2XPZA

Structure of native yeast lta4 hydrolase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
632
structure length
627
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords LEUKOTRIENE A-4 HYDROLASE
publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 205
structure length 627
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpzA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpzA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpzA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpzA01
1Z5HA 4Q4IA 4FKEA 5K7TA 3B7TA 1KJPA 4XNBA 5JS3E 4H57A 7TLIA 4K5PA 4ZX3A 4KX9A 1QF2A 5DPEE 3TMNE 1KL6A 4K90A 3KEDA 4KXCA 3FGDA 4E36A 1FJTA 3B34A 4B52A 2XQ0A 5DLHA 4XMUA 4FKKA 3FXPA 4K5NA 3FTXA 1FJUA 4NZ8A 1LNBE 4PJ6A 5DYFA 3FLFA 1Z1WA 3FU0A 4QMEA 4QIRA 3Q43A 3T2JE 5AENA 3P7WE 4ZX6A 3MSAA 5JVIE 4XMVA 1GW6A 3DO1A 3B2PA 3FUIA 1FJVA 3CHRA 4N66E 4R7LA 4XMXA 3CHOA 3P7RE 3FUKA 4MKTA 3Q44A 3FU5A 3B3BA 3FTUA 1KKKA 2TMNE 4M65A 2A7GE 3NQXA 4R5TA 1EZMA 4XO3A 3T73A 3CIAA 3FU3A 3FBOA 3FHEA 5A3YA 3LS7A 4XO4A 3TLIA 3FORA 1ESPA 5DPFE 2G4ZA 3FTYA 3DBKA 2ZXGA 1QF1A 1PE7A 4R5XA 4ZQTA 1TLPE 5TLIA 3QH5A 1TLXA 3P7PE 4XN2A 3MSFA 4FYSA 3DNZA 4XN4A 3B7RL 3Q7JA 1NPCA 4RSYA 3T87A 5CU5A 1FJWA 5HQDA 4K5LA 2YD0A 4JBSA 3CHQA 4N5PE 5LIFE 1LNCE 4ZW6A 2WI0A 4TMNE 4TNLA 3FH5A 1FJQA 3FU6A 4MS6A 1U4GA 1LNDE 5K1VA 1FJ3A 4DPRA 4HOMA 3QGOA 4K5OA 1FJOA 2WHZA 3F28A 4NAQA 2XPZA 5L8PE 3U9WA 8TLIA 4MXJE 1TRLA 2VJ8A 4Z7IA 1KTOA 5L3UE 3SE6A 3P7UE 1OS0A 4MTWE 4ZW7A 3MS3A 3F2PA 3T8VA 3N21A 2VQXA 4OI5E 3FV4A 1KEIA 1HYTA 4PW4A 1KR6A 4D91A 4ZX5A 3FTSA 4XMWA 4R5VA 1TLIA 4ZX4A 5DLLA 3DO0A 1GXWA 4FYTA 5L41E 6TLIA 3FTWA 1LNFE 4QUOA 3EBHA 5FSPA 1L3FE 4P8QA 4XN9A 4K89A 3FCQA 7TLNA 3CHSA 1LNEE 5TMNE 5LWDE 1KS7A 1PE5A 4GAAA 4MWPE 4XNDA 4XN8A 4ZW5A 2DQMA 4D9WA 3QH1A 4XNAA 3T74A 3T8GA 3FULA 4FKHA 5C97A 4XMTA 4KXBA 3B2XA 3EBIA 2TLXA 3T8DA 5FSSA 4KX7A 3B7UX 3CHPA 3NQZB 2XPYA 4PVBA 5TLNA 4XN5A 5AB0A 3T8HA 2R59A 3FVPA 3QNFA 3T2IE 1KJOA 5AB2A 3QJXA 1PE8A 3T2HE 4KXDA 1BQBA 3PUUA 3FUJA 3FUDA 4K5MA 4FYRA 3FUNA 4TLNA 4XN7A 4OW3A 1KROA 3SSBA 3EIMA 1Z9GE 4KXAA 5JSSE 1ZDPE 3P7SE 8TLNE 4X2UA 1LNAE 3FH7A 3MDJA 2DQ6A 1THLA 4XO5A 5BPPA 4N4EE 5FWQA 1SQMA 4Q4EA 4MZNE 3FTVA 5J6SA 3P7TE 3MSNA 1HS6A 3FUMA 3T8CA 3FH8A 3T8FA 1Y3GE 1H19A 4ZW3A 3P7VE 4OU3A 3FB0A 3FTZA 3EBGA 4L2LA 5LHDA 4XMZA 3FXSA 3FUFA 3DO2A 4KX8A 4XN1A 4TLIA 5JT9E 4ZW8A 5LDSA 2HPOA 1QF0A 4QHPA 4PU2A 2TLIA 4WZ9A 5JXNE 3FUHA 4RVBA 4F5CA 3NQYB 3B7SA 2GTQA 6TMNE 4J3BA 5LG6A 3FUEA 3ZI6A 5FXNA 5FSJA 3NN7A 3B37A 3P7QE 4FYQA 2HPTA 4GERA 4QPEA 1TMNE
chains in the Genus database with same CATH superfamily
4XOAA 5I6XB 2F8OA 3ISWA 1J9CT 4ECNA 3X12A 3JT2A 4MD0A 4I48B 4JW1A 3AAZA 4JCLA 4ZMWA 1P7HL 2CO6A 3L4TA 4ZN6A 3L8QA 1JCKA 4PRHB 2UY1B 1WD8A 4Y1TA 3VLFA 2XZQH 1FAIH 1NFDB 4JE4B 5TE4H 5M94B 4JPWH 3WCYA 1J0HA 3SJVD 2PQRA 4PJ9C 3TWCH 3CGHA 2X4UA 4MCYA 4B7LA 4GW4A 1XGTB 3HKFA 4QXGH 3AQXA 3OQ3B 3PAVA 4IRSA 5JMWA 3G04A 2VR3A 3ULUC 3PJLA 1NCTA 4EUPA 3ZHZA 4LIQL 1PZ2A 4HHGA 4YHZH 3FGDA 1C12A 3DIFB 3ARFD 2DWEB 3MYZA 5FO7A 3QFDB 2Z8RA 5I5RA 1AHWC 2VKWA 4OZGE 2P5EE 1TTCA 3SDAB 4NIKB 4JGUA 1U30A 2NOYA 1MVUB 3D2UB 1CD1B 3NABL 4M5TA 4PWKA 4FFZA 3FQ1A 5E8EA 3B7YA 3ZHFA 5DQJA 3EJTA 4WUUB 2XPIA 1JCQA 4Z7UB 5CHEE 1H5BC 2P9SG 4DRXE 3QEQA 5HHXH 1RJYA 1E90A 4WJ5B 1LNBE 4NKMB 2MFNA 5D7KE 4LRIC 5ID0B 1JWUB 4GMSH 2IH1B 2GEEA 4UU9A 1N0LB 1OAKH 3IJ7A 3UIOC 2K8QA 3ULVE 3T2JE 2IQAA 3B2MA 1XHHA 1HOCA 1NCBH 3V6FB 3RWEB 4C59B 4NHCH 2AAAA 1FJ1A 4X9GA 1OCOE 4D9LL 5ALCH 2VW4A 4LGRB 2BVTA 3TX4A 4ANKA 2H0EA 2I9TA 4WENB 2QVKA 1HK6A 2V5MA 3LJ3A 4PWHA 4B9KC 1F4YH 1Q0LA 1W0WB 2YD1A 3GZKA 3OAYH 4M6NH 1ZAGA 2C1PA 4J8RA 1I9IL 1TSHA 4C56E 4KXKB 3FUKA 1GYWA 1KN2L 5IW6B 1PZ5A 4DTGH 3FU5A 5LWYL 4N0RA 3QIUA 1KTKE 3FFCA 3EW3B 3ARFC 4KKZA 3GI8L 1E28A 3RGVB 1IAIH 4JB9L 1MFDH 1NCCL 1TIUA 1UG9A 1P6FA 3DUSA 3ZYOA 5JJTA 2E7LC 3ZTCC 4PRPA 1D8DA 2Z91B 5PCYA 1X5XA 4PN6A 5GGUA 2WZPA 2YPVA 1C1EH 1KXQA 4IOSD 3GHPA 3QFGA 2HJLB 3OKKB 5DK2B 3D18A 4QHMB 4X6CB 3DSUA 2VE6B 2VDQH 1PY9A 4D8PB 2AABL 2I07B 1U8HB 1E0OB 1XFPA 2X87A 4MD5B 3J2PA 1J8HD 2AMUA 4G8IB 3FORA 3DSFL 4DGYH 1KTBA 3UKUG 1NJ9A 3ZTNH 4YGVA 1YAZA 3LZQA 4NKIL 5IVZA 3NAAH 1H8NA 4PV9A 3RKPA 1PKOA 1E67A 1QF1A 4HBCL 3VXRD 1HKLL 4PJXE 5CEYB 3CDYA 1OCWL 3UZQB 4BFGA 1QNFA 2FO7A 4LDEB 2LAIA 4G8GA 3V52H 3FHQA 3QIWA 2X12A 4Y16A 5DT1H 5I66A 2BSBA 2FO1E 1FZMB 2YUXA 3BKJL 4J3XA 4NN6C 3KWXA 3PEVB 4Y89A 1CK0H 1EFQA 2DYPB 2LAAA 3DRTA 2XPGA 1SQ2N 3EYVA 4DLOA 4ETYA 4EDXB 3EHBD 4OJEH 5IJVA 3D9JA 1V7NL 5DFWH 3NSDA 1HH6B 1VFBB 3AREA 3IJSA 3C5JA 3NFPB 4ONHA 4DQOH 2QPEB 3CVHH 3MRPA 5AAWA 4G2AA 4G83A 4GP5B 3FZUD 1MWAL 3IDJB 4OZFA 1ZGLA 1MCIA 3K8KA 4N2SA 4L1HA 3E3QE 2XN1A 2E4FA 2J1ZA 2WCGA 3LY7A 4PJHE 4EDWL 4A1RA 3GMPA 3RB5A 5HKPA 5LDUA 2EDQA 4HVBA 2Y7SA 5JW5A 4FNLH 1HYRC 1HSBB 2DYRB 4FP7A 1F90L 4KFMA 1KEML 3LEXB 4YHOL 3MJ8A 3TXMA 2ZP8A 3UMTA 3D9KA 1PMYA 4BWRA 5GIRB 1MFAL 2NW2A 2NW3A 2RFMA 3AS1A 3P9LB 3MUZ1 4APXA 4Z0BL 4F7PA 1XBDA 4KQ3H 4BUQA 2Z0UA 4OIIL 2QDWA 1H3PH 2YN5A 5L9DL 4QEGA 2WSDA 4NQDB 4U1MA 4B27A 1NI1A 3GS4A 4J8SA 1E2ZA 1YG9A 5AVZB 3O6FB 4Z7QB 1U8KB 4MWFB 1ONPA 1SF5A 3CZEA 5D5ME 2ZWNA 3LVTA 3ZPDA 4FJZA 4U3SA 5J08A 2JEKA 1KTOA 3SDXF 3L5XH 5BRPA 5D4QA 2Z4QB 1RURH 3A21A 3PGCA 3DVFA 4U0RC 4YAQB 1N4XL 4AEEA 3ETBJ 1YEEH 3W5MA 1UOLA 1A0QL 4KU1A 1SN2A 4X0NA 3RZWA 2XX1A 3FZUC 4I3SL 2Z1KA 4ICXA 4PWIA 2FQDA 2GSGB 3D51A 4Y5VA 2FJFA 1FORL 2XRYA 1MJUH 2YAPA 4IMKC 1SOKA 4F9PA 5ACZA 3LPPA 4JN1L 4P4KB 1A8JH 4U1IB 3V79C 1RUKH 4GRMB 3K1DA 4OI5E 3SF4A 1KIQB 4HKBB 2CH8A 1U92B 1K5HA 4XVTL 3RI5K 4QJ4B 1A25A 1O1RA 1FVCA 3WNNA 3L3KB 4WAFA 4YGAB 4JQXC 1OHZA 3FTSA 1S9WB 2XVBA 4PJHF 2NZ9D 4DGVH 1MHPL 1YEKL 4X6DB 1HL8A 4I2XE 3WKYA 1KFAL 5KOMC 3RFZC 4XIFA 3CFKB 3H9HA 2FJUB 4TRPH 1DUZB 3ARSA 3QHZH 4HHAA 4BETA 3GSVB 4PJ5D 4G6FD 4QNPE 3KPSE 3RILA 5DO8A 5AQ7A 4C0MA 1LNFE 2VDRB 2K7QA 3RDTB 2GJPA 3O8XA 1LWHA 3IU4L 2GG1A 3BUDA 2OW6A 2AWIA 3S3PA 1INDL 5HJGA 4DZ8B 1F3JB 2NTSP 3ABKE 3MO1A 4POUB 2PNDA 3FFLA 4JKLA 4JFOB 5IR1A 5K9QI 2DWXA 3VDCA 5LWDE 1ZK9A 2YAFA 2EDHA 5DJ0B 4PJFA 4JHWH 2ESVD 4TLSA 1SZNA 5IGXL 5EZOH 4QXVA 3K6IA 3LX9A 2MOWA 3CV0A 3U9PL 1QSED 2E6QA 4JQIH 5JORB 1RV6X 1IM9D 4TLKA 4NN5B 4RESB 2DQMA 3V4LA 3IETB 3BT2L 3NOGD 3KM1A 3MJ9H 3TBVA 3QB2A 2VXQA 3LPGA 1MJ7H 1O9VA 2R2BB 2BPBA 4OFYD 1UWXH 1D9KA 4ZFHA 2NZ9C 4FHBD 3ROOB 4ABVA 1YSOA 5LGJB 4ZI8A 1IL1B 1PC2A 2PTUA 1WA2X 4JGJA 2VSXE 1NOAA 1F2XK 2DM4A 4ATGA 4CC4A 1LDSA 4HJEA 7PCYA 4J8QA 1XR9A 2DQHL 4XC3L 1NL0L 3M7OA 3WY3A 4P46B 5BNXD 1N7ML 5IG7A 4Y88A 3MNWA 3UBXA 1O6VA 5C3IA 1RHFA 3UPVA 2ZXBA 1HXMB 3MKKA 3VX1A 1QSFA 1MJJA 3WUWG 1W8NA 5JO0A 2PNNA 4F7TA 5SX5K 1ORSA 5ETUB 3MXVH 5KVMC 1NICA 4LBEA 1BVLA 4J1UB 1S7SA 1B4JL 2Q3ZA 4XP4H 4G6JL 4MJ4A 1MHCA 4X4YA 3VJ6B 4M1GL 3MRJA 4HMDA 3NMEA 3AXLB 2KPNA 4AMXA 4TSAL 1ZE3C 2R27A 1BPOA 1DFBH 2IAND 4LCIH 4MDIA 4C8XA 1E27A 2IH3A 2UZXB 1J8RA 4FYRA 2YGQA 4O00A 1HHIA 2Q6WA 2MMXA 3PDOA 1AGDB 5BV7B 3P69A 1T0OA 5HHPB 2DM2A 1FPTL 5ACLA 2A6JB 2ZTBA 4UTBL 5JSSE 2PWHA 2JLLA 2IOOA 2IFFL 1PSKL 1URLA 4K71C 4HRLA 3WJJA 3EFFA 1RD6A 4L3EA 1F3RB 4NERA 5SV4A 1B4RA 2WXNA 2A2QT 1EAJA 1Q0YH 5KYUB 5FM4A 3UH8A 4BFIA 5DVMA 4LHUA 4XO5A 4OUUB 2ZYIA 2MCAA 2HVJA 4C57C 4AM0A 1YC8A 4CRWA 1IJ9A 4R7DB 5F89A 3ZQ9A 5D0QD 4XCEA 1AZZC 1SFDA 3EGSB 3VB8A 4HAGA 3K9IA 2HUHA 1ES0B 2GI0A 4RAVA 3S35H 3DA0A 2R83A 5F6IC 1MY5A 1CXKA 1XZ0B 5CN2A 2R0LH 3B95A 2XZDG 3MV9B 4KVMA 3T1FA 1HL5A 1K1BA 4UIMA 5E03A 3ESOA 5HYSB 1E40A 3O11A 2DWZA 1TU2A 2VLMD 3HMXL 1PY4A 4KJPD 2MAPA 2OI9C 3SZ6A 4HLLA 4HS8H 2A74A 1G7JB 1E50A 1FP5A 3A5VA 3WV0A 4IW4C 1VLXA 3SO8A 2XTJE 2IGFL 5E4OA 4OY9A 3U0TA 4XO8A 5CIPA 1D2OA 1RULH 2AW2A 4CU7A 2CIKB 4UZGA 3IGAB 3NA9L 1JV5B 2WVUA 3BWZA 3LQAC 5JO5A 2DQEL 5M7QA 3UTSB 4XOCA 4L8DA 1UUSA 4QHPA 1OKEA 2G60L 4LCWD 5DJDA 4A2DA 2CZNA 3VI3A 3Q05A 1JZ3A 4Y5YB 5BXOA 3COOA 3K8LA 2VGEA 3WQQA 2W95A 2ODIA 1FG2B 4HZLA 2B0SH 3BW9B 4AE0A 4N2CA 1Z9LA 3AQYA 5C08D 1NANI 3BE1L 1ITBB 4I9WD 3ABZA 3V6ZA 1UOVA 5EV7A 3NQYB 2GIYA 4ZPTA 5E75A 2C4FT 1QW9A 1WICA 2L4OA 3WKPA 2Y7OA 5B21A 2K6YA 3Q73A 1CGWA 3MV7B 3HAEG 1CFTA 4ZOEA 3K5SA 2VMFA 3OAUH 4KJPC 3HEIB 4MNGA 4OLYL 1N68A 1SYVA 2VDNH 1GY1A 1LO3H 4AMKH 4DK6A 2F54B 5I1LA 3ZSTA 3LYAA 1U2VG 1DQVA 1U8QA 5HD8D 5C0AA 3LH2L 1JFQH 1MX4A 3IN2A 1UGKA 3TTSA 1T89C 2AEPH 2WKLA 2A99A 2BY1A 2EYTB 1SJEA 3QWRA 3BD3A 5DFAA 2J44A 4JL1A 1OQXA 4LVEA 3RL1B 1VSCA 4H7YA 4QTIH 1CI3M 1R3KB 4RMTA 3UG3A 3VXMD 1N12A 5CNHA 4XNBA 4YDWA 1C5BH 1J18A 2IBGA 5GGSY 3DX6B 3T4AB 3BQUD 3HI1A 2KQNA 2R1XB 4ZQFA 1P5UB 3FRPB 4J3OH 2GAZB 5D1XD 2NR6D 3LEWA 5L7XL 5K39B 2VLJE 3VVMA 4QKXB 1TQBB 4RMQA 4P2RD 5DZOA 1XIWB 2D7MA 2VISA 4L4JA 4PI0A 3S0PA 1D5XA 3FFDB 4H0IA 2O61A 2HH0L 4NNXB 3GMOB 3UJJH 1RJCA 4CN4A 3T0EA 1G94A 4ILIA 3SDDB 3NBNB 1BGXH 4BQBA 4E36A 4OAWB 3EFDH 1WA1X 5E8PB 4OV5A 2V9RA 3BVNB 4UAOC 1E5YA 3CVPA 3QUXB 2DKMA 5FOJA 3AFLA 3WKQA 2I2OA 1AS6A 4R7XA 1BZEA 2VDPL 2EEXA 3Q9NC 4MB5A 4PBDA 1QEXA 4PJGF 2DBLL 4JDZB 5FECA 3S34H 1QD0A 4G8FB 5EIVA 3N6YA 3W9GA 3WXWL 4JQVC 2NY2D 4GUPA 4QIRA 3Q8EA 4JFSA 4XPFL 4S1DD 2YRBA 5CO1A 1F1DA 2WBKA 4EIBA 4W9FC 1S5IL 1TTGA 4HSCX 2ADFH 1KC5H 4IRZL 4K0RA 2DIJA 5MI0B 1CF1A 5JIMA 4HUXB 1BVOA 4KO6A 4QRTA 1RUPL 4M43L 3QQDB 3BQUC 1PD0A 3HNTH 4UQCA 3E34A 4KITB 3CG8A 2VZ1A 5D1XC 4H8WH 2NR6C 3MCKB 1IC4L 2YAEA 1W8EA 3U4EA 2OZ4H 4X9BA 2LU3A 3KG5A 5JHDA 3QUYB 3P7RE 2CUHA 3MBED 4ATZD 4MD4B 5IKCA 1VFOA 2MQ3A 1NM4A 1P53A 4E5XA 4DVRL 1E2WA 2IO3C 4CZ2D 1RZJH 1NCOA 4LSPH 2JQAA 5LX8A 2XQBH 1RK1A 4ZAKC 3MA7A 4ZUVA 43C9A 4B9JA 1ZSDB 5JHLL 5LOZA 3IMWA 2CG9X 3AWGA 4I17A 3T2LA 3S8WA 4XO3A 5KVEH 1VF5C 3BYYA 2KS0A 5I1LB 3X1NA 3BWSA 5ESVB 2HM8A 2C0LA 2PUQT 4HGMA 3N0AA 4YK4B 5I15H 4WSJA 4JO2H 4PJBF 1AQHA 5DHEA 2ZUWA 3AY4A 3BPNC 3ZKMD 2DOCA 4JAMA 5GGVY 1X6NA 5E00B 1SEBA 2NY2C 5IBTH 4OAVB 1CDGA 4XMLL 4TV3A 1LO4H 4Z3TA 2DD8L 3ATBA 3ZT5A 3BAJA 1QABA 4AM0Q 3V55A 3OJ2C 4BKTC 1KJ2H 3Q01A 3VRIB 1SXAA 2WQHA 3MLUH 3IKKA 2YBGA 4N0UA 3PXJA 5I76A 4YDYA 5A7DB 3QEUA 5C92A 4WNJA 1F11B 1NANH 4L29A 5BXFB 4Z76A 5TLIA 2UXGA 2UV3A 1IC5L 4UNIA 3P7PE 3MLSL 4EZJA 3BO8B 4B5EA 1TR7A 1UQSB 2BHYA 4I18A 4WNQB 2KLTA 3MBEC 3FQXB 3Q75A 2F8IA 5D6DC 4ANUA 4ZQKA 3RE0A 3ABGA 1E2VA 4RGMB 4RSYA 5EBWB 2EIDA 2D3VA 2AVPA 1AR2A 5CSZB 5AWNL 1HCYA 3KYOA 4IBWA 3W9FA 1FL3B 3MODH 4APQD 1DJYA 4C83B 3ARGA 2EAEA 5BVJA 1R46A 1JN6B 2K9FB 4OZIF 3S36X 3KSLA 4X4XB 1RFDL 1FSKC 2A4EA 5FC9A 5TH2A 2XYCA 2FEDD 3X13B 4K5LA 1OB0A 2HFEA 5IQ9A 1NZRA 1KLGB 1K6QH 4NP9A 3T09A 2X5PA 3PL6B 4FNTA 5F8QC 2P7TA 3DBSA 1N59A 5PAZA 3ZKMC 4GT0A 2G3MA 4JY5L 2WQ7A 3RDJA 5AB1A 2J9QA 2CBOA 2XLLA 3I84A 2XV3A 4OFVA 4ZUUA 4G8KA 1FZKA 2M2DA 3NABH 4GRWE 1WDAA 4I3RL 5EOTB 4LFHG 5DJCA 1F5WA 4JHAL 5LNGA 5T1JA 1QA9B 4YXLL 4QHUA 4BX8A 4B50A 4KTDL 2XI9A 1YO4A 3WN5A 4BTBA 1EHNA 5IWLA 4TNWF 5E7BA 4ODXA 5SWZA 1I1CA 5EU5A 2YPKA 4QY8B 2IXQA 2FEJA 4IU2B 1IE5A 2P5ED 1BZ7A 2VKXA 2CO3A 2FBOJ 4D9LH 4NO3A 3GLDA 4JFFB 3L9EA 4JHUA 2QQNH 1U93B 2E86A 3DVNB 3CU1A 1WC7A 4AIZA 3QULA 4APQC 5I1DB 1OAJA 4ODUB 3J5QB 2IPKA 2XS8A 1NCNA 4IKNA 2ADJA 3SE6A 5D7KD 4TYUA 3I4GA 1IBGL 3N44B 1PPIA 1KN2H 1YEIH 3NIGB 3MMEB 2ZOLB 4PY7B 3ULVD 4E0RA 2QLYA 2V5YA 3GXFA 4GLRI 1GTNA 3GI8H 3ISYA 1HIMH 5AIJA 3RL2A 1R1CA 5HGHA 4HOWA 5EO9B 1LO2L 3S7FA 2YD9A 3DBXB 5FAAA 5CMWA 4ZUSA 4BBWA 3QPXH 4ZXBD 3SGJA 5AW2B 3U4AA 4G7SB 5MEOB 2AEWA 1FT1A 1CFSA 4LRNL 1FNSL 3VFOB 3GXMA 4OOFA 1HZ4A 3MOAL 1KEGL 4DEPB 2R70A 5DRNA 4Q6IA 2A1WL 4R4BB 4A3VA 4D0BB 4EIUA 2X4SA 3AZUA 4C56D 4XVJL 4WFEE 2OKMA 1LK3H 1U8CB 3G5XB 2UVFA 2AP2A 3DSFH 3L3OC 2E59A 2IGLA 1A6UL 2BWIA 2Y25A 3UPRB 2GHZA 4NLAA 2DM7A 4PJDB 1ONQA 4QT5A 4X0KA 3DV4A 1AGBA 4UWKA 1TVHA 4JDEB 5ECJE 2GQHA 4HBCH 4W70A 4PJAA 3QUMB 1HKLH 2WXQA 2FX8L 2PYEE 5LB1A 5A3ID 1CBVL 1JWSA 1U3HD 3HE6D 4MJJA 1NDGA 4RISH 4ZNCD 5J11B 3GTTA 4FI8A 2BNQA 1FNEB 5F7FA 3UTTA 4C58B 4MJ6B 1IB5A 3ULVC 3BKJH 4YHPB 1AGFA 5FOBB 4HG4K 4YR6B 1MJ8H 4GYOA 2K70A 5HJBA 4B9IA 2APFA 3ILQD 1LNUB 4NNPH 1LNEE 5I82A 1C5DA 1A7PL 2PL5A 3UTPE 5IJKC 4HIXH 1K3ZD 1MHQA 3KEZA 2VLRA 4ZXBC 3S6CA 2RTTA 4PRHA 4AMWA 2UY1A 1OD7A 3KJ6L 4HLZH 1IJNA 4LSTH 4QO1B 3FYIB 1KBPA 1Q1JL 4AY6A 2XEEA 1BXAA 2OCCE 3KHOA 3RY4A 4F92B 1CTOA 1XGTA 1GAFL 5LCVA 4I85A 2WLZA 2VC2H 1MWAH 2FTAA 2OYLA 5B8CB 2KDGA 2E76C 5DHVH 2FZ3B 1SA4A 3HR6A 3DIFA 3EO0B 5IVNA 4FNQA 4D10C 1EAPB 2JKXA 1T2JA 5TQ2L 2E6PA 3WIIH 4XE5B 2KCLA 1MVUA 2UWJG 1SGKA 3EJSA 4UOJA 3L7EB 5A3IC 3TBWB 4LSVH 4CGVA 1U8MB 4HIQA 1TG8A 1U3HC 4NQXB 4O2CB 3HE6C 3HS8A 3IDYC 4FFZL 3R7QA 4XRCA 4Z7UA 3TBCA 4EI5A 3A4EA 2Y6SD 4XPAL 4WJ5A 2HJFB 2C9QA 5I1GL 3A4DA 4RFEA 5ID0A 4QRPB 1JWUA 3BDXA 4URKA 1OD9A 3LJNA 2IH1A 4FXGC 4RAUB 4OIIH 3B4NA 3B1UA 4GW5A 3VG9B 1ZLUK 4XXWA 3JZYA 5DJZB 1COBA 2WO2B 4N26A 2R59A 2K1MA 3LZNA 3QNFA 3ILQC 4X4MA 4WWKB 3GSRB 3V6FA 5L2KB 3RWEA 2VZTA 2PPCA 4L9LB 1WTGT 2OL3H 4R7VA 2ZKHL 1U8NB 1GY2A 1GGTA 2VYIA 1NINA 1QACA 3QXTA 2PYFB 3RNQA 1A7NL 5DEGB 3IGLA 4CEMA 4FERA 4J2XA 1JGIA 1W0WA 2EC9T 5MHSE 1HSAB 4I3SH 4YDEA 2JVUA 3WMQA 1DJHA 3MRLB 5DSCA 2EDBA 5IW6A 1WFNA 3FONB 1XL4A 4MAUL 2VSYA 4JN1H 2E9WA 2X6JA 5F21B 1HQ4A 3O2WL 4PJEE 5KWDA 2ZWYA 4OLEA 4OUOA 2A7OA 5ENSD 2D7TL 3D4ZA 4P0DA 4P07A 3P4MB 2HRGA 5E8DL 3L9BA 4JPQA 2EE9A 8TLNE 2Z91A 2KH2B 5D66A 4GLRH 5ILTL 3TBSB 5CN3A 4E41D 1RZ8B 2LV4A 3L5HA 4WW2B 3WG7B 5C6PB 2BSEA 2Y6SC 5E08L 3WIFB 3OKKA 3MSPA 2YPVL 5DMIL 4KO9A 4KKPA 1OPGL 3EHRA 5DK2A 3UXGA 1DR9A 3L95B 2NY4D 4QHMA 4XP1H 4BFNA 5JZ7D 4D8PA 2I07A 3L1OH 4BFFA 4BESA 4MD5A 3E3QC 1YJDC 3QO1B 4DSYA 3FO9B 2Z8WC 4AKQA 1SQMA 2RH0A 2WYZA 2AKRA 2HX8A 2YHGA 3PE9A 4NKDB 5AW5B 2H7WA 2NY0B 3ATEA 2DZEA 1R75A 3ASOE 2WZ6A 4MA8H 3ASNE 3IU4H 4MHHI 3PWJA 5KN5B 3FB8B 3OTTA 1INDH 4RDQF 1ROCA 2R2LA 3KR3L 4N24A 5CEYA 1UD2A 3ML8A 5AKRA 3UDWA 1ADQA 4PGJA 1RUQL 2YUZA 4U6TA 1JYXA 5DA0B 1RZ7L 2GUOA 1FZMA 3LN4A 2NCMA 2ZCHH 1JP5A 4M6ML 4YVOA 4UILL 3S5ZA 4GG6B 3U9PH 2DYPA 3TCLA 4HX1B 5GS2H 3GZSA 3FXSA 4W1TA 2FWSA 3JQ1A 3BUTA 4P2QA 4EDXA 4PLKD 4CBZA 1AS7A 3T0WA 4U6HA 5EH1A 1HH6A 5FFOA 3B9EA 1VFBA 2FWOB 3AM8A 5E70A 4XNUL 5D96B 4TLIA 1JVSA 3VG0L 1ZIAA 1OK8A 3PDGA 4DH2A 3DVIA 1ODUA 4BEPA 2Q10A 1F13A 4XB7A 2R9HD 4FULA 1QQDB 2NY4C 3L81A 5JZ7C 4ZFFB 3MRQB 4B0MB 1NM9A 3BYTA 4JRWA 2FBNA 4L05A 4L8SA 5IIEB 3AU9A 4GH7B 4QGTA 3R0NA 3TVMD 4JRXE 3QNZB 5ITFB 1KCUH 4NX0A 5D1ZC 1V55B 3HC3L 2DQHH 2J25A 3P11L 4XC3H 1G7LA 4QRRE 3TNNB 2C4XA 1NL0H 4DVBB 5IMKB 4TQEL 5GXBB 2JK5A 3F12A 1T80A 4X9HA 1GXEA 3PWPE 1ETA1 1HSBA 4LUNU 3LEXA 4W9HC 1UHVA 1SOXA 1MW0A 3KXFE 4UWGA 4RX4D 1G7IB 3U7WL 1A9EB 4KKCD 3EHMA 1B4JH 4G6JH 1KCSL 3P9LA 4HNAD 5C07E 3VVWA 2R0WH 4GEJA 1QO3B 1XTLA 4H4NA 3NPSB 3T6VA 5ABZA 5KW9H 5T1LD 1KB5B 1ZLVK 4QPEA 1E4WL 1F2QA 1MCFA 4OKVB 1BIIB 2SODB 4HJ1A 3AGWA 2AXJA 2CCVA 2CLVB 3O6FA 1U8KA 4TUMA 4MWFA 3WFHB 3EUUA 2WKOA 2Z4QA 1LEGB 4D8OA 4B9CA 2EXWD 3D0VA 2KT6A 3WFZA 4YAQA 4I88A 5FR3A 5JMOC 3D9MA 3ZNGA 3KJ4C 4KDWA 4I2ZA 4X98A 4U1SB 2R02A 2YSTA 4ZX3A 3VWKB 4LCCB 5HJDA 5J1TC 1A6VH 1CTNA 4UTBH 3CSFA 5DPEE 1U8JB 1MZZA 4HPYL 4JN2B 4L3AA 2GSGA 5AD0A 1A1MB 1PSKH 2AERT 1GCFA 2PPFA 4P4KA 3GBDA 1NLBH 5BNWA 2OMTB 3E0GA 5FIEA 3ZE0B 5FA3B 1R5VB 1EJOL 1VFUA 5FYKH 2DICA 2IIJA 3CHXA 1KIQA 4LK4A 1U92A 4KBPA 1NCWL 3B6SB 3DHJA 1XT5A 4X7TA 3L3KA 4TUKL 2JXMB 1FLTX 4I0PB 4K9JA 4WHDA 3RIBA 4ZNEA 3GLAA 1S9WA 1YMME 2APSA 2IJ0C 1CQKA 2P1YA 4KKCC 4X6DA 5EOCH 2YQ2A 4LCTA 3LD8B 5I30L 4EBAA 3Q1EA 5DYFA 3CFKA 1GHFL 1DUZA 5BVPL 1YQVH 1WZKA 1N52A 4F8NA 4Z3HA 4AQ1A 2NYKA 4LEXL 2Z4TA 4EEEA 4ZK8A 3FAXA 3ARQA 3HMXH 3FCBA 2QVFB 3NZHL 4P2CG 4JDTL 2AK4E 4CDRA 4F6RD 1Z3GH 3AU8A 2EXWC 2OCFD 4IIQB 4ZS7L 3SQRA 4HOZA 2YHEA 3DETC 4DZ8A 1F3JA 1LD9B 1WY6A 1DQDL 2G2RB 3ZXSA 3IDUA 4N66E 4JFOA 4JZJA 5ANMB 5SWQA 2IGFH 2BIOA 5DJ0A 2H0JA 2N0MA 2VLAA 4BCZA 1U91B 3V5KA 2PPEA 3HG0D 2CKNA 5JORA 1EFXD 3LMJH 1KPRA 2BVPB 2H41A 1OP3K 1EYHA 3QARA 2DQEH 1XSJA 1MCLA 3IDXH 3QEGL 4FQLL 3T3PF 1JF6A 3OV6A 4AGPA 2ZUVA 3K6SB 4F1ZA 2G60H 2VXQL 4PJ9B 5AVSB 1PW3A 3FBQA 1BF8A 3CU7A 1JNHB 3JV4A 1IBDA 3GMQB 1DQLL 1AZVA 2CDEA 2KI6A 5G4MA 5ICUA 4LT7A 3ROOA 3T5WA 3UABA 1NL4A 2I85A 3DX3A 2QZ5A 1UFGA 1IL1A 3DLQR 5LNEA 4JJHA 3S48A 2YD3A 3R4RA 4PJFF 3W1ZA 1S7XB 1QLEH 1YNLL 5C9KA 4HUMB 3MFFA 3QCTH 2BNUB 1MFCL 3QCVL 2ZOUA 3AADB 3RY6A 1IBHA 1DCQA 2IAMB 1XQ4A 4KUZL 3KPNB 1BJ8A 1BQLH 1GYCA 3FT0A 3FQUB 2CUMA 4LLAA 1NPNA 4OLYH 1OCZE 5AQBA 1UJKA 2YQBA 5DDHB 2VCOA 3WFDH 3ZHKA 3MRBB 3PXHA 3AQZA 4WO4D 1HXMA 1H5BB 3MGOA 4UQ2B 5E4AA 3WD5H 4RNRB 1NBCA 2FT7A 4IBZA 3ZIYA 1HG2A 5ETUA 1XEUA 2QC9A 4RGNE 4CADB 3UJTH 5ENQD 4J1UA 4NP4L 2HO1A 3E33A 4NQCB 3NJVA 1X9QA 3HRAA 4MRBA 4PBVC 2OJEA 2PR4L 3TEZA 3VJ6A 4XN4A 4UYPA 1FYTB 5C7XH 4EZLA 4GSQA 4FD0A 4IBSA 3AXLA 3ABLB 3SGKA 5CU5A 3PZ2A 1J5DA 3QNXB 1FJWA 4PGCB 2NY5H 4TPRL 5FXCH 2UZXA 1IKNA 3QZMA 2Q20A 3WDHA 3CBJB 1Y18A 1TN6A 3PAZA 1A21A 2Y2WA 5J12B 5EC2A 1PKQB 1AGDA 5JYLA 2YKLL 2HH0H 4IIZA 1EAQA 5FGBA 2XTJC 3PCYA 5G5DB 4YHIA 5HHPA 3AWEA 4FQ2L 4O02L 2A6JA 3C60D 4XVUD 4I1PA 1LXMA 3T8XB 3ARFB 2GCYB 4PBWD 3BISA 2A9ML 1GGBL 2OM5A 2ZAIA 2WWNA 2PP7A 1A6WL 4LKCA 5CEZD 1BMWA 3CFEA 2O5XH 1H0DB 4EOWH 3S3JA 2ZCLL 4JFTA 3HG3A 4ORZC 2Z65C 1KCVL 1RI8A 3EZ8A 5KYUA 1KTLA 1BREA 1HX8A 3UINC 3WXWH 1E7VA 3WUWB 3QHFL 3MCLH 2Z93A 5FYJL 3JTTB 1QLFB 4J8EA 5EU4B 1ZJAA 1EPUA 4R7DA 3GEWB 3AT0A 2AVGA 1JUFA 1FFTB 1LO5B 3ARPA 4GZCA 2V9QA 5JIHA 1S5IH 2ATKB 3EGSA 3QXVA 5EC1B 3NJKA 1SMAA 3H7BA 4NUGL 2AEOA 4OJAA 1PLAA 3PJNA 4XAWH 2Y1YA 4M43H 5KVDL 1OVZA 1E5AA 2UVEA 2XG4B 8TLIA 4N3AA 1ND0B 4R4ND 5EBLB 1NBYB 1NKOA 1XAKA 3GO1H 1YNTF 1IC4H 3O45A 5HYSA 4AI7A 1RP3A 2D0HA 2K6WA 5DHYB 1L0PA 2QHLA 3KAAA 1M7XA 2NNFA 1LP9A 3EJYD 1G7JA 4J3OF 1U58B 4DVRH 4HIHB 3L9RB 3C60C 1O6TA 3X17A 2X6MA 4NN6B 2MNJB 5B7MA 3LKQA 2FX7L 4GKNB 3GRWA 4F57L 3IEAA 4MA1C 2D03L 3KYNA 2WVIA 4P5RA 1VFAA 3IGAA 4OQTH 4TMPA 1JV5A 1I1AD 1MFBL 1ZLSL 3WO3B 3UTSA 3RX5A 5I0VA 1MHHB 2VQXA 3MKQB 2ZXWE 3U6RB 1GCYA 3ECBB 5D1QA 1HYTA 5E4EB 2CDGB 4WDIA 1QZNA 5EBGA 4UZUA 2BTDA 1ZLUH 3IJHB 3OXRA 4XMLH 3HA0A 4OGXL 4Y5YA 4AENB 2DD8H 1KR6A 1FG2A 1E8YA 3EADA 5AW1B 5KBKA 3BW9A 3HI6L 3GSOB 3FFOA 4GZ5A 1J8HB 2X9XA 4RRPG 2AS5M 5ERWB 3TNMA 4KKAD 5J1SC 3DO0A 3T2PA 4UT7H 4D7BA 2BP8A 3MV7A 1TNNA 5F3FA 3U0WH 3PWUA 4R4NC 1OTSD 2BOCB 1F86A 3KVPA 1Q9LB 3MLSH 4F2ME 5ALBL 3EDTB 1UA7A 5B3JE 2IDFA 4YDJB 5BV7H 5DMKB 4MASA 2F54A 5C2BL 3EJYC 2X9YA 1HXYA 4IK6A 5FYLD 4UT9L 4AYID 2CHWA 3EJCA 1U6AH 4F8OA 4F7CA 2H6PB 2IDUA 4EN3D 4E9XA 1KIUB 3LS4H 5AWNH 2H1XA 2EYTA 4BA8A 3CCHA 3CHSA 1S7VB 4AQ8C 1T0PB 1XH2A 2JCCE 3RL1A 3JV0A 1KCWA 1RFDH 3KH3A 1KWGA 3JCKC 4LIQE 1II4E 4PLJD 1CI5A 4I6EA 3EGDB 5DC2A 3DX6A 4NBYB 4HCGA 1I1AC 4FZ8H 3T4AA 3QUGA 2R1XA 1EBPA 2AXGB 2BSSB 3FRPA 3RVXC 5HDQH 4XNAA 4U0RB 2R17C 5K39A 4JY5H 5C0GA 2DMKA 1LO0L 1KB9J 4K8RH 1XIWA 3HUJF 4B0ZA 4XOEA 4XMTA 4HXBL 4NC2B 4UDTB 2GRLA 3FFDA 1JF1B 3GMOA 1AXTL 2WN2A 4H88L 3C2SA 4TVSa 1FC2D 4JHAH 4OAWA 1FDLL 4YXLH 4KKAC 3BUIA 3GUTB 5AEAA 3NCYP 4XBEH 3BVNA 1QUNB 5HDBF 1NLDH 1CGXA 4ODHL 4B94A 3MV8E 1P7BA 1NAMH 4PVBA 1OTSC 4GRLD 3F7QA 3HAEB 4RA0C 5JHAA 4WI7A 1GVIA 2AV7A 1R3IL 2PMZA 4JDZA 3HB3D 4AVXA 5BV0A 3DX4A 1QMUA 1NC2D 3K72B 3QJOA 4G8FA 4PJCE 4PWJA 1NEZA 5C0CD 3WE6A 5T1MB 3D8MA 3I9GL 2MOVA 4DGIH 4UM9D 4EN3C 1TQTA 5D71L 3RFZB 2XKNB 5ABAA 5AZEL 1CICB 1KJOA 4ZQGA 4JHKA 2V9TA 2W80C 4Z3GA 3SDCA 5IT2L 4PLJC 4HUXA 1CO1A 1IBGH 2PUSA 1KGYE 4JG5A 2Q7YA 1IV8A 2ZYHA 3MV2B 3QQDA 2JKIS 3O6ML 2DQGH 4IS6B 4GKOA 4PTTB 3RI5F 2VJXA 3F7YB 1A64A 4IGBC 4EE2A 3MCKA 5H37A 3NSJA 4P2OD 2W88A 1PIGA 4HWBL 4UI9K 3PUCA 4Z7AA 3PYCA 4BWWA 5H94B 3TCTA 4JHBA 3ZO0A 2HRPL 3NEEA 3Q2LA 4ZTEA 1ACXA 4ZOCA 3SPVB 2IU1A 1KROA 3WN6A 2LSVA 2V7HB 4JG0H 1FNSH 4ZFOA 3HW7A 2WXFA 3MOAH 5I8KH 3QR2A 4YDVB 1ZSDA 3V31A 2R4RL 1KF9B 1OP5K 4AEHH 5AJLA 4HLEA 1HT6A 2UWEE 3LNDA 4GRLC 2Z7WA 3DOHA 3SFZA 2B6CA 3FCTB 5ESVA 5HYJE 1JZ8A 1T5KA 4XP5H 3ZHLA 2C8NA 4CSPA 3KHQA 2AFNA 1DQKA 5E00A 1ZLVH 2VJ0A 1AKPA 1NFAA 3PRZA 5I0XA 4PDXA 5CECB 2DQUH 1GPOL 2R05A 4AXWB 2FX8H 2GRQB 3EJPA 1CBVH 1SVCP 1JPTL 4W4OA 4PJCF 1SXBA 2P46B 4WTQA 1NPUA 5JW3L 1J1XH 1I7ZB 3ELAT 4L4TB 4NWUH 3SBTB 4UOW0 4BZ1L 4BYHA 3TF7C 5DD0H 2SEBB 1VAHA 4WFED 5C0DB 2VQ4A 3L4WA 4HBDA 1F11A 5GSRB 1F0LA 4P2OC 5T3ZD 1DQIA 4MLIA 4Q6KA 5AJDA 3BO8A 1UQSA 5F7EH 4N22A 3ZQWA 1OSPL 3JWNE 1HH8A 4WNQA 4ZW3A 3UYPB 3DUUB 2B1AL 2NQCA 3F6IA 3K2IA 5IVOA 3UGUA 1DVFB 3BZFB 5EBWA 1RUML 1FRGL 5CSZA 3BVXA 1Q1JH 3CSPA 1FL3A 5JXED 2PKDA 4KROB 2YD7A 4ONFH 1JN6A 5ITBL 3NFNB 4DZBA 1BZ9A 2CRIA 4WJKB 1O9ZA 3L7FB 3X13A 1F18A 4UAHA 4BV1A 4NQWA 3K7UA 3WHE1 3P30L 4GBXB 4N0CD 4EF3A 3RWHA 4AY5A 5TQ2H 3GC3A 3PGDA 1BMGA 1YYHA 2WO4A 4FL4C 4Y9FA 3HMWL 5JW4R 4A6YA 2UWEF 3M1CA 4YE4L 4EKXA 1S6NA 1EHXA 5KBLA 4WWNA 5EOTA 3WAJA 3LIUA 4FFZH 3VNZA 2I1KA 1MFEH 2PO6D 3AJIA 4WV1A 4XPAH 3TN0B 5HGAB 5I1GH 5EG6C 1P4IL 5TTRA 4P2YA 4JG1L 2D7QA 3QZWA 2FX9L 5E94B 1WO2A 5DHMC 3FXIC 3EO9L 2VDLB 3DWLG 2V5FA 1BD2A 4N20A 4PH8A 5DR5H 2ITCB 4AUJA 2AJSL 4G72B 4IU2A 4KJQD 4P5KB 2QV4A 3NSFA 3SCMA 3D39B 1QRKA 4DPBX 2ZKHH 2WB2A 3NJJA 1F56A 4JFFA 5IW3A 1GGCL 3IHYA 1OP3H 3VDBA 4G26A 1P4BL 3QHTC 1YQ2A 2OP4H 2K78A 3DVNA 4DO4A 1Z5YD 5JXEC 5I1DA 4XP6L 2E7CA 2XVKA 4LSZE 1CUOA 4ODUA 5EN2B 4GI6A 5J57B 2J09A 2UZYA 4AC2A 3UFIA 1NMCB 5KYXB 4HFWB 4CKQA 5GJTL 3F7LA 4Y19E 2YPLD 3MMEA 2ZOLA 5KZCB 4MAUH 3ZE1E 3Q5OA 2EKJA 2F74B 5DLML 2OI9B 5LGYA 5C0JA 2EDMA 1YYCA 3O2WH 4N0CC 4EDWH 3V5DA 5EZJA 3EBAA 4Q97A 2MRYA 3K6DA 1FZOB 1AWCB 5EO9A 3DBXA 5E4IA 1JZEA 2OEVA 5ILTH 4BHUA 1T7WA 2YRZA 1ZLWK 4JJOA 1AFVL 3JV6A 3KNBB 1YNKH 2Z7YA 5MEOA 2BVQB 3E6FA 1H2TC 1EUUA 2JFCA 2PO6C 4KBQA 1CE1H 5E08H 5DMIH 3MEKA 1M4KA 3NH7L 1OPGH 1SM3L 2FCBA 2CO2A 4AVHA 4D0BA 4KRPD 3TASA 3R7RA 2FATL 3WFEL 4GAFB 2XVGA 3HG2A 1UM6L 3ZYIA 1U8CA 3Q6FA 2JB6B 5IB1B 3EOBB 4FKKA 1FV1B 1IGYB 3UPRA 3S37H 5D2LE 4KJQC 1OT4A 2PXYD 2W38A 4PJDA 1WAAE 3DX0A 3GFUA 4PJ6A 2VLLB 4XVSH 4CBPA 4JDEA 3FU0A 5ANRA 4UTAH 1HAUA 2X4QA 4OLZH 5EEZA 2FUQA 2YA2A 3BD4A 3CH8A 2MOQA 4Z8FH 4ILHB 4HSAC 3RHWK 4JY4B 2HT3D 1RUQH 2IOLA 3D3VE 1RZ7H 4MJ6A 1P84K 4TUUA 1R6VA 5K1JA 2J4BA 1BJ1H 2EADA 3DDFA 3QNYA 5FOBA 4GNKB 4YR6A 1UWGL 1JHTB 3FC8A 1Z9SB 2IH9A 1LNUA 3ARDD 4I8DA 3NJNA 3LS8A 1D5MB 1P6WA 1OZUA 3N3EA 3QA3B 2NNCA 4NCC2 4AGLA 4F20A 4WEUD 4QO1A 3R06B 3MROB 4R90L 2B1HL 2EEAA 2YXWA 3QWOB 5DJ8A 3WNOA 3HDXA 4FI6A 5IEKA 1IC7L 3JUZA 3PWNB 4KRPC 4PW9A 5AALA 1QFWM 3UT8A 3ESMA 1B0RB 3BXNB 5INCA 5LCVL 4LHQB 2EDRA 5B8CA 5KTEL 2ICWA 2ZX8A 2X44D 4R3SB 4B8AA 3RDTC 4U1JB 2FZ3A 4G8EB 4HQQH 2LLLA 4PRIE 3PWLB 2OJZL 4P59L 4W9GC 2PXYC 5JIKA 5IV2A 2P44B 3OX8A 2VN5A 1H8OA 4TQEH 3H55A 3HBZA 3VLEA 4C4UA 4WF7A 5EUOE 1MZCA 3QI9D 1QI4A 4ANWA 1RUAL 4M00A 4ADGA 3TBWA 5M72A 1AG6A 1I8UA 1U8MA 1W2KT 1QQEA 3HOGA 1NFDF 5KYWB 43CAB 4O2CA 4UAOB 2EO7A 2Y1LE 2FUTA 2WXHA 2FWUA 4MQSB 2QFCA 5IB5B 1ORQB 4U1HB 1HXIA 2HT3C 3Q13A 1WAAF 2CCLA 1IFHL 1KCSH 4QRPA 5CD3B 2F2HA 4PJ8D 3VFPB 1URZA 4J5VA 4RAUA 1YDPB 5K59E 4PV8B 4KMTH 4PS7A 2BERA 5EOQH 3ZGHA 5L4MA 2YWYA 5CEXB 1L7IL 1U41A 1JGEA 4WWKA 3SHSA 1CGSL 5EUKA 2DLFL 3ARDC 3DYMA 3GIVB 4QRRD 3U30C 2Y4TA 2WBWB 4L9LA 2UUDK 2F5BL 2F7RA 4M7JL 5D70L 1KELH 2YEZB 5KBNC 2PCFA 2XOTA 3FQ4A 1U8NA 3PWPD 4ZUWB 1W91A 1CLCA 3V4PH 1OW0A 3DNKA 2PYFA 4GKZB 5JDSB 5J9PB 3KXFD 5DEGA 2HLAB 2WB1A 3N04A 2WPVA 1BM7A 3T3ME 3TYGL 2DIAA 3BQUB 1Q0XL 1H6KA 4A55A 1DVYA 2CBTA 4JVSA 2J8UA 4HPYH 3MRLA 3Q2NA 5D1XB 2EDDA 4PUCA 3GZ2A 5E2VH 5J1AA 3MBWB 4P2RB 1W9XA 4YBLB 5MEPB 3P4MA 1B2WH 1EJOH 3QUMH 4N8CH 2XN2A 4NIYE 1NCWH 4QHNB 1KTJA 1RP8A 3QI9C 3TBSA 3FQNB 2XXGA 3AWFA 1RZ8A 4ZAKB 5DS8B 1FJQA 4GZ3A 5FJYA 3FU6A 4ZO7A 3TO2A 2DEXX 3DSNA 3RAJL 3WIFA 3WXVH 5ID1B 4JFHE 3L95A 4PJ8C 3ULYA 1U4GA 4S1SH 2JKLA 2BVEA 1GHFH 3CZJA 5BVPH 4G1TA 2EDJA 3BPNB 3FO9A 3K2KA 4LSRL 2B61A 4LEXH 4NKQB 3OJVC 2Y1FA 1JXJA 2OV0A 3U6XS 1VEOA 1F58L 1OXJA 2AEIT 3RGBA 2EIKE 1AJ7L 4O58H 3CDZA 2X6FA 1ZT7A 5J5EA 4DX2A 4ZS7H 5JMND 1MRCL 2MKLC 3FB8A 4BWTA 5KN5A 1HAWA 3P4OB 2C9XA 5E9AA 3QDGE 1YMMD 2B3RA 1DQDH 4TSBL 2OMZA 3WSQL 3QUZD 3GRGA 4N2DA 1RXLA 4JC8A 3RO2A 3D87B 4NRZB 4ODBD 4X6CF 5D7HA 4X9FA 3QXAA 3HS0C 1ADQL 3RUGB 1F41A 4FFYA 4PJ7E 1H6FA 2DDQH 1ZRUA 3VFNA 4Z3JA 4GG6A 1VZGA 2ZPKH 3WNMA 3E2HC 2BW4A 3MBEB 4HX1A 2OTUB 2X1XR 3ZHYA 3QEGH 4FQLH 3QDME 1T5WB 2AK4D 3B56A 4KNTA 5I6MA 4KZCA 2CKBB 2FWOA 1ETZB 25C8H 5FUCE 4WWOA 4KNSA 1DQLH 3DX8A 4M48L 2WZGA 5DEFB 5FFLA 4M8VA 5EF2A 2HWZH 1HHGA 1QQDA 1SYSB 4ZFFA 4DO5A 3MRQA 4E9QA 2NQ3A 1MFNA 1M1SA 4YBQD 2J49A 1YNLH 2ZAGA 1NAKH 3QNZA 1WHPA 3QCVH 5ITFA 4ADIA 2VDML 3UROR 1SDDB 5IMKA 3D1MC 4KUZH 3TNNA 4DVBA 1KYUA 3AUVA 3REWA 3RVWD 2O6FA 3T5VA 3EG9A 3NACL 5F7MC 2H32H 4P49A 3UX4A 2LU4A 4P9HC 3QUZC 1G7IA 2P24B 2CO7B 3RASA 4KTEH 5D72L 4DGUA 3PV6B 1WWCA 3MNMA 1J7VR 1QZ1A 4HCFA 3C5XA 1HDMA 3DROB 4CAGA 2G4GA 2E4TA 3QGVA 1KB5A 5DO2D 4MZIA 1JE6A 5FA4B 3R8BB 1BIIA 5DD6B 3AU5A 1QEWA 4YH6A 5FM5O 1QBQA 1A3LH 3HC4L 1Z9PA 3HXEA 1CL7L 1OP5H 4RFOL 4S1RH 4AJVA 1LEGA 3PG2A 4BRJA 4APQB 1OALA 4PJ7F 1BPLB 3M1BB 1B0GB 2BOBB 2XWTA 3LH8A 4N2NA 1TJXA 3OKMA 1FPPA 2IOMA 2ZUSA 3LQAL 1TPXB 2YKLH 3V4UL 4GSXA 4RGND 4U1SA 4D9WA 4LCCA 1TT6A 4BK5C 4O02H 4KUCD 3ASDA 3VVLA 1K4DB 4G6KL 4RDQG 1U8JA 4JN2A 4YBQC 3O2DL 4Y2DD 3SPCA 4K9EH 3VFSB 2J1KA 2X3MA 2Z7ZA 3OMNB 3R4DA 2LFEA 3WL9B 4DI3A 1Y6IA 1G9HA 3T8DA 1GGBH 2A9MH 2ZSVB 2MCPH 1A6WH 1ZB1A 2OMTA 2AJAA 3RVWC 1BOGB 3EYFA 4JFWA 1JZDC 2ZCLH 3V0IA 4N9GB 4Y7OC 3B6SA 4KK8D 4HGWA 1DVSA 1OWLA 2Y1VA 1C5CL 1KPVB 2JXMA 4I0PA 4JZNB 2OSXA 2WWMC 8PAZA 4UQDA 2XPYA 4A37A 2X6HA 4PYHA 4BE6A 3ZW3A 3CN2A 4IRJB 1MLCB 5K1NA 3S36L 2BSTB 3MLXL 2Y23A 3WOVA 3MLPA 2ZOWA 5AAMA 4AT6B 4YFLI 5EO1A 4XN5A 4RMUA 2PWFA 2FSEA 3OXSB 1UJ3B 1E8WA 4OZGB 2NYZA 3IJYB 2P5EB 2YQ8A 1OAZH 2XNAB 3AQDA 1HH9A 1OSZB 3QE5A 5GRUH 1UOWA 2W0PA 1L9SA 2X41A 2WM9A 3EGXB 3JYBA 4IQHA 1E5BA 4KO7A 1U2YA 1WWWX 2VDRL 1WBXB 4HUUB 4C4BA 2P5WE 1JVOA 4I2WA 4PAZA 4HRMB 4IIQA 4WTZG 2AXHA 2WVVA 3APMA 1UB5A 4ETQA 1LD9A 1OANA 2A9NL 3HZMB 3V9EA 4RGNC 1Z3YA 2DI9A 4Z7OE 5ANMA 3E1ZA 2DZOA 1S5HA 4YBHA 2R7EB 1PD6A 4Y2DC 1QFPA 3IE4A 2Q76A 4XBPB 5I1AB 1G9NC 2FX7H 5CXPA 1NFIB 3ONKA 2AJVL 2J21A 1OCOB 4AUYA 2BVPA 4XCYB 1YUHB 1KCRL 1KY6A 4S11A 4ZXBB 1ZLSH 5IOPA 5CCKL 5JYMA 4N1HB 1CDHA 2J4WL 1GZHA 2K3TA 4KK8C 1DVUA 1ZDPE 2R2EB 4WI9A 3K6SA 2LQRA 5GRJL 1FFNB 2W9LA 2F19H 2OOEA 4OGXH 2R39A 3EJQA 3V0WL 1IBBA 1EZSA 4PG9B 2WLNA 1YCSA 2Z6FA 1WBYB 3DO7A 2YUWA 1DBKH 4NCDA 3Q15A 2BNUA 1DBBL 4HK3J 2XT1B 3VFVB 4QJ3B 5L2JA 2IAMA 3KPNA 3IGKA 1S63A 3SO5A 1DBAL 5DDHA 3NCEB 1D7BA 4OZHE 5ALBH 3D85B 3MRBA 4DKEH 4ODWB 3HC0B 4UQ2A 4UT9H 3FQRA 4DX5D 1UXWA 3WFBL 3BH4A 3UTMA 4LRIA 3RX8A 2KM4A 5KSBE 5ISZE 2WW8A 5G05J 4NQCA 2BSDA 1A4KB 3RWCA 2MPAL 5KSAD 1ZLWH 5KVFL 5IB2B 5IROA 4H0LC 1FYTA 1VPOL 1G7QB 5HHOE 3CPLB 2C0MA 2GRMA 1UT1A 5CJQL 3TT3H 4U6XA 4XMPL 3VXUB 3KGRA 2XA8H 4Z7OF 3QNXA 3FUFA 4IEFB 3O4LE 3GINA 2VLKE 1BZQK 4GU5A 3HXDA 1LO0H 2ZUQC 3ARBD 4PJXB 4X42A 4YDIH 1D6EB 3GZQA 1RZJC 3BP4B 1VERA 4EIGB 2Q7FA 3UKRG 3GSNB 4HXBH 3CN0A 1X5LA 5DQ9A 3SDXB 4F7MA 1AXTH 5DF0A 5G5DA 5B1AE 4BKXA 1A3RH 4H88H 4TS6A 5CBEA 3ZKQD 2JKSA 2VQ1B 1GA2A 2QKSA 3G5YA 3QFJA 3T8XA 5FV1L 2I69A 2ZIRA 4X8QA 4JFQB 5E2WH 3VD0A 5CJ5A 5J4MA 1IFGA 2BIMA 4YDZA 4DI4A 1H0DA 1R3IH 2XIDA 3BWUC 3WTSA 4OVVA 1MFUA 2J56A 4JFXB 4ZD3L 2WTRB 1MCQA 3OD3A 4HQDA 1H3WM 4J6RL 4RIRA 3I9GH 1DL7L 4V1DE 3OZLA 3WUWA 1DQMH 3EOAB 5HY9B 3HRZC 3D69A 2XS1A 2Y69E 4OF5A 3ZI6A 4KVPA 1LO5A 3DV6B 4BDVB 2FYYB 3OM3B 5TDOB 3BAWA 5KSAC 2ATKA 4OZHF 2C3GA 5EC1A 5HGBB 4AYDC 1UXSB 4PJHB 4G9FE 4EQFA 2NDGA 1S9KC 3CQPA 2BFVL 1XWVA 2W65B 2O1AA 4GTQA 3OGCB 1UEYA 2A6KB 4NRXB 4Q14A 4WO0A 3I5PA 4N8VB 4GAGL 1PZCA 4DP1X 2JKNA 3N06B 5EBLA 2VW6A 4NB7A 1AY1L 1NBYA 5KSBF 5DVKA 3CDGB 3G6JE 1JNLH 3ARBC 4HWBH 5DHYA 2P2CP 5D7SL 4N6QA 2WMOA 4A7GA 2HRPH 2F0CA 4OGZA 3ULUH 3PNWB 2Q3AA 3FSZA 4L4VB 4H57A 5F0PB 3RIFK 4MDRA 4HIHA 4WCYH 3KDPB 1ZVHA 3M86A 2XWBB 4LASH 2JJWA 5C09E 2ZUYA 1QF2A 2TSAA 3EYUL 4JO1L 5GISL 2LT9A 3IS0X 2R4RH 4GKNA 1KENL 3ASGA 3QJHA 5D5MB 4NC1E 5CJXC 1AMYA 3GRWL 1NC4B 2OAAA 3OB0K 1MHHA 3MKQA 3VA2C 4HEME 3OC8A 4QHLB 5AYUL 3ECBA 4FX5A 2QJ1A 2CDGA 5EOCJ 2QZQA 4FNRA 3C09B 3IJHA 5LAXB 2K0RA 5DLHA 5DUML 4AENA 1INEL 4XMUA 3OTNA 2F68X 2NY4B 3E8VA 1GPOH 4A66A 4KVNH 2BC4A 2UUDH 1PIFA 4I6GA 2X10A 1BV8A 2VSDA 2XY1A 3GSOA 3CWGA 3GPEA 5ERWA 1QFUL 3VQMA 4BZ1H 4CVZB 1WBZB 2EEDA 5D1ZB 1PU0A 4S1QL 2R0ZL 8CGTA 5HYJD 4LVNC 5C0FB 2ADGB 1V7MH 1O7SA 4TULL 3FO1B 3NJXA 3MSAA 1A7QH 4YDJA 5DMKA 3WKNA 2ILRA 1K3IA 4UQEA 3CFTA 3BG1B 3K71B 2WMPB 1MJ0A 2XQYK 3CV5A 4ZSOA 4MZ3A 4I2XB 1MAML 4DHLA 5KSUB 2H6PA 4AOFA 3GKWL 3PF2A 1RUMH 3W38A 5IHHA 1KIUA 4XB8A 1ZTXL 5KUKA 1QR1B 4JL2A 2X6KA 1BHGA 4B3VA 3HHSB 3KPSB 1OCRE 4PUBL 1AD9B 3VXUE 3MA9L 3EGDA 2XCBA 2AK1H 3U4BH 1X3DA 5H7PA 2C9AA 3EDJA 4M5YL 5AW9B 4ZFZB 3RTLA 3SE4C 3TIDA 2W5PA 2AXGA 5I8CA 1I7UB 2TMNE 2Q5BA 3P30H 1YN7B 3ABKB 4JO5A 5K9OA 2Z31B 4JW3A 4LLDB 4R5TA 3KJ4B 1ZDQA 4HUNB 4J3VA 3ES6B 3U82B 3WIHA 4AYSA 4UDTA 2CM5A 1N5AB 4YE4H 5CEDB 2QSVA 4FXKC 4J3OG 3GMMB 3K46A 3GUTA 1EZVY 4GQ9L 4KGJA 1G87A 2I60L 4J12A 4YC2B 3S3SA 1B2YA 4BUGA 5GGRA 3G2SA 4NFCA 3HAEA 3MUUA 5E5MB 5E2TL 3EO9H 5E9DD 1CT8B 5I2IB 2QMKA 1K2DB 1QAWA 4J8DA 2AJSH 3MUGB 1WFIA 2WXPA 3C8KA 3K72A 5EULV 1QBLL 4EQ3A 4LESA 4MA3B 4OFPA 5E7FA 1AGCB 1Q0HA 4ZYKB 5T1MA 3ZN6A 3TTYA 3I9AA 3RLSA 4CVXA 2F8VA 3V4VA 4PS8A 4EZMA 1IM3B 4X4KA 3PVLA 2XKNA 4IOFD 4CDGC 1EVUA 3ZKSD 3GHEL 4F1SA 5C3LD 1HJBC 1CICA 3U9UB 1X44A 1C8PA 2JELL 1DLHB 4N6RB 3V5HB 4HH8A 4IS6A 4JEHA 1YY9D 4GAYB 4AQAA 1XF4B 5KEZA 3FFCE 4HIEA 5EU7C 5DLMH 3EU5A 4GXVL 3JWNC 2APTA 1NIFA 3K1KC 1PTZA 1SXZA 4OCYL 4XPHL 3MGAA 5H94A 2HT2D 1DSYA 1B6UA 4B41A 2Z35B 3ECVA 3AMKA 3FB7A 5F7UA 3ME0B 4QOKB 2PW2B 3GHBL 4HCRA 2V7HA 4N5CA 3F7VA 3WLBA 2CLRB 3KDMB 2QL1A 3TH2T 4G6MH 2P9PG 1TEGA 2DS4A 4ZFOL 2WI0A 4TMNE 5IHBA 2DTML 2APXA 2FATH 4Y19D 3WFEH 1UM6H 1FH5H 2F15A 3DTXB 2NX5D 4HG4J 4ZMQA 2BFGA 1AD0B 1AO7A 4QDGA 4GYWA 4IDLA 3UBGA 3TURA 2ZOKB 1HU3A 1IC1A 1RIUL 2VB5A 5FW6A 1P1VA 5CKAA 1ZHBB 5F70A 3ET9F 4HF5L 1GGUA 2V5RA 4NM8L 3T08A 3X11B 3KYAA 4G8GE 1M6OA 4QAMB 2ATAA 1I7ZA 4L4TA 4CNIA 2WGXA 4UWHA 2J1YA 1I9EA 1YY9C 2P26A 1JHLL 5L8PE 1MI5D 2IO2C 1SXCA 4XHJD 1QKZL 3A6OA 3MX0B 3VXNB 1R4XA 4E9SA 1QRNA 1XGUB 4OV6F 1ZTMA 4JFVA 3UYPA 2ERJC 3DUUA 3QH3B 2X1PA 2V0PA 5B1BE 3P7UE 1DVFA 1XCWA 3GSUB 2JKWA 1Z2KA 3V2AR 1V5JA 4R90H 3LEVH 2B1HH 3QC5X 2AEQH 2P5PA 2QADD 3KWWB 5FZQA 5HLTA 4NBXB 2WZ5A 5K33A 1Z9NA 3MBXL 3D3VD 3L7FA 3U36A 1QG3A 1F8TL 4P48A 1M7DB 3FW6A 4FMFA 2CRZA 4JFDA 3HBPA 2EVFA 4BFJA 1KZPA 3TLRA 5A7EA 2FQEA 1BLIA 5IESL 1D7FA 4GBXA 4OFYA 2EDOA 1NCJA 2E47A 2R23B 4P3CL 4LLUB 3H0TB 1FFPB 1UEMA 2XTJB 4FQ1H 4J39A 3IAQA 4CN1A 4D91A 5I5MA 3DRQB 4A6YL 4PP2B 1NBZA 2OEWA 1H3XA 5AZUA 2LFGA 1TNOA 1Q72H 3TN0A 5AOIA 5HGAA 2NDFA 2NYJA 3KCPA 1LMIA 5BRZE 5C2UB 2Z34A 2H3NB 5DI8A 1CL7I 4XHJC 5E94A 3ZKJA 1XH3B 1K8KG 1CGSH 1HL4A 2DLFH 4UQYA 4IKLA 3QRGH 4MRCA 2F5BH 1L3FE 4M7JH 3D39A 4NDMB 4OF8A 4XN9A 4K89A 3HNVL 2FFLA 3CSYA 4IKIA 2QADC 1J8SA 3HNSL 4FXLA 3CTTA 5F44A 2F8XC 1SBSH 3GWJA 4PB0L 4JREC 5D7JD 2A73A 3TYGH 4XWOD 1Q0XH 5IQOA 5KYXA 4HFWA 3VRLE 3I74A 2P52A 1JJUA 4HFUH 2VDKB 1KACB 1GR7A 2DQJL 4DN3L 5LXGL 4IDJL 4PJIA 3UZVB 4HPOL 5FGCE 2KLRA 2Y5TB 4K3DL 1EZVX 1NDTA 1R33A 2F74A 3D9AL 3RJDA 3L48A 4QJ5B 2FD6L 2JIXD 1EEUA 2OPCA 4JZOB 5MENB 1U3NA 2X4TA 4YL9A 2BEDA 2JD1A 5KJ4A 4DP9X 3SYCA 2YLHA 4M29A 2AITA 1F6AB 4GAEA 5DWUL 3LNGA 4MA1B 5AL8A 1AI1L 4YHMH 2EE3A 5JAZA 4FC8A 1PQZA 2IWGA 1A9BB 4JM2F 4X7EC 3N44F 1KUMA 2VLJB 4NQED 2D4FA 5DZ9A 2VWEE 3O4OC 4GTPA 5DVOA 4AGQA 4AEFA 1FV1A 1IGYA 3LIZA 1RZKL 4D2NA 4B89A 1KGUA 1F58H 4FZEL 4RRPM 2VLLA 1J05B 5DD3H 1LD8A 3KAEA 1CGUA 3D5OF 3NFSL 4N28A 4JMNA 3SHFA 4ELME 1UENA 2JTDA 3IV0A 2QV2A 2ZX7A 2LAGB 3H9SB 3BIKB 1ZE3H 2QT6A 1E6OL 2NY1D 3WSQH 3EIJA 2VXTL 2C5DC 4XWOC 3EH3B 1QLRB 1EGJA 1FNGB 3GM8A 4JFHD 3RWFB 3BCDA 2IPUG 3NTCH 4KVCL 3BP5B 3NGBB 2Q2LA 2VDOB 3E1F1 4WGKA 2XGOA 1CQYA 5BQ7B 1VRSA 4NI6A 4J27A 4M3HA 5KUMA 3BAYA 3FUJA 1TTAA 4XMKL 5AQ0A 4LVHC 2MPVA 2JI2A 4K5MA 1IGCL 4GMRA 4GIPD 3FUNA 1T89A 1AXIB 1Z5LB 3QA3A 4UINL 3B13A 5AW7B 3II3A 4RBPK 3R06A 1HNFA 4AX3A 4YHNB 4OW3A 3QDGD 1JIBA 3CN1A 4LCVA 5L0QC 4N3UA 1XV8A 2EH8H 3NT0A 3QJFB 5FUOL 1G1YA 3QWOA 4M48H 1OAUL 3SKMB 2DB8A 5CD5D 2MTPA 2FGWH 1Z9GE 4BINA 5IMMA 1E5CA 1JTTA 3CZNA 3DC0A 1B0RA 1KBGL 5E23A 1WCQA 4HLZG 4OT1H 4U1JA 1U8IB 2HP4A 4IHQA 1BCIA 2VDMH 1UWFA 4G8EA 4X80L 3FH7A 4DOHB 5IF0B 3MREA 3PWLA 5ENPD 4ZO8A 5D7LB 5E1QA 5F9OL 3WGVB 2J20A 3OWEA 4GCNA 3NACH 1QSFE 1IEAB 4KFZC 3DI3B 1WCBB 4KMLB 2CO4A 4LNVA 4X99A 3ROLA 5KYWA 3CVXA 1DEEB 43CAA 2NY1C 4LCUB 1JNJA 1J12A 2X9WA 4HWUA 2CA3A 4Q4EA 4OD3H 5IB5A 1ORQA 4U1HA 3QZOA 3M17B 4G8AC 2FH6A 3MZGB 5EORH 5CD3A 1RJLA 3S5YA 3VFPA 4F91B 1SY6H 3BEWA 2XRAL 5ENWA 3WFDL 4PV8A 4ELMF 5CEXA 2MQCA 3ASHA 3LNIA 3DJTA 3DSVA 4YVQC 2ENJA 3I02A 4KDTA 5BO1L 3W2DL 2W8CA 1YPZF 1CFBA 3WJLC 5HXMA 4APFA 3FSWA 1E6JH 1HCZA 1NPJA 1CL7H 4RFOH 2ZYRA 3OMZA 3F6LA 4ZUWA 2ISDA 4JLRB 4GKZA 4YPGB 3L2LA 5JDSA 3NCJH 5E2UL 3OB0H 4TNVK 4XCNB 3TZVD 1SJVA 3UG4A 5J9PA 3LQAH 3QYNA 1TEFA 3L16A 4Z77B 4F7KA 3V4UH 3I75A 5CD5C 5FV2A 2XJKA 2P47B 1UA3A 4YZWA 3KYKL 4M93C 2WUCL 4WI0B 3ZZLA 2RCSL 3O2DH 4IGBB 1X5BA 3VFGH 1IAMA 4Q58C 2FQFA 3QUKB 5KS9E 4NJAH 3MBWA 3KEAA 1WISA 4L3EE 2ONDA 4YXHL 4R96B 3UTZB 5F3BB 1AC0A 3WXXA 1R3LB 1FNAA 1LWRA 5F7KC 3SKOA 4D0CB 4AITA 4F8LA 2IQ9L 4QHNA 2PTVA 1YHPA 3FQNA 2PR9A 1RZGB 5KBDA 1MCOL 1OPOA 1B9ZA 3UT4A 4ZAKA 4FLOA 1P5VB 4X8XA 4OIBA 2VXSH 1E4HA 2XTSA 3N40F 4RVBA 5ID1A 5KBAA 3MLXH 4MQTB 4OCRH 1I3RB 4UQ9A 5DXWA 3D9NA 5KVDE 2HA1A 3GUFA 4F5CA 3NJHA 3F5WB 4BQCA 3W0WD 1UOKA 3D3MA 6TMNE 3J5PA 5ANLA 2BJML 3NF1A 4LAQL 1G6RH 4WFGE 3C6SA 1SXSA 2X1WL 1KGWA 4BCXA 4JPSA 3X1EA 4GQPH 3NN8B 4XI9A 1FGNL 3TZVC 4JKPL 4GERA 2A9NH 2MHKA 2LTQC 3TJEL 2BP3A 4MQXD 2FIRT 1NCDL 3AB0C 4WW2F 3P3YA 5I8EB 4CMHC 4G2VA 1N2RB 2V8MA 4QD2E 1ZEAL 2JH2A 4U3CA 3VXSB 4P2OB 4MMZA 3IS1X 3GXDA 5DJ2A 3RUGA 5IQNA 3HG1D 5JS3E 2AJVH 3LVEA 2QKIB 4FFYL 3MBEA 5I1JH 1PGRB 2OTUA 1KCRH 1NIDA 2DQIH 3KVDD 4KY1L 5EHFA 2DIBA 5T3RA 2A9BA 1W0YT 2YKKA 4QRSB 1T5WA 1ZT4A 2J4WH 2P5WD 1GTFA 1JCSA 2X6AA 3THML 2NRDA 2CKBA 3VI3E 3Q9UC 2KHAA 3LRHA 5KS9F 2PF6A 1XD1A 2GT9B 3MI6A 5DEFA 4QTHB 2QPDB 1UKTA 5HYIA 1SYSA 1HWGB 3WS6A 3DHMA 4ZMYA 1N4RA 3O0RL 4U2YA 2Y1EA 3KPQB 4LSUL 4P99A 4FCAA 4HUCA 3ZVVA 3FXPA 1SDDA 4FL4B 2IV9A 1ZBPA 1N6VA 3BPLC 1HWHB 1XCTB 1N0QA 1DBAH 4KKBD 3AAAC 3MHZA 4AR8A 4ZOBA 4WY7L 1JPLA 2AQPA 2AC0A 2E9GA 2X2UA 1MX2A 5B3SE 3WTVA 4O5LL 2VDQB 1XR8B 4R97B 5C0AE 4YSCA 3NUKA 1WITA 3FBKA 3WFBH 4MQXC 1RU9L 2P24A 2CO7A 5BUPA 1BA9A 1BJ1J 4JRYE 4N2MA 4GYYA 4R0LB 4RETB 3IK2A 1DEDA 4E9RA 2FGZA 4PPTA 5CM1A 4CL7A 4UT6L 4YFEA 3DDGA 1TN8A 5DJAB 4RQQA 4N25A 5FA4A 5C0EB 3IGUA 4UUJA 2G0LA 1KB5L 1EHKB 4A2HA 2RIKA 1KLFB 3BQVA 3MKGA 2H45A 4XMXA 3TV8A 2UX7A 1TQUA 4MCMA 1UB6B 2PYEB 3DX9A 3HXBA 4Y5XC 1F4XL 3M1BA 5C0BD 3BZEA 1CDYA 4NOFA 2UXVA 4QHKI 2F5AL 4BELD 5CEZL 3TPUA 3T0EE 4HOSA 1PZ3A 3DMMD 5ISZD 2VRQA 3BUQA 4OSUL 1BPVA 3WDIA 2GRPB 4A67A 3E6HB 1KJVA 4PP1D 1UACH 1KDJA 1WT5C 5FCUL 1KMGA 4CDMA 3TONA 3ZEFA 4C0EA 3CBRA 5HHOD 3QDJE 1M1XB 4OM1L 2XGMA 2ZNWA 1ESOA 3O4LD 4PVLA 4KKBC 3CVHB 2VLKD 4JO3L 5FGSA 1IQDB 3SDYH 2UXTA 1NGPH 2OCCB 4J6RH 5GGVH 1KPVA 2Q0ZX 4ICWA 1N18A 4JZNA 3PXLA 1UD4A 3UGXA 1XB3A 4PG2A 1OOAA 2MQ0A 3WO4C 2NY6C 4IRJA 2CJUL 1MLCA 1RKRA 2FO4B 4N8UA 4YDKL 5D7IF 2BSTA 2BDNL 2DF3A 4UWLA 1DQQB 3NCMA 1D7CA 1NGQL 2J6EH 3OXSA 1UJ3A 1UGNA 2P5EA 3Q2WA 1SDYA 1ICTA 3HKZA 4M62L 4GAGH 3VFWB 4LERA 2XICA 4XN2A 1UURA 5BCAA 1OT8A 3EGXA 3MSFA 2FBJH 5EZPA 3VFTB 3ZE0F 2D3JA 1J0YA 2BHZA 5D7SH 5J06A 2QPSA 4ODTL 4HEPG 4V1DD 2QHRL 2DTSA 1FBIH 3HZMA 3IRPX 1IGFL 3DMMC 4XC1H 2BSRA 3SGHA 1W72L 2O72A 1FNHA 2DEWX 2X3AA 4BH8B 4PP1C 1M05A 2ZWLT 4G9FD 5GISH 4JO1H 3GSXB 5I1AA 2QGEA 1KENH 1NFIA 1QPKA 3OPZH 4MYPA 2V2XA 3D4CA 5TGBA 3QR1A 4XCYA 2VTBA 3GRWH 5LIFE 3ZL2A 1THCA 4Y6RA 5IJDC 2HSIA 4U6YA 4ALAL 3VQ2C 4GZ6A 4ORGA 4P57B 2FR4B 4KH2A 5D2NE 4DIXA 4MAZA 3RHWF 3DPBB 1Y8MA 2B77A 5DUMH 3C5SB 4H8HA 2ICES 1I8LC 2F61A 4PG9A 1S9YB 1TNMA 4FLQA 2Q8AL 5C09D 1ZVSB 5FYLL 3CMGA 1WBYA 4MAYD 1QFUH 2BMKB 3DVGB 4N85A 3NG5A 4P9MH 4PJEB 3WEXA 2R72A 4PW3A 4Q74A 4S1QH 3SJVE 3DUHA 3V2XA 4XPBL 3VFVA 3F8UB 4HJJL 3P73B 2DQFA 1MF2L 4TULH 5JHBA 1N8OE 2CPUA 2WHZA 4QGYA 3D85A 4FQJL 4GA2A 4ODWA 1FIGL 1JPEA 3HC0A 4MCNA 3O9WA 3KEHA 1TMQA 3D9IA 1U21A 2BOLA 4URTB 1WIUA 1OE1A 1ZTXH 5A2BA 3TU6A 1V10A 3BQOA 1A4KA 1CDIA 3A67L 1XGZA 3N1PC 3ULUF 1KN4L 5IB2A 3AG3E 1PZDA 5GPRA 2ENYA 2KBXA 5JJ6A 3ARUA 5I0YA 1RZQA 3ASOB 3ARDB 4Q69A 4LPXA 4D94A 4PRAB 4JNDA 1H3VA 3ASNB 4Y4HB 4M5YH 3VXUA 1AS8A 4OLWL 2MRIA 5JLZB 1K8IA 4GUCA 2VMEA 3L4CA 4IEFA 4D7PA 1K5WA 4X5WA 2JLPA 4PJXA 4FQXB 2WYTA 1D6EA 1IT9L 1MCJA 2N1KA 5AAPA 3GSNA 2HAZA 2Y5QA 5BOJA 2CNYA 1OM9A 3SDXA 1JXFA 3PFQA 4MXQD 4ELKB 1X4YA 2P48B 4P05A 1J5OL 2HVBA 2OMVA 2XIIA 5HNHA 4MAYC 3SBQA 2P9UG 1SPDA 4GQ9H 3VXOB 2Y72A 4UWFA 4IRSD 2AXUA 2JB5H 4JFQA 4NC1C 32C2B 1GC1L 4LP5A 4IKKA 5E2TH 3JVGC 4R5VA 1I85A 2CRMA 3QI9B 4G7YL 4NJ9L 4TSCL 2ZAHA 2LXLA 4Z3IA 1H6PA 4UI9J 3L1FA 4YSQA 4JFXA 5ESQA 4CILA 4ZQHA 3EOAA 3ULVH 3UAAA 4FI7A 3O41A 4PJ8B 1NZNA 3GJFK 4JXTA 3QEQD 2CR0A 3BP7A 4RG6A 4FQCH 2FYYA 4JRXB 3GHEH 2V3DA 2HFTA 3I2CL 3INUL 1UXSA 4PJHA 4RBPH 5BZXA 5HGBA 5DJYB 2IDTA 1R5WB 2W65A 3OGCA 2A6KA 4JA9A 2ZXQA 4NRXA 1LEIA 1T03L 5FB8A 4N2GA 4GXVH 1BOYA 3KXFB 1NBQA 4XPHH 4BHUI 4KQ0A 2QR0B 3D6GA 5FM5M 1L3WA 3ZUNC 4F37F 3APFA 3PNWA 1T1YA 4L4VA 5I75C 5C07B 1G9ML 4XNDA 2NMSA 4WKZA 3GHBH 4ZW5A 5IEHA 2DWYA 1I8MB 3T74A 4GSDH 1T1XB 4QYAA 5CMAB 4RGOL 3VXRE 4W6YB 5KJNA 5JNYB 4IRSC 3E2HB 1QBMH 3S7GA 4YPJA 5LBSH 1R24B 4G11A 1NGZB 5JIIA 2H6UA 4OCXH 5DK0A 3QIUD 4HJIA 3FFCD 2LSUA 5FSSA 1NC4A 3VW3L 1OM3L 1BG9A 4QHLA 4NZRL 3B7UX 5CCLA 1FT2A 4PRPD 5I1EL 5LAXA 5BW8C 2B14A 2LVEA 2WQWA 2X6VA 2O30A 2FL5B 4NZTL 4PJAE 5T3ZL 1ONNA 2WZPD 1I7RB 3MRCB 4V2CB 5H4YA 5DMYA 1FL6B 1BAFL 4NM8H 4UCFA 5CINL 5MEQB 4ODVL 4CVZA 5CP3A 3UTTE 5D1ZA 3ARWA 4HKZB 1OV8A 2HJKB 1JHLH 3SQBB 1WAEA 2ADGA 3HG4A 4OLUL 5C0FA 2WCSA 2BP0A 2BUGA 1LDPL 2Y7LA 3FO2B 3GSWB 1ZA6B 1LVEA 1YMMB 5AB2A 3K71A 5C6TL 1D5BB 5E6ZA 2VLRE 2H47C 3DARA 3QUZB 4K5AB 4H2CA 4M4PA 4MJIB 4I2XA 5KSUA 4N8PA 4KXDA 3MJ7A 3TJHD 1UUNA 2RFAA 4JKMA 1P2CB 1WH0A 3CVVA 1IYGA 2EDFA 4ISVB 1QR1A 2AQQA 5AYWD 2LR4A 1NA8A 1DFXA 2VO8A 1KT1A 4G8GD 4JUSA 1M56B 1YAIA 3KPSA 3QIWD 3V6BR 4N0YL 2P80A 1UM4H 1ZK5A 1CYWA 2ICWI 2FEZA 3HVDA 5KJKA 1AD9A 2DQTL 2EECA 4AH2B 1F8TH 4XNQB 1UH3A 3QIUC 4ZFZA 3MOBL 5EZIL 2AQRA 1I7UA 5FT9A 1Q0QA 5C0IB 3W9EB 1X4XA 3MNVB 5ICYA 1NUNB 1L4IA 1YN7A 5EMYA 5IESH 3RO3A 2Z31A 4LLDA 2COVD 4U7KA 4P3CH 5A2FA 4G9DB 2IOSA 4Q94A 3ES6A 3T2OA 3U46A 4B5ZA 1T2QL 4XNYL 3ESKA 3ARED 3K5RA 1YJDH 3CQCB 3M07A 3WIHL 4A6YH 2WYHA 2QSCH 4I1MA 3K2MC 3HE7B 4KHXL 4TL4A 4RRPA 4AWJC 1TYJA 4NPJA 5L8JB 3N50A 1T4KB 4KC3B 1YEDB 3QYCA 5L6YL 4N4EE 1PF3A 5I0ZA 3SGDH 1FHNA 5I2IA 5GS1B 4R83A 2H1LM 3MUGA 2EIMB 4MZNE 1UKQA 4ZYKA 5E6IB 3U2SB 2AZUA 1AGCA 5AG8A 1NIEA 2XVLA 1MIEL 4G42A 4J23A 3TJHC 4AM9A 5IFJB 2YHCA 3UYRH 5F0MB 2CXKA 1IM3A 4Q2ZB 3V4VL 4JZYA 1IKOP 4U1LB 3TA4D 2CMRL 3QIWC 1M71B 3SNXA 3U9UA 4WW1B 2WQVA 3L2NA 4Y16C 4OU3A 1XSIA 1Q1PA 3CEQA 2VDNB 5T5FA 4N6RA 3V5HA 3ZUVB 4DN3H 4IDJH 5GS3A 1OCZB 3CFCL 5C71A 2IONA 4LPYA 3DXMG 4YLBA 2CCWA 3FT2B 5CGBA 4TQIA 3D9AH 5FM8A 2EEBA 5E8OB 5FX3A 2FD6H 3UM0A 2ZCZA 4O60A 1FO0B 2IO5A 4RGNB 2Z35A 4UMSA 3AREC 2W94A 3TEXA 1QFWL 2X6BA 1QSVA 1S9VA 1R0KA 4QOKA 2PW2A 5JT9E 1QTPA 4ZW8A 1S8DB 2QGDA 4Y2DB 3WEBA 5DWUH 3I6LE 5L88L 5AAWC 3O6KH 3KDMA 4HCRL 1ZGLM 4XO9A 1AI1H 5E6SB 3LNHA 3PEUB 3LPWA 2X4OA 3DK2A 3NRQA 4QCIB 1P84J 2ZONA 1DVXA 5FW8A 3DTXA 3URZA 2GSIA 4NPYB 2YFOA 2ESVE 5IFHL 5EF1A 3ZSSA 3MN8A 1AD0A 5CWSB 1RZKH 2Y7MA 3TWXA 2F58L 3VNYA 5JOPD 1JUQA 1TKWB 3N9GL 4O51B 1WFUA 3WENA 1CIUA 2FJHA 3FUEA 2CLZA 3NK3A 3L3HB 3RB7A 1PJ9A 1E6OH 3X11A 2VXTH 1CD9B 3L82A 2DEYX 4X7FC 1N11A 2W60B 3C98A 4EN2A 3A6BL 2FJGB 1KLUB 4LU5H 2WUBL 4B97A 2D73A 4PCYA 2J55A 2BRRH 4AL8L 4MJ5B 3VXNA 1E3FA 3BKML 4XMKH 4X8JB 1Z5HA 1XGUA 4P2QE 3O8XD 3BUYB 5DVNA 4ABUA 3RWIB 1IGCH 3ANNA 3QH3A 3C5ZA 4KPHL 4WUKL 3CDFA 3PHOB 3NEXA 3U6XA 1GYAA 4H1LA 3H54A 3UMVA 3KWWA 1OAUH 4IBLT 4Y5VC 4F7EB 3F7KA 2FHCA 3TPKA 4F9PC 1M7DA 1KBGH 1MPAL 3CDCA 4LOEA 3E4BA 2ZQKA 2ZUQB 1PDKA 1IQWH 4X80H 5JMRA 3QRFM 4JJ5B 4IHOB 1TJCA 4Q9QH 2R23A 4EIZC 2HZHA 1KSRA 3H0TA 4HC1H 1UD8A 3BCFA 1DZBA 4EI6B 2IANE 3TF4A 3DRQA 15C8L 1D9KD 4TF4A 3TH3T 4AYEC 3HUJB 3LV3B 2AI0L 2O6DA 4GKSA 3DPDA 2WVTA 3ARRA 2CUIA 2NTFA 2XRAH 3ULEG 2ZXWB 4NN7B 1I9RL 2H2SC 3RWGB 3MRFA 1EJFA 2VWEC 6PCYA 2CWRA 4RZKA 3RJQB 1A9VA 1XH3A 3WGUB 1XF2B 2E7BA 3P7WE 3W2DH 5BO1H 1BF5A 1LILA 1RZ4A 2A0LC 4LKXB 4ACPA 3C08L 2FLMA 3B9DA 2EUXA 4TUJB 1KJ2B 4PGBB 3V0VA 1MVYA 3ESLA 5JMPA 1WIPA 4NDMA 5JW4N 4XMVA 4PJGA 2DLGA 2WOYA 2XN9B 1QSFD 3T77B 3WY4A 1KY7A 3ZK0A 1FZJB 5LXVA 5DZLA 2ZGGA 35C8L 3UC0L 4POZD 2R1WB