA 3WL9A 1NBVL 3REVB 3SNXA 5D70L 4JPVH 4HZLB 1NH6A 4JKNA 3R8QA 4GEJA 1MFAH 4PBDA 4AXWB 4G72B 4N26A 3QXVA 5CJXC 4OOFA 1K8KG 4LLMA 4CGVA 3UTPE 3BZFB 1EJ8A 4A2DA 3LZFH 4L05A 4YPGB 5D1ZC 4LSPL 4DZ8A 4B9CA 4POZD 5EUOA 1UN8A 2CDGA 3H9HB 3L81A 4W4OA 1RIVL 3RNKB 4KK6C 4BSVB 4FX5A 1OE3A 1I9EA 2HRLA 5DMGC 2MMXA 3LX9A 2AXUA 1DJSA 4WI6A 3QRLA 5FYKD 1U4EA 3IDGB 3IM1A 3FYIB 4L0YA 2H4EA 2NY4D 1MCRA 1HFAA 3L1OH 2YK1H 1MJ8H 1N4PA 5AVXB 4NQVB 3RZCD 3DSXA 1XZ0B 2DJUA 3FTSA 5AW9B 3O3DA 4HJ0C 3HC0A 3SE9H 1BVKB 2F7IA 2DQUL 3U9PH 3S8WA 2Y5TA 3HI1B 1U91B 5GRZA 4YX2L 3TNMA 4YHML 4AW4A 1ETZA 1XF5B 5FM5O 5FEBA 2ZXGA 3ALPA 5HI4D 3LZNA 2D7QA 1THCA 5AAPA 1CXHA 1FC2D 4XNXH 2K8QA 5INCB 2ZSVB 3UBXB 3NCFB 3MRNA 1FJWA 3C75A 2X4QA 1ELKA 1D9KC 4XPFL 2IOSA 2NNAB 2CPUA 4BCXA 3QQ4B 4JDVA 1XIWB 4I4WB 1MNNA 2XV3A 1NFDF 1HZ4A 4ZQTA 3CIAA 4M5YH 4PJFB 4NZJA 4FTVA 5IT2L 3SDDC 4KV5F 5LCVL 1ZHNA 1OTTC 3K6FA 2XY2A 3ZHZA 4TUJA 3VXUE 4WI7A 1FYTE 5FDWB 1OCWH 4HIEA 3QB7C 1KF9B 4G3YH 4MAYD 1PCXA 3RWGB 3TC9A 5CEZE 3D7PA 2ICEA 4ODSL 4Z3FA 3UPRB 4ODBD 4MZNE 2AW6A 2MKLC 2B15A 3EFOA 4AMKL 1LO5B 3HBZA 1FJ1A 2QC9A 4MAYC 3JV6A 1NKGA 5CP7B 3S35H 2QMKA 3SHFA 3NQKA 3L9BA 3KCWA 1SVXA 3L6AA 1B0IA 4ZODA 4JKKA 5IHUH 3DSTA 1FFOA 5DEFA 3HPLA 5FSSA 2CQVA 2XZCL 1FAIL 3H2WA 2PYFB 5KNHD 1N3NA 4R96A 4PRIE 5ABZA 2VWEE 4GIPD 2HLAB 3RLSA 3QEUA 5T1KD 5AQ9A 2A77H 2WPGA 2Y06H 1U93A 3C8DA 1AMYA 4KVPA 4JPWL 4M6OH 1N4XH 3AT0A 4NQXA 5KVEL 1T7WA 1TJGL 3N0AA 4AOFA 2BNRD 2Y9RT 3ZPJA 1TLKA 3WJJC 43CAB 2HG0A 4RFNB 2F08A 4DOHE 2NY0D 1Z9GE 1DQQB 2VLMD 4APFA 4P9HH 5CBOA 4XGZB 3ZZLA 1KGXA 3ZE1E 5LDSA 2IOMA 2J4WL 5FYKU 3NEXA 3U48A 2HZHA 4PJCF 4YVOA 4MBOA 2DH3A 4S1DC 1I4FB 1F4YL 3HI5L 4NPYA 4N0FA 5EORH 1ZT1A 2K6YA 4C9BB 4N28A 5J6GB 1IFHL 2NSZA 3K7UA 3L82A 4OZIB 3D4GA 4H1LG 3JWNH 1JZ6A 5DVPA 2EZ0C 3FFCE 1PD0A 1FRGH 3SFXA 4N5CA 3BSGA 3WAJA 3REVA 3ARDC 3K80A 4U0ZA 1MVUB 5FO2A 2OVBA 1HKLH 2WP3O 3F7PC 3OXRB 3UGXA 1UXSA 5FZRA 4XMPL 5EFIB 4WUUB 1NC2D 4N9GA 2PP8A 4HUNB 4NZUH 1WDAA 3FC8A 1X5IA 2CK2A 3Q43A 4ZOCA 4RWYL 1JYXA 4N3TA 1TR4A 3MNWB 3BKYL 4U7SA 4X6EB 3KS2A 2C9SA 2Z4QA 3HRPA 4O5LL 1FA4A 1M7UA 4H44C 2VQXA 3MKRA 4NLHA 4FAAB 1I1AB 4FXLA 3SDYH 1GAFL 2R4RL 2YRBA 3G9VA 2J6EA 4GUOA 1AS8A 2OSLB 5F7BA 1KWGA 2XN9E 4R7LA 2OL3A 5F6IC 4QRTB 4HU8A 4Q9QL 1LD8A 3CE1A 1CZ8L 2IALB 1XF3B 4Y16A 4X2UA 1HZHL 1QWHA 1ZDPE 4P23B 3LDZA 1RZQA 2ZUQC 4PBVC 3D5OF 4CRWA 3RA7H 4ZG1A 1HSAB 1E3XA 1VPOH 3QG7H 4NQCA 4ZX4A 4Y4HC 3GSNA 3QDGD 5DGQA 1OAXL 3T04D 4YOKA 5I8EB 2AJ3B 2OSYA 4HUVA 5GZOA 1U8OB 4LHUB 4UMSA 1IBFA 4IBVA 2ZWKA 4U1KA 4F7PA 1ZB1A 3U4KA 2AEIT 1I53A 3HPJB 2ZF9A 4HJTA 5F21B 3IF1A 4QWWC 2WN2A 3D4CA 3T0ED 4OZGA 3T4YB 1RUAH 1VGKA 3QNFA 1TEFA 3T0WA 4JDZA 4XIFA 1W72B 3R19A 7CGTA 3F83A 4JANA 4P3CH 3WNJA 5AD0B 3Q48A 4HC1A 3MRKB 5I24A 2GJ6A 5DVNA 3FU6A 4XBEL 3C6SA 3S35X 2D8KA 1JGUL 3SO3C 3DOIA 5IBLC 5ICZB 2WWKT 2B14A 4JO2L 4NQCD 5IROC 4DFHA 1XBDA 4QHUA 1E9PA 1OAYL 3M1BB 2RD0A 1LNAE 5KSBF 2EDYA 1H6FA 2DMBA 1ZXKA 3OB8A 1AG6A 1KTCA 3FAWA 2L7EA 1AGEA 2WJ7A 4PJDA 1MQSA 4N5EC 3MV7E 3QEUB 4HQDA 3MV7D 1X9UA 4YQXL 2OL3L 2I5YL 3SBWC 1OTTD 3LSOA 4M6NH 3RO3A 2H6PB 4YDLB 1N8OE 5DC0A 3IN0A 2XG4A 1TJMA 4IMKA 4UBDD 4O2FB 5HGDB 4YDKH 1NIEA 1RHHB 3FFCD 4PJGF 5E6ZA 2VR6A 3LN4A 4PTUB 4UNVA 3QZOA 1KJMA 3FB7A 3QJTB 1FGVH 3KL0A 2ZUTA 2HM8A 4Q96A 1EJOH 3NFPB 5B1KA 1J0IA 4KK9C 1V54E 3U46B 2CFUA 1A7RH 3BP4A 1XGTB 1MW2A 3FSAA 4XR8C 5E9DA 3PV6B 5H94B 5T3ZL 4XI0A 4DLOA 5AVYB 2AV1A 2D2CC 2F1EA 3QQXA 3IJHA 4M1DH 2KXPC 4MQ7B 4O58L 5MP6L 2WBKA 2Q7FA 2GG1A 3SDCB 4A7GA 2J49A 3VSUA 3SE8H 3V6ZA 3RWDA 2O5ZH 4X4XA 3P4LA 5DD6A 1JJUA 1P1ZA 5EIIG 2UZPA 2XEEA 5IG7A 5JW5A 1EQWA 4QAWA 3T0EC 5KUKA 1NIBA 2VQUA 3IJYA 3DOHA 1NEZA 3MXVH 1H3PH 4WWKC 3EO1A 1JWUA 5KW9L 3KAAA 1BFSA 1MDTA 2XWTB 3ARBB 4M62H 4D2NA 4UB0H 3MTRA 4FQPA 5E23A 3HW7A 2A74A 5HDLA 3MRPA 4PJ8B 3LD8B 1S3KH 1C5BH 4TNVF 2JI2A 1HCFX 3MCXA 5D4QA 3ILEA 1KXQE 2GC7C 2WYZA 5DQDL 4P2RB 2CO7B 1I7ZB 3FQRB 3L48A 3S98A 2WCGA 3QXDB 3U6RA 2DWEB 1WD8A 1AIZA 1DL7L 1U93B 1XCWA 4HEPG 5DUMH 2OKMA 4GKZA 4BZYA 2C3VA 3PL6C 5ESAA 4YSSA 2CO1A 3WDIA 4JRXA 3VGAC 2OMZB 3Q5TA 3NK3A 3SCMD 3WE6B 3ZGHA 3UUXA 2E86A 4ZUWB 5HHOE 4JZOB 1H5BA 3MDJA 4YVQC 2E0PA 2FATL 5DLLA 1LO4L 4WW2C 4M93B 1BYOA 1H3PL 3K8KA 4MJ5B 2Q20A 1ADQH 3CVQA 3L9YA 3TWQA 2WZPA 1MFVA 1IC5L 3Q1SH 5AWNH 2J4BA 2B16A 2VISA 3MLUL 5DJXA 1KJVA 4MNQD 5KSUB 1AD9A 1NA8A 4YSAA 3JUYA 1BD8A 3OKLB 3CZGA 4HAKA 2DTML 4FTVE 4U0RC 2FLMA 2R1WB 3R8BB 1G9MH 4KQ4H 2ZX5A 3G5VB 4UINL 3VX0A 4OCRH 5EIVA 1QFPA 3IMVA 5EX3A 3TZVD 1F2XK 4IULA 2Y7NA 5KVDL 4P5RA 5AFAA 1AS6A 4H1LH 3IK2A 5KSVA 1KIQB 3CFJA 4QHLA 2PPDA 1JK8B 5FYJE 2ZUYA 3GC3A 4G3YL 5DJYB 1NFDE 3KPMA 3O9WB 2VTFA 3KSQA 5FQ7A 1NGYB 3B8YA 3EYOA 3RHWK 4MXVF 4YHZL 1ML0A 5AOKA 3KDMB 4PWEA 4NQEA 2VC2L 4XN5A 1V27A 2GTZB 5GS1C 4MA8H 3HZKB 3MTXA 4GNKB 3L6FB 3VI3A 3B2PA 1DHKA 3QUKB 1PKQB 1A7QH 1TQUA 1K1AA 1EDYA 1MLCB 5AZUA 2YPVL 1UZ8A 2NMSA 2V0PA 2CLVA 2F8VA 2X1PA 4XNUH 4WWID 4G43A 3O6MH 3H2PA 5EO1A 1CI3M 2DW5A 4LCIL 2Q10A 1S9WB 2Y1YA 5CJBA 5FFLA 5D7IA 3EDJA 5KVDH 2WIMA 2MQCA 1T1WA 5TD4A 3T8KA 2K4AA 1IHGA 3UTZA 2ED8A 2ZKHH 3WV0A 4KKZA 3MHZA 3R9MA 2EABA 4X5PA 3ZIYA 3BLBA 5C1DA 5ICUA 2JK5B 2DEWX 1FL3B 2OMNA 1OVZA 3F84A 3L4YA 4YNDA 3RY4A 5LDUA 1Z1WA 1F3DJ 4OCXH 3CPLB 3GJFK 5G5DA 3IJSA 2WHZA 4U07A 5CMYA 1IJNA 2YLHA 3CMOH 1KEGL 4OVUA 1L7TL 2WVSA 3DSNA 3KH4A 5AOJA 1UB5B 3MROA 2GTWA 3VRLE 1LEIB 1I7TB 1KJ2H 3DRTB 1HI6A 5GRJH 1PG7W 2P5PA 4GSUA 3MBXL 4PJCE 4G26A 1YEFH 2BVUA 2F7RA 3KYKL 3DETC 4GZDA 2TSAA 1E96B 3BC9A 2F37A 4BH8B 2DBAA 1NEZB 4F15B 4A2GA 3WI9A 2X44D 4FHKA 2XVGA 1GZHA 1GKEA 5AG9A 4KXZI 1K2DA 4GG6B 3MRMB 4MTWE 1NQBA 3U46A 1SVZA 4N90E 3BN3B 4W81A 3AMLA 4ETQB 5ENWA 3LY9A 1D3CA 2V5MA 4DP7X 2BFGA 5E5LA 1ZA6A 2A77L 2X6HA 1VDYA 4E6HA 3C5XA 4M7CA 5CZVL 3VE0B 4XVTL 3SN6N 2RCSL 4FFYL 2VW4A 4PWKA 4HLJA 3FTYA 4KKNA 5T1KA 4RSVA 4XVUC 2R1YB 4U6VH 1KY6A 2I85A 1HT6A 2ZUQB 4LVNC 2R27A 3KH3A 1L7TH 2CU9A 4GS7B 5DD1H 5C0AE 4BFGA 4OBSA 5FXCH 3SE9L 3SGEH 1MG3C 4G1MA 4F3FB 4CC1A 1UHVA 2IWFA 5JDSB 1WPCA 3Q9QA 4YBLB 1Z6JT 5EU3B 4A6YH 2AQRA 1CL7H 1RK0B 3CFIC 1H15A 3HHSA 5IQMA 1MWAL 2JKIS 3LNGA 4QHKJ 4YFEA 2CGZA 1P7QA 2O5YH 2XIDA 4NC2B 5L8KB 1X3DA 3IPEA 4K73A 4PJHE 4YVUA 3OKEA 3C3RA 5T1MB 3GSRB 2BVYA 4MDJA 4C8XA 3B9EA 3RNKA 3S88L 1UQSB 3MLSL 1JWMA 1QG3A 3NSYA 4UV4L 4H4NA 4DAGL 1MWAA 3QDJB 4I0CC 2LAAA 4P4KA 3WEXA 1KLXA 2B1HL 4X6CB 4KX9A 5DRXB 4QIRA 3B6SA 3QUYB 4JO1H 4FQCH 4L8DA 3TT3L 2WVIA 3ZHNA 1VACA 3PJNA 2XWDA 1N70A 2F58L 4MA3A 5EEYA 5IM7B 1C7TA 4KBQA 3VXTA 2DYPA 4FQXB 5AVRB 3VXSB 4BWTA 1FORL 1ORSA 3CVHA 3O2DL 4MCZB 2R4RH 4G8EB 3HFML 1N9PA 3VA6A 4DZBB 1N4QA 3P02A 1IBHA 1WFNA 1IE4A 5BUGA 5B39G 3BW9B 1BD2E 2IH9A 3HMXL 4KROC 4NT6A 4LCUB 4CMHC 2O5YL 2V8SE 1G7QA 2B9AA 4FFWC 3ZSSA 2CIIA 3VDCA 4IU3B 2GRQB 4JC8A 4MS6A 4MQSB 1KTJA 3X13B 2DMGA 3CFMA 3E30A 1PS3A 2FVNA 2XTSA 5IMMA 4M3KB 5KJ4A 2OULB 2KZBA 4UM8B 4Y19D 1QA9B 3ULVF 4GKOA 3TWUA 3DKHA 5CILH 5AVTB 3MRIA 4OGAD 3RAJH 2V2TB 3O6LL 5AB2A 5DWPA 4KI5E 5F1OB 2QSCH 1DZBA 2IPKA 4ZBJA 1MLBB 3GXTA 1KXQA 2CUAA 4ELMA 2OMUB 4IOSA 4B9PA 4ETYA 5F7HA 1SDDB 4JRYE 3PS6A 1NWOA 2J21A 4X6BB 2V5YA 4C47A 5EC1A 3IXAB 4U3XA 4OVVA 3GHEH 5I15L 3B7BA 4MAUL 5EFIA 3TN0A 1OGTB 2A6KB 2LAGB 4QRRB 3GSQA 4TNFA 2W07A 3D3VB 1WD9A 3MPCA 4HG4J 3H3BC 4GUPB 5HHOA 4C4BA 3UM3A 2NDGA 3ALWA 1BOGA 5C0NC 1FO0A 2A6IA 2VL5A 2C9RA 1EAQA 4PP1C 4UT6H 1U8IA 4AM9A 1GIGH 3LPGA 2A9BA 1IU1A 5CZXD 4DX5D 3RWFB 4YHKL 2QL1A 1Y3GE 2NXYD 2VDOH 4YL9A 4ZTPL 4PRBB 5F0PB 1I4FA 4DGVH 2CJSA 2R29H 4MD0A 3CN3A 4RVBA 1KEIA 3T4AC 3QDMB 1P84J 1MH5A 3FQTB 1MRDL 3HXDA 1PG7H 3P77A 3MV2B 4JHBA 1SLUA 4LARH 1KTKE 4NQDB 2CR6A 2OX5B 3G3LA 2P5ED 5BO1L 3IDMB 3Q5MA 1SYSB 4KXDA 4OLVH 3O2WL 4D8OA 1MFEH 3VSVA 3GPSA 6TMNE 5M72A 2C1OB 2FWUA 4W9JC 3IDIB 2NSMA 3HG1A 4YSEA 5IQNA 2UWEA 5EPMA 3RWHB 2XQBL 2W0KA 4TNEA 4YDMA 4Y6CA 4NO3A 2BHFA 3NCEB 2GYSA 2D9CA 2GK0A 3VFMB 2AVPA 5FF6A 3WE6A 1INDH 1H3WM 3RX7A 2BIPA 2KZTA 1LM8V 1XHHA 4TQ8A 1JWSB 2BSBA 3C8HA 3QUGA 2H6UA 2CR3A 4XP4L 5G4MA 3VG0H 4AQ1A 1MYOA 4YFLF 2ZX9A 1Q9LA 1NOFA 2R29L 3NK4A 3DXMG 3QORC 2O5ZL 5DRZA 3G5ZA 5DT1L 4KX8A 3I74A 4TLNA 1BLNA 4XXWA 4Z7VB 3QWRD 3I5PA 5C9JB 4Y9GA 1JGVH 2QV4A 2F53E 5FR3A 5F72S 3WJJA 5JW4N 4J5VA 3DXAE 1EVUA 2NXPA 3ZIMA 3MUUA 4W9DC 5E56A 3IAGC 1ZIAA 3FCSA 3DURA 4XMVA 2HR2A 4LDEB 4GPMA 4BFFA 3HZVB 2I24N 3QRBA 4JMNA 4AQAB 5HDQH 4I2XB 1IM3B 4GA1A 3C5ZC 2I7SA 3MX0A 3B34A 4R5TA 4MD4A 4LBEB 4QHMB 1RVFL 4H8QA 5GRUH 3VB8A 2HMID 2H9GB 1PQZA 4ILHB 3EOBB 1ANUA 2NXYC 1CLYL 4B5EA 1EHLL 1U95B 2CO2A 3QUHA 1WAO1 3OB0K 5HI5D 2X4PA 2VLJA 4P06A 2XVKA 4XRCA 2BKKB 4XMUA 3FCGA 3N21A 3HVNA 5FKAB 3UPCA 1J1XH 1QSVA 3IJSB 3LN4B 1CDGA 1Z5YD 2VAJA 5D1ZD 4JQXC 3NACH 1ERNA 1AS7A 2J56A 1HHHB 2JK5A 3DTDA 1SLWA 1YSOA 4FXKC 5E94B 3IFPB 1Q94A 1SOSA 3K5RA 4UZSA 2AJZB 4LCIH 1BEXA 2W0FA 1A7NL 1J7VR 3ZVVA 2NYYC 1YYHA 2RQEA 5KBKA 1IBZA 1YJDH 3DX3A 2PCFB 4GXUM 4P2RA 1WIPA 2JV7A 2XZQL 5I6KA 5A7BA 3RVXD 4JHKA 2G2PA 3T3PF 5JBIA 2QPEB 1NEPA 3VJ6B 4GIOA 1AO7E 3P3RA 2AW2A 4OGZA 1QWUA 1VFMA 2IVFC 4KDTA 2RACA 3GZPA 2X05A 2DM7A 1U3CA 2P9LG 4HJUA 3NABL 4FG6C 1E5AA 2QVIA 2VGLM 2FEZA 1E4XL 5E9AA 1YO4A 4DEWA 15C8H 3DROB 1XGQA 1HXYA 4E5XB 2YEZB 3EO0B 3ERXA 3NACL 4CU6A 1NUGA 3H6JA 3VWJA 2FIRT 5T1LB 4MB1A 3BP5A 1A3LL 3W9FA 3T71A 5C2BL 2PR4H 2VM3A 4YHIA 3RIAF 1J0ZA 2VDNH 4U33A 2MSPA 4NZRL 1CWVA 3OJMB 4LCWA 4C58B 1W80A 1YJDL 3GO1H 3O6ML 2JD0A 2VDLB 4X7EC 1JCQA 3BJLA 4ZPTB 5HHOB 2K9UA 2A83B 4TXRA 3QZWA 5DZOA 3T0EA 3SBQA 1WAPA 2YNQA 4QO1A 2FJSA 4OKVA 4JGNA 4UWHA 2WBJC 4L8SA 5DJXB 2GAZA 1WP6A 3GJEB 3V5HA 3N50A 1HNYA 3MJWA 5C0CD 4PLKD 2AXFB 2VT0A 4RQQB 3E37A 3OPUA 1N52A 2ADGA 4U1LB 4G6MH 4ZFOL 2G4ZA 2M1KA 3U0TB 3EG9A 5D2LF 4AM0Q 3BVVA 4OI8A 2QADD 4NHUB 5JXAH 4MRUA 3NQYB 4YXHL 3EHMA 3QH3B 3EOAB 1EHKB 4IEFA 3UTTD 5D96C 5E03A 3MUJA 3T8CA 4CVWA 4LBAA 2VJ0A 3T8DA 3OQRA 3QQ3A 2IAMA 3JXJA 1M2OA 1QYGL 4K3DH 2AANA 1CD8A 1BZ9B 3RIBA 4HXIA 1T7XA 3DSVA 1I7UA 1SRDA 3CUPA 4U1NB 4H2AA 3IJ9A 2WLLA 5E0QA 1S5HB 3HC4L 5IMOA 3UH8A 3VFGH 4ATGA 1QKZL 4OZHF 5FS5A 4F58H 1EDHA 2YC1A 2GJ6B 2D3JA 2H47C 5ESQB 5AW3B 2AQQA 3D30A 4XO8A 4FADA 5AZ2L 5AOMA 4D9LL 2IWKA 2BEDA 3GYZA 2PP9A 4N8VB 2HFFA 1JERA 5G04C 1NCTA 3H85A 5FO9A 4C59B 1QSEB 3RGBA 1QUNB 1QFWM 2J8UF 4KXAA 4U1KB 5EORL 3VO0A 2NNXA 1YUHB 4PJEB 4DKFH 2GCYB 3U0WH 5KTEL 2IO3C 4TV3A 5E6IC 4IS6A 4BA0A 4EO5A 3MJ6A 1YA5A 3MRBB 4R4BB 1QRKA 2OFQA 4GT7A 1TJHL 4ODWA 2VABB 4XXDA 4HRMB 1R3KB 2J20A 5EEXA 3ROOB 2YPLD 5FOBB 2VDRH 4PJ5B 4ELMF 3P3SA 4PJBE 1M53A 1GA2A 5K69A 4K3EH 2WJ5A 2VXQL 1XGPB 1V55E 1FLRH 5DWUL 3ARSA 3CX2A 1JHKH 3SCMC 4BFNA 3OVUB 1O9WA 3FSOA 3M1CA 1RZGA 5FGCE 2P1YA 5FUCC 4NBZB 4XPGL 2CGYA 3PEVB 4GTMA 1FE8H 4FQIL 4JO1L 2EC9T 4AMKH 2FSEB 4GA2A 2ICWJ 2YXWA 2GABA 2YOCA 3FB0A 3DUUA 3V0FA 1V5JA 1KT2B 1JZGA 4U3SB 1THAA 4L8BB 4ILGA 1H5BC 3BIBX 5KUMA 4L5FL 2JQMA 3GYRA 5KTEH 3BAKA 2ATPB 2C9VA 3GRGA 3AMKA 4HXBH 3BH8A 4G8IA 4ZAKC 1N5YH 4AQOA 1ECYA 1XGQB 1OOWA 3ABZA 3AREC 3AWGA 3EJCA 2YPKA 4HUXB 5H8DA 1AI1L 2WZAA 5FCUH 3RDTC 2VGXB 1T04B 3EJSA 4U1JB 4MTMA 2BVQB 2QHLA 2PO6D 5DGRA 1NSNL 2BY0A 4KOCA 4PLJD 1F11B 3SBTB 2UUDH 4FTVB 2G0KA 2FLRT 1DBBH 1UVQB 3FFOA 1P7KB 3V0VA 1V7ML 2VLKE 4DQOH 1SBSL 4LPVA 5CZXC 1JTTA 2UWEF 5HHOD 4GMSL 4IRZL 4R6UA 4GZ6A 2LTQB 3KLLA 2RCSH 2HTLD 1MRCL 2MNUA 1E2ZA 1FVEB 4XAWL 5F3HB 3CFQA 2FO1A 1AE6H 2H2PC 4AM0B 3DSWA 3E8VA 1DJGA 3GZSA 3IFOB 2A38A 2K45A 3QE5A 3NN8A 2VR4A 4IKJA 1GW6A 1Q72L 2R0ZL 3BWAA 3ENEA 3EIMA 1ZV2A 2CAKA 3LVTA 3SCMA 2W0PA 4H57A 2G3MA 5C09A 2RFXB 5FUZL 3VYOA 3K9IA 4ZNCD 3LEXB 3ZT6A 4P23A 1AMXA 5IB2A 4G8AC 1WV7T 3V2AR 1PKQE 4W9LC 5ID0B 1MCIA 2ESVE 2VXVH 5FCUL 3S3JA 2FNWA 4HQQL 3TN0D 1N9AA 4F6RD 4YSQA 2AXVA 2Y1FA 3FQNA 3E33A 1MJ7L 1VADA 4HK0A 3IPBA 2FBNA 1XTMA 2Y69E 4PPTA 2AGJH 2Y69B 4ZI8A 2F7OA 3L5HA 4QRUB 1CDBA 2HWZL 3HG1D 1AP2A 1PQZB 3EOBA 5E6IA 4DQOL 4IOIB 3N43F 4X6EA 1YNLL 4ISVB 3S3BB 1KOAA 3ASWA 3OKDB 4OTXL 2DLEA 3MA5A 1RUPH 5F6HJ 4XRCB 1ACXA 4BX9A 3DUSA 5F1NB 5HVHC 5TH2A 5FECB 3SE3C 5HI5C 4HIEB 1BAGA 2C7UA 2N7SA 1UTDA 4O02A 4X6DB 5TDNA 2V4HC 4ES8A 2P24B 1F4WH 2OR8A 4WU7B 3GI9L 2EE3A 3HFMH 4NKMB 4UOW1 4D0CB 1VKXA 1BM7A 2DL2A 3QHTC 5INDB 3DX6B 5MERB 1JGLH 4I4WA 1GGTA 4J6IA 5I6MA 2NCEA 3O3AB 1HQRB 2E4TA 3SPHA 2OV8A 3MLXL 4OBRA 3KBEA 1N2RA 3UBXA 2APFA 4RA3A 3L54A 1XB6A 4GI9A 1MFNA 5I75B 4L18A 2DEYX 3JVGC 5E75A 1ORQB 1IAIM 2D0GA 3KBFA 3PUCA 3TJHD 1O6VA 4UU9B 5E7BA 3UIZA 4WNFA 4I6JA 4TS6A 1X5YA 5B1CA 3BUPA 4NERA 1N54A 2QSCL 1SYVA 1KJOA 3GK8H 1KXTB 3BVWA 2Z8SA 3QT2A 2QJ1A 3V5DA 4TKWA 4U7EB 4FRWA 2LXMA 2H6FA 2DWDB 3GEWB 3GIVA 4JRWA 2EVJA 4KI5C 5D9SA 3CBJB 2XBZA 4FLQA 2GJZA 2N0MA 4LHQB 4DW2H 1KPUB 1B0GB 3DOSB 3QG6A 2GK0B 4Q89A 3UBHA 3D9AH 1A3QA 2DQTL 4IBSA 4JO2H 3RJOA 1C7SA 3HB3C 4YE4L 4BCYA 1L9PA 4HH9B 5CZRA 4NO5B 1F3JB 5CHNB 5DJ8B 3D9IA 1BMZA 4XNMB 2QADC 5EO9B 3QQDA 3ZYLA 4G1EA 2H6IA 2OJZL 3EJJX 2C1PB 3NABH 3ZHFA 4L4TA 5FOJA 3LY6A 3MZGB 4H8UA 3JV0A 5IUCA 4JUSA 1KLGB 3V0WL 3MRFB 4BKLA 4N1EA 4WI3A 4AYFA 3PEUB 2BIQA 4Z7NE 2VGYA 2W91A 4JVPA 4TL5A 5I1CH 4TMNE 1NGXA 5B8CA 3LVEA 5L2KD 3CVDA 2OYKA 3AU1B 1S78C 5KN5B 5B8CC 2BNUB 2XIIA 4TF4A 5ITFA 1TTAA 3MO1A 3K71B 3FTWA 1AHWB 2X9WA 1VEOA 4L8BA 5HGHB 3OKYA 4BQ9A 5KS9B 5L0QC 4L9LA 2NW3A 3WDHA 2A3TA 1DVSA 1VCBC 2PCXA 1BMGA 4OLUH 2JD1A 4GYYA 5DD0L 1DCEA 2DQTH 4FMFA 5CN3A 4NAQA 5IR1B 1S7XB 4GUPA 4RBPH 2FECL 4PIRF 3IAQA 4W93A 1GVIA 4XVSH 2JQZA 1GGYA 4YSDA 5EU5B 1HQ4A 3AJ7A 3GXNA 4PRIA 5L4FA 3QUZD 5AW0B 2W8CA 4PS4H 4U6HB 2UXGA 5EZJA 1X5MA 1L5JA 2NUTB 2TRHA 3IXEA 2CBTA 4NXSA 9CGTA 2UZXB 1EBAA 1KS7A 5BXOA 4C54A 3CKBA 5KSBE 2NYKA 4JFTA 1IGTB 3GZQA 4M5ZL 4YR6B 3IKKA 4QRRD 4R4BA 4JFDA 2P5WA 3MU3A 4HOXA 3VWKD 3VI4E 1MQKL 2VDQB 3Q3GB 4HOZA 1ZV5A 2GCYA 4X5RA 2XEHA 2XWTA 3ARBA 4TVPL 4A38A 1HX0A 2YHCA 5FYJL 2E8YA 2TMNE 2YUWA 3ABGA 2ESVA 3RTQC 4URTB 4H0LC 2FL5B 3SHSA 2Y25A 2P26A 2E7BA 1RIVH 3V4PH 4JO8A 5CMWA 2D31B 5DJZA 2OYPA 1KLFB 4LSVL 2ZPKL 1SJHB 1QBLH 2LVCA 3GMNB 5FT9A 1UM4H 4PCSA 1S7VB 3GRWA 3ZXSA 4PRID 5B39A 2KI6A 2OXGB 3D85A 5EIIA 5A40E 1B0WA 3TCXA 4HIPA 3U9UA 4LLYB 2DJSA 2GT9B 4HBDA 1QHOA 2P2CP 4AJVA 4MQTB 5A16A 4FOMA 1OZTG 5F0JB 2WSDA 1T6VN 3MBWB 4TOYL 5B38B 4ZFGH 4F91B 4Q14A 1HESA 3QAZB 2W9EL 1R19A 4MJIE 1UOKA 2ZWNA 1S7WB 4OIIH 1QFUL 3AGWA 5F71A 1N6QH 1JUFB 3QJSB 5B21A 3BAEL 4Z7UA 4E0RB 3VWKB 5L2JA 1ZK9A 3SSBA 5FA4A 1X81A 3RX8A 4JO3L 3Q7FA 2B08A 4PV1C 3PP3K 3R7RA 4ZX6A 2VN4A 3HS9A 3N44B 4EBQL 4JZJC 1OCZB 1WCBA 3MV11 5HY9A 2CUMA 5CGYC 4G42A 2ZPKH 1QR1B 1X5LA 4JPQA 4PWJA 4TLTA 1J5HA 2DN7A 4IBWA 4F53A 1AOZA 5IB4B 2Z9TA 4BSZB 3FMGH 3RGHA 2FSDA 3BEWA 4LCWE 4WCYL 3NCBB 4CBZA 3NG5A 4FFYH 3K91A 3BWUC 4AZUA 3K4DA 3NQIA 1EA9C 2WQ8A 3NPSC 1E9PB 2VC2H 5EYPF 2FEJA 1J87A 2J8UA 1Z3GL 1ZVHA 5FIOA 1Y0LA 3ZKMC 3T3PE 4MMYB 1UD3A 5BZWA 4AWJC 2WI0A 3E0GA 3L9RA 4JPVL 4GP4B 4ZYKA 3UTMA 1MVUA 1PNDA 1HH6A 1RZ7H 2N7BA 4HCFA 4JO3H 2RALA 4NRXB 1FPPA 1E9QA 2BP3A 4P4RB 3BLPX 5E8EB 2HKHL 3U7WL 1EH9A 4Z7AA 3NF1A 2ARJQ 3QJHB 4FERA 5I6NA 5FYKE 1QO3A 1Z2KA 3GMRA 2LU3A 5DJ2A 4P2QA 1PMYA 3EYSL 3JWDC 3DETD 5DK2A 4E9RA 5JW4R 4MA7L 3ZTJG 4F57L 2G2NA 1JAEA 2P8MA 1SA5A 1AG0A 5KVEH 2DQMA 2VMDA 3FN0L 2F54B 4BZ1A 2E2EA 3S4SB 5C0FB 1TXKA 3H8NA 3IKCB 2PXYA 3T9KA 3MRHB 4RAVB 3IHYA 5IHBA 2G2RA 2VIRA 3BPCA 4HUMB 2NW2B 1DVFA 4PMFA 5BOPA 1CC3A 1EV2E 2I32A 4NRYA 1DN0A 4F8NA 1CFMA 2IH1A 2CG3A 1FCCA 4HT1L 4NKOB 4RIRA 1LMKA 4ADIA 3G7TA 3V5DB 1QW8A 5A6LA 5DSCB 1PKQA 4GQQA 3F04A 5GGUA 1AYRA 1CFVL 1QACA 1TMQA 1GYUA 5DXWA 3V4VB 3BKJL 1IEBB 3U4BH 3FXIC 4R2GD 3WKNA 1ZLWH 3UZEC 3ABKE 4F7CA 4ORGB 1U41A 2JKTM 3T2NH 1NCCL 4LVEA 4AR8A 2NY4C 2WZ6A 2GUOB 4HV8B 2ARJA 1KR6A 1HQRA 1DLFL 2GIXA 5G4OA 1SN5A 2J7LA 2AXZA 1WFOA 2JELL 3KNBA 4GG8A 5HHXL 5HPMA 3SKOB 1GSMA 4YEFA 3V0EA 4NEHB 5JO5B 4AV4A 5EBWB 3V6FB 5ITBL 2HPOA 4MJ2A 1HXMA 2WNXA 4EXPX 3BRGC 1TKWA 5EBLB 3PZDA 3BKCL 3SQBB 3MJ8A 4FQ2H 2BW4A 2IADA 3P7PE 1IBGL 4Q58C 2E7MA 5JVIE 2AI0L 1JPLA 4I0PD 1C9SA 4PJBB 2WB7A 3NSXA 2W9DH 3EZJB 1OGAD 4HGKC 5EO9A 2C3HA 4I18B 2EINE 3RRNB 4U1GB 1A3RH 3I6SA 1T2XA 3I02A 4LNVA 3ULEG 4JW3A 2LU7A 4N2IA 5I18L 4AGPA 1F4XL 1M2VB 1F6AA 4FC3E 4HUKB 4MBRA 1JZ4A 2IIJA 4JDEA 2F8XK 2ALWA 3T6WA 4MCMA 5LCWJ 1WBXB 2P3YA 3AXIA 5IQOA 4RDQG 3SDCC 3L08A 3ZT7A 3WSQL 3LJ3A 3D0VB 3TAXA 4JFEA 1D7BA 4QOKB 2OAAA 1JHKL 1FFPB 3MYJB 3SYAA 2XS1A 5F7DA 5ACLA 3L17A 1NZRA 3FEXA 4D3CH 1G4MA 2OA9A 3LQZA 4NCC1 3FCTB 2FJGA 2J4WH 4AJ0A 4GRLD 4GFXA 1RUAL 4LCCB 1FLTX 1IBGH 3ARGC 3HG0D 4NBXB 4HSCX 5IV2A 3FQYA 4M4PA 1HH9A 3MRJA 3ARTA 3BKML 3L3OC 3QXDA 1U8MB 4ZNEA 2W9DL 1SHWA 2DBJA 1THLA 1OANA 4ZD3H 1EWHA 4UCFA 2Z65C 3LD8C 1QUPA 3EDFA 3S8GB 4WQOA 3DO1A 5MERA 3KR3L 4MJJA 1A14L 1IIIA 5IG7B 1XB3A 1A6TB 4X50A 4AJYV 1OAYH 4UQZA 3P40A 3CFCL 3ARZA 1BAFH 2V9QA 1LP9B 3SDDB 1KG0A 3AS8A 4X4KA 5B7MA 2R83A 3IJHB 2YGPA 2RR3A 2CNYA 3R0IA 4PJXB 1FV1B 2LLLA 3DGGB 4NQED 2OL3H 1P1ZB 4WDIA 1FH2A 4MD5A 1HXKA 3ZZSA 2TRYA 5JIQA 4OGXH 1LO0H 3OSVA 1WUNT 3W39A 2KQNA 1HWWA 3GUFA 1KFGA 5FHAL 4BEIA 4ZT1A 1JWSA 4O6FA 5DZVA 3ZDYE 2OPCA 5C0EA 2EQXA 5E0FA 4HISA 2B2XL 3WGUB 4Z7WB 1K3IA 2XPGA 4FZ8L 1UENA 2WBWB 3ZL4L 3EZ8A 2XN9A 1Q72H 2ICCA 2A73A 2WUCL 1GXWA 3CV5A 4N2MA 4UTAL 4NO3B 2YRZA 2WP3T 2Y24A 2BY1A 2DYRB 2XWEA 1KMGA 1BSIA 2BRQA 1X3ZA 1LD9A 2VUKA 5FUZH 2W9LA 3QUXB 4OZFB 1Y18B 4M1DL 2IH1B 4MS8C 2X10A 3RVVD 2Y1LE 3CFCH 1ID5I 1BAFL 2F68X 1AR1C 3B7SA 4XP6H 4CUCA 2XS8A 4LT7A 1LXMA 5K9KA 4Y16D 4F8PA 3OKMA 4X7CC 4AQ1C 4LGPB 4TNVK 3KLAA 1U3HD 4OZ4A 5EOQH 5ES4B 3B2UC 2PPCA 2D2OA 5LAXA 4UQ3B 5C0FA 1AACA 4F5CA 1H6PA 1NUDA 3FQTA 4YDIL 3TIEB 1G6RH 4WKXA 3LKOB 4HYTB 2TAAA 5AB1A 4HUWB 1TTFA 2JV6A 3LIZH 1EPFA 5FYJH 3TURA 1XH1A 3PHOB 4PJGB 3F6LA 5BNXD 3VYNA 3ULSA 5IJCC 4K3HA 4ZDHB 2FWOA 3HUJE 1PD1A 4GW4B 2HSIA 4FXKB 4GI8A 1CF8L 3ATEA 2GBAA 2IDSA 3LKPA 1FAKT 3JWOH 3K2MC 1JWGA 3PF2A 1EGJH 4HKZA 1RJZA 3VXRA 4N9OB 3GI9H 4M7ZC 4LLYA 3U6XA 1CGXA 1UKQA 4PRNA 2GRLA 1DQJB 1P6AB 3R4RA 3TMNE 1JGLL 3VXPA 1PE7A 1CVSC 3QYCA 3ZI6A 2R70A 3V95A 3GMQA 1OAQH 4UUJB 2DICA 3EYFA 3WHXB 5ISZE 1KLFA 1MFBH 4NHCL 5D1QC 1BF8A 3OB0H 1R24B 3VXOB 4OJFL 4X4YB 5KSAA 3GSRA 3ABMB 3WKPA 2APXA 2QKSA 1JPEA 2FATH 2W07B 3D3VA 4OGAC 1F4AA 1BREA 5IOPB 4JM4H 3PY9A 5BS0B 1A7OH 4K3JL 4J8FA 5IW1A 3HHRB 2EYTB 1AJ7L 1OARL 1AHWC 2ZF8A 3B9DA 2WZGA 1GY2A 3H7BB 3OL2A 1LVEA 5FK9B 3GSUB 2QZAA 4NP9A 4D94A 1G9ML 1RSFA 4KQ4L 3UAEA 3E2HC 2ZUVA 4ODTH 4WTZG 2JNZA 5EF0A 1IC7H 1M1XA 1TCRA 4B9KC 4N2EA 3HJ0A 1T4KB 5C0CB 1TMCB 4ZFFB 2X28A 2Y2TA 1GJWA 1N0LB 1KYOJ 3QR1A 4JG5A 2R17C 5E9DE 3TT1H 1XF2B 7FABL 4J8YA 3P4MA 3VD5A 4CVZA 2MCG1 1KGUA 3I3BA 5A16B 3LRHA 5EWIH 4GTQA 1JVKA 2PP7A 2FD6L 2BNQA 2OTUB 3FU5A 4HI8A 1K9TA 5I8KL 1YMPA 5H7PA 4HJGA 4DUIA 4MCZA 3WIIH 3VWJB 1Z5LB 3HG3A 4JG9A 3DJSA 3TIEA 1KG0B 3QQDB 1JNHA 3QORD 1HWGB 4XNUL 1YEKH 2Z93A 3V6OE 1OP3H 3CXHJ 1R5WB 1Q9OA 3P9MA 4MA7H 4F57H 1RPQA 5E6YA 3VG9B 3ZKMD 1FH5H 4X6CA 2PO6A 4D10C 1XCQA 3H4HA 4TRPH 4WUUD 5F88A 3DIDA 3DYPA 2OMYA 5GGTH 4FXGB 1NCBL 2PYED 4BSXA 5DMIL 5JQ6L 3EGDB 3PXHA 4KK8C 3AREA 3WLWC 3P0YL 3UDWC 5FQ4A 1TENA 3WTXA 4I13B 3KPQA 3BP6B 3CMOL 3QO1A 1S9YA 1E5ZA 2NY5C 3QIBB 3MYJA 1A1MB 2IU1A 3QDME 5IREA 1I3RA 2WLHA 1ZPUA 5IMLA 3U6XS 2G4EA 3UG3A 2H32A 3HE7B 4XHJD 3LXAA 5C2BH 2P80D 3QPXH 4G9DA 3W39B 3TBYB 4PJIF 3ZQXA 4Z78B 1HVXA 4NC1C 3NIFF 3QWRA 4Q7DA 1VHPA 2JCCB 1V54B 3DIFA 3ARFC 2B61A 1NANH 3LKNA 3TCLB 1VSCA 4PJ5E 1Q1JL 2JWYA 2UYLB 2BNRB 3MLYL 3N6YA 2LLNA 4KDVA 4X0KA 5ADPL 1HEZA 2FUQA 4ZQGA 5HHNA 1GYVA 1EEZB 1NCBH 5BZXA 2BSEA 5CBEA 6PCYA 4NDMB 4XC3H 1H2UA 2IADB 1RP3A 3FN0H 1H8NA 3D0LB 4P5KA 5T1LA 2NOYA 3ROLA 2FB4H 2GBUA 4Y2DD 2WZ0A 1KJ2A 3TVMB 1KBWA 1QSEE 1BGXH 1ID2A 1N6UA 5MENB 4R0LC 3H42L 2FX8L 4ZFGL 1P4UA 4LSQL 4CC4C 1D5BA 5IV2B 4N0CC 1QR4A 4N25A 5JORB 2VERN 1X9RA 1F6FB 3ECQA 3SGJA 2VISB 1BLNB 1W91A 3SGDH 4F8QA 1P4LA 4F7CB 2CO4A 3DTUB 4UIMB 5IVOA 3UJIH 1MAMH 2AMGA 4M7LL 4L8CB 1JDCA 2YD3A 2UWEE 2L8AA 3PAZA 1NSNH 1HH9B 4B9FA 2DWDA 2O4EA 3IEAA 3G9AB 3HTLX 3EUDA 2ITDB 4RESB 5BVPL 1NFAA 4CC0A 5TDOA 4ELKB 5GGSY 3FVPA 5EILA 4WUYA 1JPTL 2BSTA 3BKYH 3LQZB 4JNXA 2N1TE 1JPGB 3QFJE 1ETJA 3ZHYA 1SOQA 3MFFB 3FMGL 1HHJA 2MPVA 4NIYE 5LXGL 3A3YB 4Z3HA 4NM4H 5EZPA 3JT1A 1UFGA 2GJRA 4GT0A 5IFJA 2D7NA 4LLVB 1G1CA 2KL6A 4N2KA 3LZRA 3HG0A 4L23A 3ZE2E 4YH6A 4R3SB 1FT2A 2VNCA 5FV1L 2YAPA 3ZX1A 3HVEB 1MCWM 2UVEA 1UJ3B 1F11A 4HVBA 2AXGA 4JY4B 1PEWA 4B9IA 4NFBA 3BIKB 4JM0A 2A7OA 4QT5A 1O0VA 5JOPE 5IQLA 4LZKA 3CKCA 2GVYA 4JQXA 4QHMA 3EGXB 1QEWA 4WFHD 3RZCB 1IQDA 3F05A 3JQOB 2CM6A 3TEYA 4BRJA 3KJ4C 4Z3IA 1KZOA 2V7HB 4R84A 5D2NB 1B88A 4DKAA 1O1SA 1CG9A 4H8HA 1YEGH 1E4WH 4R8WH 3FRUA 3T09A 4DEPC 4TXQA 2ETAA 1HE7A 2XZTG 4MMXC 1CURA 5CILL 4ECNA 4GW5B 4XMLH 3IDXH 2HLFD 1X3WA 5CKGA 4RRPA 1LO0L 4BT8A 4UYPA 1UACH 4XVTH 5AVWB 3B83A 4M65A 5BRZA 4ZMZA 3UZVB 4I7ZC 3QIWD 5EEWA 3EXLA 3VVWA 4PTUA 4UWLA 3HE7D 2AEWA 1XEUA 5E1QA 4X9BA 1TLMA 4BDVB 3QIUA 1OTUC 2XG4B 3MRGB 3RDTB 5A2CA 1SXNA 1S6NA 3LMJL 3GB7A 3N42F 3BH9A 1A1MA 1EEYB 4ZD3L 1BFVH 1J0KA 4XN4A 1H6KA 1AD0B 4I3RH 3HC3H 3BP6A 4RLYA 2XTJC 4XP6L 3T5VA 1SJVA 2PYEB 1FJUA 1Q0LA 1U2VG 1VFAA 3K5SA 1QQEA 1B4TA 1XSJA 2YD0A 2IF4A 5FGBC 2J12B 5H2BB 2FX9L 1MOEA 1GC1C 1N19A 3GZ2A 4RZCA 3T2NL 4UQBA 3VDBA 2R9HD 4WWOA 2L7JA 3FT2B 3G2TA 4N5QA 5C0GA 4Y2OA 3SBSA 1IVTA 3RURA 3VFVB 4YDZA 3DEOA 5FYJU 5L9DH 4XN7A 3GD1C 4NJAH 1CE6A 1ZT7B 5BUZA 4HPOH 4K4KA 3UX4A 4PGBB 2W1NA 4QXUH 3DO7B 5LXVA 1FFTB 1YECL 4P46D 2PTTB 2XICA 1ZE3H 3C6SB 4E85A 2DPKA 4RAHA 3FKUS 3IDJB 4DK6A 1V3LA 1Z5LA 4NUQA 5AD0A 1NGQL 1VFUA 4JM2B 1DC2A 3MUGA 1OTSD 4KDWA 3VXSD 1OS0A 1ZS2A 2OW7A 3KPNB 3L3OB 4I0PC 1E8YA 4L4VB 3FYEB 4XI5D 1CT8A 3U64A 5AJLA 1MFDH 3B2DC 5EF2A 1GGCH 1OTSC 1JUQA 1FFNB 1YMMB 2AK4A 3V6ZB 2UZYA 4XEIG 5JC1A 1OAUH 1UA7A 5BZDB 4Y2DC 1PLBA 4RLDA 4OD2B 3BUQA 2ROXA 1XF4A 4EE2A 2A6KA 4QJ4B 4JKLA 3N0PB 1N0LA 3VFRA 3FQXA 5HHMB 1KGIA 1ZLUH 3A4FA 4DGYH 5AG8A 4HWBL 3LSOB 2HT4D 1EFXA 1W3BA 2H0EA 2HXAA 3O41B 4DN4L 4Y6PA 2X7LA 1T1ZB 5KVDE 1JP5A 3LRMA 5DS1A 4XP9H 5KSBA 3VTYA 5EEZA 1KIUB 4GTPA 4AKQA 3ARFA 4XPBH 5GGVY 2RJMA 1UWEH 4WWNA 5ALCL 2P44B 1TTUA 2HG5A 4ENEC 3OAZH 1BG9A 3CVPA 4JFOB 4XNZC 1FBIH 2XIBA 4PGCA 4BSWA 5G05J 3FUJA 4PLNC 4X5LA 3FV4A 4WU5B 2P8LA 4F2EA 5HDQL 5D66A 2WO2B 3D69B 4IHQA 3AS1A 5ICZA 2E7LA 3OGCA 1IMHC 1JZ8A 1UZ6F 1KB5L 4LLQB 4WHCA 5DMJB 4B97A 2O61B 3QDHA 2W65B 4PS4L 2GAZB 2F7PA 2XRZA 1GTNA 1E27A 4N2HA 1WBYA 3GIZH 2PWDA 3CFKB 3T3MF 3OXRA 4AEFA 3HZYB 4AG4H 1CF1A 2Q6WB 4JFZH 1PC2A 4Y5YB 2PO6C 4DPBX 4GO9A 3LOWA 4MRCA 5AUMB 3V6OC 1B2WL 1XXDC 4WWPA 5IBUG 4ZS6D 4D9WA 1M71A 2ENYA 2PW1A 2Y0BG 4TQIA 5EOTA 4XNAA 4B27A 4NN7B 5K9JH 3O3UN 2VZSA 4ZDHA 4HETA 1LO3H 4R3SA 1JYVA 4JHZA 3DVGA 4EN3D 1MCFA 4OCRL 1OSEA 4Y5VB 4L9PA 4UOQA 3ARDD 5FA3B 3U2JA 5D0OD 1ETB1 1H6TA 2UZXA 1X7QB 1MPAL 3L4VA 3EOTH 4FDWA 4TN9A 5GGTL 3U79A 4HWBA 4LLWA 4Y16B 5CSZB 5AOIA 1XZWA 3Q3GA 3C3OA 3N42B 3R9AB 3CFBB 2D9QB 2BRRL 1YEWA 1A7PH 1XT5A 3K4ZA 1M05B 4RWHA 3L3DA 4PWHA 2LE9A 4ODHL 1EEYA 3GIZL 4YGAB 5DJCA 2OCJA 3Q6GL 3RY5A 3LXUX 3NQPA 4JRYD 7FABH 4AY0A 1L9RA 4PGDB 4QJ5B 3I85A 1OAKL 3ILPB 5EOQL 3WLBA 1RULL 3ZN3A 4KZCA 3P7UE 5CUSH 2B0SH 1Y07A 3WS6A 1AGBA 2IBBA 4YDIH 5I8KH 3NOCD 1A3LH 1JF6A 2Y1DA 4EN3A 4PY8J 3VD0A 2EO1A 1XGWA 3UZQA 1HAWA 4PRDA 5I16A 1MVFA 4NQEB 4OR1A 4P2OD 5TMNE 4OCYH 2IWGA 3T2OA 3NDZE 1DBML 2EC9U 3QNZA 2BH0A 4Q6IC 1P7HL 4LEEA 3TNNB 3MRFA 4H25B 3I3NA 5ETUA 2CHWA 1YEHL 3GKWH 3B5TA 2P24A 3ZKXB 1OLZA 4TNLA 3KGSA 5FB8A 2R2BB 4HF5H 4AGQA 4FEMA 2L7UA 4DUWA 5MENA 2YBGA 5JDJA 4Z7NF 3G5VA 1S4IA 3DRTA 2Q2EB 3OXSA 4L37A 4YL4A 3EBIA 3D25A 4G6ML 4UWFA 2PNNA 1KJ2L 1QNZH 4ISVA 4XCEA 5CERB 5I2IA 1L6ZA 4KFZC 3F64A 2E7LC 2VR5A 4X83A 3SDAB 1A3ZA 4KRNA 3QWOA 4LASL 2F5AL 5DD3L 3UPAA 3ULUL 4GRLB 5KEZA 2ZCZA 5G55A 1JS4A 4KYOB 3MBEA 3TZVA 1M42A 2DJMA 4R2GC 3UJIL 5C0DB 1QQDA 2C5DC 3HDXA 2W95A 3PWUB 3GMMA 4GU5A 5EIDA 1OARH 5HNHA 1T66C 3D87B 3WY1A 1JRHI 1EXGA 2FRGP 4OF3A 4BINA 1IGMH 5EC2A 2XN1A 3TCTA 3FORA 3WTWA 2FEEL 4ZUSB 1U3HC 2C1OA 3DHJA 2A6DA 1M57B 3KPSD 1YN7B 4Y16C 1SF5A 2MCPL 1MCOL 2CJTA 1HCYA 2IAMD 5D5MA 3ZW3A 5ISZA 1ZSDB 2EDKA 3ARVA 5B1AE 3OLIA 5DA4A 3ZKNC 3IE4A 1OGAB 5DHYB 3BPOC 4JREB 2AV7B 3WFDL 1QFUH 3LY7A 1GS7A 2X4TA 2OMYB 3ZDXB 1L3NA 3ARBD 4KHXH 1F1GA 2ORBL 1ZLVH 4NM8L 5E99H 3ZE1B 2PR4L 2UY6A 1RH8A 2NY1B 1QTYT 2NUPB 1S78D 2O6PA 2IDQA 3STLA 8FABA 1YEDB 2G9HB 5EG6C 4FJ6A 2LHAA 1OE2A 3ME0A 1E7VA 2R4SH 4GBXD 5IHLB 4FGMA 3KWVA 1AP2B 2Z64C 3MGOA 5I26A 1B3JA 1MAML 4M7LH 1N18A 1QRNE 2JCCF 3OR6B 5DJDA 2FJHA 3KPOB 3MCKA 4MYWB 5C0CA 5DQ9B 1YY9C 4YHPB 4AYMC 5SWQA 1UWGH 1OK0A 3BQUC 3REWB 4TSBH 4IOIA 5JJTA 4HPYL 3V10A 3FDHA 5I71B 3FUDA 2DWYA 1SC5A 3RWIA 3O2DH 3GSQB 3U25A 4QUOA 4ZUWA 2IAAC 1W8OA 3EDKA 5E1HB 1JMXA 4KO6A 4IOFC 1NBQA 1ETZB 1XF5A 2ORBH 1A0QH 1E6JL 4X7SL 3RG1C 2G3XA 3X13A 3ZTNL 5KSAB 3CDZA 4K5PA 4A6YL 3MLTA 3MV7B 4PG2A 5FA3A 3VTAA 4X4MA 3N41F 4GBXC 4K94L 4S1QH 1D5MB 3TH4T 1ZRUA 3MRIB 4JG0H 1IILE 1I1YA 2EINB 4M5YL 4ZMOA 5CIPB 1Y7VA 1TPXB 4DKTA 2DQJH 3WKML 5BT1A 1FHGA 4G5AA 4QXUL 5TLNA 4R97C 3RIKA 3DO3A 3VXTB 1UWGL 5I0WA 4GTVA 2OI9B 1D6EA 3DX1A 5CEYA 3WJMB 2IH3B 1XAKA 3FOLA 1UATA 3P9LB 4HK3J 1TZHB 4ZUVA 4D3CL 3BI9X 1F13A 3FF7A 1DQMH 2OXGA 3H3KA 3NJHA 3KEAA 4AVXA 4P5SA 5DC4B 2B6CA 5DVOA 5C08A 3AG3E 3QDJA 2SEBB 2ISDA 5IB5A 4NSKB 3S35L 1OCCB 1QF2A 3BU8A 3G5YA 1A6PA 1E6JH 1GGCL 3RAUA 2B20A 2IH3A 3EDEA 3FOLB 4RGNC 5DK3A 2C9UA 1BJ1J 2XTJE 4E9SA 4ONHA 1RZJC 1K4CB 3H2QA 4R7NB 1INQA 1T89A 1WBYB 1NDMA 1BZ9A 4XC1H 1G87A 5HGBB 3BG1B 1N5AB 4JPWH 4M6OL 1X9QA 2DQJL 3WKMH 4CBPA 1MJ0A 5I8CB 3ABLB 5BVPH 4AEHH 3OGCB 1JZIA 4ACLA 1P2CA 3DSUA 3FWVA 3QWNA 1X6NA 4DT2A 3QNXB 5I19H 4G11A 1F6LL 5FINA 4L4VD 1KENL 2FX7H 4MSWB 2YAFA 5HGGS 1Z5SC 2X4SA 4AV0A 1FBIL 2Y6SD 2EADA 5MEQA 1TQCB 4UTBH 2X40A 2IONA 3JWDH 5FHAH 3SQOL 5ACZB 1A5FH 5IMKB 4I1RA 5GRVL 1E3FA 3CZJA 3APCA 1IFHH 2YO3A 3BP7A 2XGOA 1A3RL 1Y1UA 4JFXB 4MLPA 3ZNGA 1TQTA 2CK0L 3MRBA 2X9YA 1PNCA 5D6CB 6FABL 3QA3A 3LNIA 4ZO9A 3QRFM 1TZAA 4IK6A 3F7VB 4B7IA 4B8AA 4H0IA 4XP5L 3PAVA 2AVGA 3VXSA 4NGHL 1CLVA 1NCNA 3D85B 5IM7A 4BKSC 4P46C 4JB9H 2YGNA 3ZYQA 1E2VA 1UKTA 2G9HA 4UDUB 4UT9A 2NR6A 2FECI 4A3TA 2Z34A 1OWMA 1NUFA 4HWBH 5EU6A 1DUYB 5BOZG 2B1AL 3ZKQD 1IKOP 2FX7L 2YD2A 4YZFE 5C0BE 1ZIBA 1ZT1B 2ESVB 3Q05A 3AITA 2YPLE 4MFHA 5J8OA 1XGUA 3JWDL 4UT6A 4HUUB 4ICXA 1OWOA 3LCAA 1U4FA 4PRAB 4A6YB 4Z0BL 1EO8H 2Y22A 4CDMA 3DRQA 3KWWB 1FFQA 3QFDA 1KGJA 1G5GA 2WQAA 1T0MA 3CR3A 2DRUA 5F89B 4C55A 2GRRB 2X6UA 3O48A 2HX7A 3IAPA 3NTCL 3H55A 4MHHI 3LH2H 3J2PA 4Z7UF 4Z18A 1SXCA 3IT8D 4I3RL 1PIFA 5JIHA 1L5GB 1LD9B 4MNQA 1GGUA 1OF0A 3SFYA 4OKVB 5IKCA 3Q79A 2O6FA 3FU9A 2Z91A 5EU5A 3AAAC 1MQ8A 3C5ZB 4LNBA 3DIVA 5KJKA 2AK1L 4A2HA 3ABLE 5E8PA 1QI4A 1U8NA 4PJ7E 3WS3A 1DQTA 3CHMA 3FK3A 4NJAL 4U05A 4CN4A 3BDXA 3A06A 3KBHE 1Q0XL 2NNFA 2EEFA 3UTQA 5CKAA 2ZSWB 3QO0A 3BP5B 4JKWA 3SDXA 3ULVE 1LNBE 3LB6C 3UG4A 2NYJA 1TKWB 4ZW6A 3QC5X 1U8HA 2XZQH 1E9OB 3QR0A 2CKBA 3JWNG 4K7PL 2EVIA 2W81C 1OY3B 1C16B 4LAQL 1NLDL 4YHNA 1QI5A 4TSAL 4PJBA 3IGFA 4EUPH 4FL4C 1NCWH 1RUQL 5E1GA 3SDXB 3MJ7A 1RVFH 5GRUL 3ZE0E 3Q9UC 4YEEA 4N66E 1NCJA 2MOGA 4PJFA 3TBVB 3HZVA 2UX7A 4FLHA 1JK8A 3ES6B 2EYSB 3OQ3B 4BERA 1J05B 1SMDA 5C8JA 3ISWA 2OMXA 2WAHA 4A67A 4ORGA 2EDJA 5EULV 1IT9L 4XX1G 3GRWL 3IU4H 3MRJB 4DN4H 1H9DA 4YQXH 3GEFA 1J5OL 4BKTC 4EEEA 2I9LB 1XR9A 2OTWB 2E5EA 3UCRA 2XWCA 4OSUL 4XP9L 1W16A 5GGVL 2ZNXA 3FO9A 4NZRH 5JQHC 5IK3A 1ZMYA 3UAJC 5LG6A 1MCLA 3C09B 2QZQA 2WLNA 3HZ3A 4ATTA 4U1SA 1KCVH 3I6LE 1A6ZB 1EGJL 1FH5L 4PJ7B 2OW6A 1A22B 3Q44A 3E1F1 1WT5A 3QIWA 3UC0H 1PZDA 3VXMA 2IGLA 4YE4H 4AM0A 3CSFA 2AJUH 3B95A 1OXYA 3MQIA 1DN0B 5CR8A 1G7IA 2X3AA 5JPNA 2GI7A 1SG7A 3TXMA 3V0WH 2GY7B 5FKAA 1I8IA 4DO6A 4YXHH 4OCMC 1RZPA 5I1LA 3L3KA 4GLRH 4XWOC 1RUML 4ZXBC 5E8NB 3V79K 3PWPA 2Q86A 3JYSA 2ILRA 1T1XA 2EEXA 2ZUSA 4JM4L 3S37X 2PGGA 2ICEC 5TF1H 5KAQG 1I31A 3TBSB 5BZWB 3WDJA 2KQMA 2DIWA 4HEPA 4NNPH 3DO2A 1A1OA 3L3HB 3MX0B 3WNLA 2IOOA 4ODTL 3ILQC 3SKOA 1AZCA 2C3GA 3SYQA 1Z9NA 3OZKA 5DBKA 2FTAA 4AC2A 1UC6A 2X4QB 4HV8A 5ADPH 2CLZB 1RZJH 1UOVA 5F3BA 5J56B 4XVSL 4LLQA 4NNYB 3DX7B 4TOYH 1AOHA 2YWZA 4WCYH 4I87A 4C83A 4ALAL 2EYRA 4PRHB 2HUHA 1LK2B 2C3XA 1X5XA 2DQDL 1FF5A 3WG7B 2OMZA 3QNXA 3GSXA 3K6DA 2WLKA 3NJFA 4LCVA 5DHMC 2PUSA 3T0EE 1D5IL 1BBJA 2DQUH 1A2YA 1WGOA 3V4LA 4IGBA 3U0WL 4KNTA 2OMWA 4K9JA 4R0LB 2GHZA 3LN5A 1QSFE 1FL6B 4J3WA 1AGCA 5CUSL 4WJKB 3RJQB 2BVOA 2BUGA 4B94A 1NOAA 2OZ4L 2ZXBA 3NP3A 4QRPB 3P11H 4OCNC 4MVBD 3ZTCC 1RMFH 3MRPB 4IRUA 4GQ9H 4K03A 1G4RA 3N1GC 2C3WA 4B7LA 2DZNA 4YHYB 25C8L 2XEVA 4A03A 5HPOA 5FKPA 2YSSA 2EUXA 5KYXB 1X5FA 4PRBA 1JUFA 3KVQA 5IVXE 3CN0A 1RJLA 2PO6B 3HB3B 3FB6A 3LNHA 4JANB 4JQVA 3MV01 4KH9A 4PREA 4RZKA 2P8PB 2WXMA 2NXZB 4WI2A 1UA3A 4BUGA 3N9GH 2EZ0D 3RTLA 4EAEA 1DQDH 3X1BA 3ARBC 2FWLB 4AK2A 2GJ6E 1COBA 4HPYH 4N2SA 3U30C 4DP6X 4LCYB 1EHAA 4NZFA 4PJEF 1RY7B 3RWCB 3UTQB 2EIBA 2IO2C 3SGJC 1O9ZA 3QEGL 1KDIA 2PXYD 3MLTB 1WY6A 1RFDH 2ZXCA 1IM9D 3HVDA 1KXHA 4PJFE 1O9VA 2DLFH 3UTTA 5F9JB 2W92A 3C60D 4LHUA 3JCKC 3KXFB 1HYRC 4MQXC 1JGEB 2MOQA 1TUPA 4XCNB 3HRZB 3ZMEA 1YEGL 5KJMA 4HDIB 5D7LE 3A0OA 3B2MA 4PGCB 3M8OH 2LLGA 4DAGH 4UAOB 4WW2B 1DSWA 5ICXA 2ZCKL 5L3UE 3TV3L 3OG6B 2YPLB 4AITA 4UT9L 5F9JA 3N9GL 1CGVA 1GSKA 4PJDB 3UYRH 5KVFE 2KC7A 1W0VB 5I74B 4F8LA 1MCJA 4AX3A 1D5XA 3OZ9H 1FT1A 4OJEH 4P99A 3B4NA 3AG4E 3II2A 2VLME 3E3QE 5F7MC 3P4NA 4GXVH 2AI0H 1FJOA 1WRFA 4QHUB 5AL0A 2BZDA 4UZGA 3KPRB 2DWXA 2EDWA 1I1AA 5GZNA 4MNGB 4FL4B 4OIBA 1WC7A 3ZYJA 1ZAGA 3PH0C 4KHXL 2LNIA 2VXVL 1OB1A 3U7WH 5AYWD 3GI8L 2OSXA 3RTQB 1SM3H 3ULVL 2GI0A 2AABL 4Y89A 5F0MB 1ZT4B 5LP0A 3IYLW 5JHMA 1IVLA 4EUPG 2BFVL 3AROA 3AG4B 5BW7A 3TEUA 3C5SB 4GCNA 1XMEB 1U3ZA 3F7VA 2LFGA 1H2VC 4UI9C 1DBBL 2F8OA 2MNWA 3NUKA 5BUPA 3MNVA 4GW4A 5J6SA 3PE3A 2BOBB 5J12C 3CSYA 5J5EA 4RSYA 1P84K 1D5MA 3NA4A 5F7FA 3VGAB 2XYBA 2GC4C 4JQVC 2LW3A 1ONOA 2BF0X 3WLWD 2PCFA 4WTQA 2KPWA 4XAKD 1V3MA 1CFVH 4PRHE 1IKND 3C6EA 4TQHA 1HHKB 3UP1A 1B0GA 2N0KA 4LDOB 4K71B 2BSTB 1UXWB 1X5GA 3BH9B 1DN2A 3NZHL 4W9IC 3FU7B 4JLRB 1YLBB 1AZBA 1HAUA 1KGYE 4NQDE 1C08A 2A9CA 3MLSH 2OMWB 3SDDD 3PDGA 2Z31A 4S1SL 2EVFA 2HVJB 3MGBA 4UWKA 3O45A 4WY7L 2WO4A 1OW0A 4MCYA 2O72A 4IKKA 1NICA 2KBGA 3SDXE 1JZDC 2H1PL 1NZNA 2EH8L 2FZ3A 3F85A 3NCYS 1MHHB 3ECVA 3DVNA 3ZTEA 2QPUA 1YMME 3DX4A 4CW1B 1GMEA 3DECA 1W9XA 3GM8A 3NJXA 1AY1L 5T1LD 3W0WD 3O3BB 1WBZB 5JHAA 1PZAA 2VQTA 3RUGF 1AZUA 1KJ2B 3I9AA 4Z0BH 4UOW0 1MJUL 1ZKAA 2E74C 3IMSA 3N1QC 1ZJBA 4X42A 2B2XH 1NCWL 3ESPA 5C09D 2K9FB 4IIZA 3GHBL 4ERSL 5PAZA 4UTAH 3QGOA 1SEBB 2BS71 4V2BA 5F7WC 5I1DA 3NJLA 4ONOA 5C07E 2C7UB 1VAHA 1F4XH 5HP5A 4QHPA 5HJDA 2QQLH 2KMWA 4OFYA 1EZLA 4JZNB 3L3KB 4ZX3A 3Q8BA 4IHOB 4Z3EA 3EAKA 3SEPA 2OMBA 4O4YH 4NENA 4TPRH 4K0RA 4LIQH 3LPWA 4GINA 4WY7H 2UXFA 3VQMA 4F9PA 1L9TA 3L1FA 4LRNL 5JMRA 1MJJB 4BZ2A 4IRSB 1K8IB 2J07A 1I9IL 3T8HA 3JUIA 2CKBH 2VRAA 5DS2A 1HU3A 1YECH 5FO7B 1IUZA 1CIUA 4O1OA 4ZUSA 3EF4A 3PZ3A 2Q8BL 1AKJA 2VXQA 4PJAB 3ZDZE 1JPGA 5DUPL 3FZUC 1GMIA 3TO2A 4M29A 2MOWA 5DEGB 3KS0H 1H3LA 5D1ZB 4HJEA 3E9TA 3CFEA 4KJYA 3WEAA 2E7HA 1J0JA 1G6RA 2CALA 5MEPB 1DBKH 1EAPA 2NX5D 5EUOB 5IK3B 1TN6A 4QMEA 4BGLA 5BJTA 3FS9A 2DQEH 3ARGB 3MODH 2R72A 4GI6A 2VQ2A 2DWZA 3LDBC 1A7PL 2Q3ZA 3CDGA 1Z6TA 1EXUA 1CGWA 1RUQH 4HC1H 4NI6A 3HLAA 3CX5K 3RVUC 3SPIA 1FVEA 1NPUA 3KCPA 3N40F 3SJVA 1YA0A 2YQ2A 4WU7A 3L4ZA 3RKVA 3WKYA 1JNHB 2Q6WA 1IXVA 1VEMA 1MCBA 2B0SL 2CFZA 3MRLB 3QCUH 4ODXB 5LBVA 1C1EH 1RAMA 1ONPA 2PCPA 1CICC 1PSKH 5ALCH 3DUSB 5F1NA 4FQLL 3L4CA 4AI7A 1SXAA 3SZKC 4MJ5A 5HQ8A 1AO7B 3VM5A 1U8HB 3OF6A 3N71A 1JXKA 4M8RA 4Z95H 4J2XA 2A6JB 3PV6A 4R90L 1UM4L 1UJJA 5HHVL 3OKLA 1YEHH 3DI3B 1QP1A 2F54D 4Y4HD 2ADYA 3MODL 3W82A 4GP8B 5DUJA 3SY0A 3TT1L 1A4BA 4DO4A 1XEDA 5DYFA 5C0AD 2H32B 3HE7A 2J1XA 2CRZA 3EBAA 3VXQB 5CJ5A 1TJXA 1NKRA 1UXWA 4C56B 4WEEA 2W9EH 1F02I 5EWIL 2X53A 5B22A 1T1ZA 4X5XB 2Y4SA 15C8L 3FUKA 1CTMA 2EKJA 5AYTA 2XT1B 5FYJD 5KG9A 5C0BA 3M7FB 4TLIA 2HRHA 2UWEB 5EPMB 3AQYA 3B9KA 3TU6A 5BXFA 5GS3A 2Y7QA 4LLUB 2CIIB 4FZEL 4LSPH 1TN8A 2AK4B 1OCCE 1R24A 1SJEB 4NQDD 4EBQH 4HNAD 3H7LA 5CGMA 1GC1H 3PL6B 4QXWA 3TYFB 4XCEB 3NH7H 4EI5A 4Z95L 2R8SL 2WWKO 4NCDA 4G82A 3KWWA 3QFDB 4F80A 6TLIA 3UOAB 1BD2D 1UFUA 1ZA3B 5D7IF 1RHFA 2KCKA 3AAZA 4ZO8A 3ISYA 2AAVA 4KK5D 1U4GA 1HK6A 4TRPL 2R7EA 1UB6B 4IMLB 2XXCB 1CGSL 2O7GA 1J8RA 4LSVH 3G08B 1LWRA 1ONQA 4PH8A 4W9EC 1AXIB 3BGFC 4Y4FC 4S2SB 5E5UB 4ODHH 1DCLA 3TJEL 2Q1EA 1TQWA 5DMIH 3WL9B 4A39A 3R1GH 5KBLA 3WY4A 1ZTXL 2LUHA 2BTDA 5I9QC 3CFKA 5CXPA 2WSPA 1FO0B 2A6IB 1WTGT 2YSTA 4HZAA 4NP4L 4BQBA 3POHA 4F7TB 2P5EE 2WXFA 4X7FC 1HL4A 4OFQA 5HYJB 1SMOA 1BD2A 1WC7B 4CNIA 3BVDB 2QEJA 3VFTA 4G83A 1KGCD 5I17B 4DLQA 4DVBB 3GXUB 3IGUA 3N91A 4Y7MA 4AEEA 3D39B 1L9QA 4Z9KB 4BWWA 3KHQA 2AXJA 1JBJA 5C71A 2HKHH 4G42B 2Z7YA 5D1QB 5I30L 2BK8A 3KD4A 4MSWA 1G7HA 5GZND 4CVXB 3UKRG 2WQVA 4ELMB 4MB3A 1G0DA 4OOEA 2BVPB 1RP8A 3WFCH 2VSXE 4YDVB 3VFGL 4YNYB 1XR8B 4GIAA 1MIML 4F93B 4JRYA 2AJUL 3KPPB 4Z5RB 4LEBA 1KDJA 2WTRA 4O9HL 3SDAC 1OCRE 3O41A 1XF1A 3EU9A 5DURD 2J73A 2VMCA 3WQSB 5DK0A 2OLDA 2MPAH 3QJRB 2VDNB 1PY0A 4BUQA 2FR4B 2N4IA 3UL4A 2Z4QB 3BW9A 4NT6B 4ABNA 5C0RH 1K1BA 4J8QA 5BCAA 1YAZA 4I6GA 4NWUH 3RWCA 3VFSB 4DKFL 5F6IB 3RNQB 5EOCH 3Q49B 4LPTA 2V7HA 4PAZA 3MNVB 3IJ8A 4Y19E 2FBJL 3P2DA 4D8PA 3NOIA 3C08L 3II3A 5FUOH 5KYYB 3X1FA 2AABH 1ZVSB 4HIIB 4J4PA 3K72B 1OALA 5AVUB 5IW6B 2FQFA 4HLZH 1EUUA 5I1IL 1RFDL 3D50A 5EN5D 3QDJD 3OC5A 4KKLD 4UWQB 3OXFA 3F01A 2AMUA 2HT2D 3QUZB 4JFFB 1A5EA 4NZ8A 1NGZA 2DM3A 5I66B 1TVBA 4I9CA 3GSNB 3CIQA 1NFIA 1LEKA 3DROA 4P9HL 2X5PA 2HT3D 1A02N 5CZVH 3MV7A 2NXZC 4NPKA 3JUZA 1EAJA 1FFRA 4FG0A 5JPNB 5A7DB 1HSBA 4K5LA 1M6OB 1T0NB 2BXZA 2FJFB 5IQ9B 4QRPA 3DMMB 4RGND 2XTLA 4X6FA 3UTZB 4NQCE 3CBKB 4KZEL 4WLCA 5JLZB 4Y0GA 5CD3B 3ASDA 5EOCL 3NZHH 5L2KB 4G1MB 4F7EB 4FI7A 2CHNA 3LPFA 3RPBA 3C08H 3MVSA 5DPFE 4NZDA 4PLJC 1WBXA 1LK2A 2Q5BA 2Z8VC 1HE8A 1OUVA 3TL5A 3VFNA 1BP3B 2D4FA 4ZMXA 4J39A 4GQ9L 1AHWA 1Q94B 1L0QA 3PNTB 1Q1JH 4QRBA 1TZGL 2KCVA 3CHRA 2BWIA 3HOGA 1NAML 4A2LA 3CQPA 5C08E 1KB5A 3UGUA 2CLZA 2ZTBA 3PHAA 4POZC 1S63A 1H3UA 4KMTL 2YD1A 4OFYD 4WI9A 1NGXB 5B8CB 1UW4B 4ZMNA 3T08A 2EDRA 4LIQE 4XH2A 1EZUA 1FYHB 1OCRB 2VZOA 5KWYC 1Q9KA 1M3IA 4HSQA 4BCZA 2ICEB 3TT3H 1MELA 4GG6A 1T80A 4LAJH 4L9DA 5LNDA 1B0RA 2B8OT 2ZXQA 1JDDA 3DV6A 4OFPA 2YD4A 4PI2A 5M94B 4BM7A 3E6HB 3OBAA 1QBQA 4Q9QH 1U8PA 2PYEE 4WNQA 3W9GA 4OFKA 3F12A 4PV8B 4ZRGA 4FNTA 5KBNC 4Q6YA 4HPHA 4K23H 3TYFA 4EI5B 1QFHA 4N90D 2BERA 1ND0B 5JMOC 1O7SA 3HZMB 1SOKA 4ABVA 4HBCL 3FZUD 4WEBL 2DAVA 1AAJA 1HEHC 1LNEE 5JOFB 3F6JA 5I23A 4RMRA 1B9KA 2AGJL 1HX8A 1CN4A 1GZQB 2E0IA 3A6CL 3FL7A 1E7UA 2V5RA 3QS2A