2XPZA

Structure of native yeast lta4 hydrolase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
632
structure length
627
Chain Sequence
b'MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUKOTRIENE A-4 HYDROLASE
publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 205
structure length 627
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpzA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpzA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpzA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpzA01
4R5VA 3T87A 3FUHA 1TRLA 1LNDE 4PW4A 1TLXA 4XN9A 5CU5A 4ZX5A 1ESPA 3P7SE 3FB0A 3TLIA 4K89A 4XN8A 5FXNA 4FYRA 5JS3E 2HPTA 5LHDA 4OU3A 5HQDA 4XO5A 4M65A 3B3BA 3T2JE 1Z5HA 2TLIA 3CIAA 3P7RE 3B37A 5TMNE 4XMXA 4J3BA 5L3UE 3CHQA 3N21A 8TLNE 3DNZA 3SSBA 1KROA 3CHOA 3FXPA 3FUFA 3FUNA 2TLXA 4XMZA 3FCQA 4RVBA 4MZNE 3P7UE 5LDSA 3FULA 4XNDA 4WZ9A 3MSAA 3Q7JA 4FKKA 4K5MA 4GAAA 4XN7A 3FGDA 4N66E 4Q4EA 1TLPE 4K5LA 4N5PE 1GXWA 4ZX4A 4E36A 4FYQA 1Z9GE 1LNFE 3FTXA 1FJVA 4GERA 4XMVA 3FUKA 3TMNE 4JBSA 3B2PA 4XNBA 4PU2A 4XN4A 1BQBA 3CHPA 3FUIA 1FJUA 5DLHA 3FTUA 3NN7A 4MTWE 2YD0A 1QF0A 3B2XA 3FTZA 4ZW7A 3EBIA 3FUDA 3B7TA 4N4EE 4QMEA 3B7SA 2DQMA 3QH1A 1LNCE 3FU5A 3DO1A 5A3YA 4KX7A 4XN2A 1KL6A 3T8FA 1OS0A 3T2HE 3FH5A 1FJQA 2DQ6A 5FWQA 1KR6A 4XO3A 4QPEA 2VQXA 4RSYA 5FSSA 1KJPA 4XN5A 3FUEA 3QH5A 1KJOA 4Q4IA 3P7QE 4ZW8A 3T8CA 1PE5A 5AB0A 3FU0A 4XO4A 4B52A 3FUMA 4KXBA 1LNEE 1KS7A 4D91A 3DO0A 7TLIA 5C97A 1FJTA 4ZW5A 4MXJE 6TLIA 4K5NA 3MDJA 1KEIA 3CHSA 4KX9A 1LNAE 3Q44A 5AB2A 5DYFA 4OI5E 4KXAA 3EBGA 3QJXA 4KXDA 4ZX3A 3DBKA 5DLLA 4ZW6A 2WHZA 5LG6A 4P8QA 4NAQA 5JT9E 5J6SA 3T8VA 5FSJA 2VJ8A 4K5PA 4QUOA 4KXCA 1FJWA 1NPCA 3FUJA 3FV4A 3B7UX 1KKKA 3NQYB 5LIFE 4TLIA 2XPZA 3P7PE 5JSSE 4R5TA 3FU6A 3B7RL 3MSNA 3FHEA 3PUUA 4R5XA 4XMUA 5JVIE 1GW6A 2XQ0A 3FU3A 3NQXA 4XMWA 1QF2A 5L41E 3EIMA 4DPRA 3KEDA 2ZXGA 1L3FE 3FTWA 1THLA 4KX8A 4FKHA 4D9WA 3F28A 3LS7A 4K90A 4K5OA 1TMNE 1SQMA 1PE8A 3NQZB 8TLIA 5K1VA 3QGOA 4MS6A 1HYTA 1PE7A 3FTYA 3FBOA 3FVPA 3CHRA 3P7WE 5L8PE 3T8GA 3SE6A 1KTOA 2R59A 3T8HA 4ZQTA 5K7TA 1Z1WA 1H19A 3FH7A 4L2LA 1FJ3A 4FYTA 3FXSA 2TMNE 2HPOA 3QNFA 4XN1A 3FTSA 1LNBE 1QF1A 1ZDPE 4HOMA 3MS3A 3P7TE 3FORA 3T8DA 3U9WA 5TLIA 5DPFE 5BPPA 3DO2A 3ZI6A 5AENA 3EBHA 3FLFA 5JXNE 4TLNA 4ZW3A 1U4GA 2XPYA 3FTVA 4ZX6A 3MSFA 4MKTA 3T2IE 5LWDE 2WI0A 2A7GE 4OW3A 4F5CA 1TLIA 5FSPA 3B34A 3T73A 5DPEE 4NZ8A 4QHPA 4FYSA 4X2UA 3FH8A 4XMTA 1HS6A 4H57A 4R7LA 4MWPE 4TMNE 4Z7IA 4PVBA 1FJOA 4PJ6A 1EZMA 2G4ZA 2GTQA 3Q43A 5TLNA 4TNLA 4QIRA 4XNAA 7TLNA 6TMNE 3P7VE 3F2PA 1Y3GE 3T74A 4FKEA
chains in the Genus database with same CATH superfamily
1QLEH 2Q8BL 4B96A 3U83A 4AQ8C 1V7NL 2AV1A 1E2ZA 2B15A 5EC2A 4UQXA 1WFTA 4ATTA 3KNBA 1KT1A 1J9RA 5BZDB 3FB7A 3VD5A 2J44A 1CE1L 4NC2B 3K2UH 3D51A 4BQCA 2AV7A 3MZLB 2JCCE 5AOLA 1R3KA 3HLAA 2VXUH 4NRYB 1SGKA 1LO3H 3AB0C 5J13C 1X5XA 2R9HD 2YXMA 3IXAB 2Q8AL 3EYQC 5CCKL 3RWCA 4HHGA 4U6HB 4GUCA 4Q58C 3OQRA 1RERA 4Q9BA 3F01A 3TCLB 4HJ1A 2FJGB 4XN8A 2BIHA 5KVFL 3NFNB 5F9JB 1AD9B 1YYCA 4PSRA 4ANXA 2MCG1 1ZHBA 1FAKT 2HPTA 3GSXB 2IO5A 5KAQG 1MPAL 4MXQC 4NQWA 4APQA 3GI9L 3SJVB 4EN3D 1EXHA 1D7DA 4BH7B 4I48A 1PW3A 3IXTA 1DJSA 3QWRD 1SVCP 3V0DA 4H40A 4UINL 1G6VK 1UT1A 3EHQA 3EOTH 2ENJA 1FLRL 4U0RB 3WI9A 2DAVA 1PEWA 3FRPG 2TLIA 1K2DA 4PVLA 4PJXA 4H1LB 3FCTB 2F9BT 1PJWA 2Z35A 1ZDSA 2L7EA 4NUJB 3SZKC 4Y5YB 3QXDA 5LCVA 4L4VA 1X7QB 4FEIA 1IM3A 5CJQH 3RBGA 3CXDL 2I5YH 3RTLA 1PTZA 4AXWB 1EAPA 1S9XB 3QB7C 3QAZB 1ZV2A 4G9FA 4S1QH 2B7DT 3TH2T 4BFIB 3IAGC 4IKIA 1S0PA 1IU1A 1K6QL 1OWOA 3SE4A 3ARQA 4AJWA 3VXTB 3ZDZF 2QJDA 2WKOA 3O2DA 5DC0A 3AT9A 4FQHB 1H8OA 1KT2A 4G1EA 4RDQG 1BIIB 4TXRA 5B22A 2K1MA 3SPHA 4TQEH 4K7PL 2NXPA 2WD0A 1LILA 1I53A 2BW5A 2VAAB 3VI3F 4Q74A 4ZTOL 1Q38A 4E42A 3TXMA 3ZYOA 4UQBA 1FNGB 3D52A 2V0PA 2WINA 4BH8A 4DVRL 3L08A 2BOLA 3NIGF 1J05A 3P11H 3ECBB 4UV7L 3RFZB 3MSAA 4L9DA 2GFBB 4KY1H 2ZOKA 3EGXB 1F11B 5KYUB 4MX7A 4Y4FA 2BSEA 3RVUC 1ZS8B 5E2TH 1QSFE 3AWEA 2JELH 4HIEB 4QYAA 4QRAA 5D1XB 1KGCE 1S7RB 4PJAE 3ZHEA 5CZVH 4BIKA 3FJTA 3JVGC 1HE8A 1X4XA 4L05A 3ATBA 3TBSA 3FTXA 3GYZA 5GRVL 5JIKA 2P8PB 3BCDA 4R2GD 2GTZA 2BSDA 4BFBD 4FA8A 3PQYE 1LO5A 5D1QB 3EYFB 2W65A 1NOLA 2WVTA 1AS6A 3HI6L 2ZCKL 2R56L 4DUXA 2VDKH 1VFAA 2G0KA 4HUWA 5CCHE 4HRNA 3DLQR 1NEZB 1J1OL 2VSKB 4FRWA 4OCXH 3HE7C 4HULB 4WW2F 1MJ8L 3QS2A 3OJ2C 2PQNA 4ZI8A 1CTMA 3ELAT 1DO6A 3FO9B 4G11A 3V79C 5LO7A 1FFTB 1NL0H 2F54E 2X9YA 4QT5B 4QRRA 2APBA 5LQBL 2X53A 3U64A 3H7BA 4K4KA 2APFA 2KM4A 4YWGL 4X4XA 2EE3A 5KNGA 2A0LC 1E5BA 3D08A 2GSGB 1YMMB 2FTAA 1QFPA 2JLPA 3Q2NA 3HZKA 2DQ6A 4QDGA 3C5ZB 4GQZA 4WWNA 2I27N 3LN9A 4N3CA 3IGAB 2VISB 3X3GH 4KFMA 2K3TA 4K3DH 3NCBB 4FQIL 2DM4A 2ID5A 2L9BA 1NCTA 5B1JC 1BQHA 1TZHA 3NCJL 1ZT4B 3MNVA 2MKWA 3TIDB 1NCAH 2VXVL 3S7DA 2ZAIA 1AIFA 4KOCA 1HFUA 4OD3H 1TYEB 4EJ1C 4ZFFA 1PVHA 2ALAA 1T20B 1WA2X 4AC4A 1SJHB 1T4WA 4FJZA 4N3AA 1SLVA 4MCYB 3LPWA 2BVQB 1WAO1 1OD9A 3V6BR 1FV1B 4NCDA 1SA4A 2VLLB 4A37A 5C8JA 4P23D 4B52A 1OD7A 2Z92A 4IDJH 1MQSA 3WGUB 4JL0A 4Y6CA 4MD5B 1KS7A 1QI3A 1AG0A 4D91A 1S5HB 3MRHB 3ROLB 1N6QL 3R7QA 5FYLL 1T3FA 4EN3A 5E70A 1RIUL 5C97A 2FO8A 3CTTA 2QL1A 3GMOB 4WDIA 3WFBH 3QWRA 2PP9A 1CTOA 1G7QB 4QTIL 4U63A 2XVGA 2QADC 4U1NB 1RD6A 2YEZB 4GP4B 2HVKA 3RL1A 1MHQA 2BOBB 3SQOH 1OM9A 3UAJC 2AJAA 2C9RA 4HUXB 2X6IA 3TBBA 2WXIA 3Q44A 12E8H 3QFJB 4HWBH 2LU4A 4YE4H 3VFSA 5K9OB 2A83B 2QKSA 1JWSB 5C0AB 3ZSSA 4F7TB 1ETA1 4AITA 3ULUC 1ORSB 2DBJA 5JQ6L 3QQ4A 1AG6A 4ODXA 4KJYB 4OAWB 1QSEB 2WTRB 5EIIB 4Z0XA 2C9QA 3TWUA 3I50H 2NRDA 2BRRL 2EO1A 4J8QA 1A7NH 2ZUXA 4HPYL 3OKKB 3QDMB 2GRRB 2YPKB 4I6EA 3F65A 1MCOL 3GI8H 2FECL 2G75A 3MOAL 4UQZA 1MCSA 2J8UE 3D4GA 4GRMA 4L29A 4CN4A 2CIIB 3HN8A 3DURA 5DQJB 2BXYA 1JV2B 1UG3A 5FKPA 2EIME 4JB9H 1WICA 2FL5B 3HUJF 4N26A 2IDSA 5AW5B 4HWZB 3QULA 3PLYA 4GW5B 2FGWL 4GZ5A 3HS9A 3RZCC 2PYED 5E9DE 5EX3A 1FL3A 3LMJL 5DLML 3ZHLA 5ID1B 1MCWM 4IBVA 4HKZB 1J12A 3UTTD 2RALA 4RZKA 3VFGH 5IW3A 4LLVA 3ASFA 1R5VB 2PN5A 3FV4A 2G2NA 4ONFL 5CGYC 4KJWC 1H3PH 4QYOA 2CUHA 5IFHL 2ATPA 1RJLA 2R1WA 3FRPA 1YZZA 3BPNC 1Y18B 3FF8A 4NN7B 4NO3A 3WQQA 3RPIB 3LKSA 1D5ZA 4H8UA 1QWUA 2GVYA 3QWPA 5BQ7A 3NOIA 3MSNA 2PCFB 3DX8A 1D7FA 2GY5A 3KXFD 2YAPA 1TF4A 4OVVA 1EF1C 3TEYA 4Y7OC 4XP9L 4QEGA 3IEGA 4IJ3C 3NQKA 4KKQA 1X5AA 2R4RL 1JUFA 4A1GA 3HC4H 3O41A 2C0LA 4NFDA 4B9GA 4S0SD 3AABA 4JGUA 4FQQB 1FJ1A 1X7TA 2C26A 5A2LH 3U2SA 1XCWA 1DLHB 4IN3B 4NQSB 4URKA 3SE3A 3H9HB 3MJWA 3TBCA 5FO9B 5KBAA 3H0TA 3KPRD 4Y5VB 2DKSA 3CU1A 2X89D 4B41A 3QUMA 2LU5A 4UI9K 2QGEA 3O6LH 5F7MC 5L6YL 3P30H 3QR0A 1A5EA 3L4TA 1KFAH 3CVHL 2E9GA 2HJFB 4R7XA 5I16B 1CDYA 1FGNH 4U3SB 5IROC 3SPCA 1SEQH 2V7HB 5HVWA 4J8EA 3V0JA 4Y4HD 2HTLD 1EZVX 3PV7A 3QO0A 5F0LB 1FNSL 1PX4A 1OF2A 5AYUL 4UTBA 1ET7A 3G6JA 4DN3L 5KSVB 1XGYL 1F2QA 5JIIA 3AS1A 4N1EA 5MHSE 3KYOB 4EN2A 5IT2L 5JUEH 5F1SA 4OZGA 2XY1A 2ZUQB 1F90H 3HG1A 5D1ZI 3FN0H 2OXHA 4Y2DC 4UDUB 5IOKA 3BN9C 3DPBB 3A23A 5C0GB 4IOSD 4D8PA 1X5JA 2LLLA 1YY8B 1H3XA 1ITCA 3CH1A 5AAOA 5CZXC 1OAUH 4LCTA 3CSGA 3QARA 3QNYB 5T33L 3CH8A 2FNBA 4Q52A 2CM6A 3LXUX 1AD0A 1WCBA 1NDGA 1S46A 5SWSE 1CWVA 4IRUA 4P23A 2F0CA 1OO2A 2NTFA 5K7TA 4L8SC 4XVJL 4YDJA 2H6FA 4KVNH 1MRDL 1E5UI 4L3EE 2OW7A 5D6CA 1UJ3A 4AL8L 4ZSOB 3GWJA 1Y0LA 1Z6TA 1MFDL 4K8RD 1NGZB 1Z0NA 2F5AL 3SYOA 1FFNA 3FO2A 4LP5A 4W9ZA 3T8DA 1UM4L 1BMWA 2X4OB 3BIAX 3SFZA 4ACKA 1ASOA 3VYNA 2NR6C 4DCQB 1N12A 1RP9A 3CQFA 4X6FB 1GS7A 1IM9D 2JMRA 1U4EA 4HUNB 3GXDA 3KLQA 4R4BB 5TTRA 1BFOB 1SQ2N 2QZ5A 1J87A 1H3LA 3JXAA 3JTSB 1L4IA 5AKRA 2WLYA 3HNSH 2Y7SA 2UXTA 4NZTH 5LN8A 1RMFH 1R19A 3HZ3A 4ELMF 3AG1E 2JJSC 4I43A 1S7SB 3QZPA 4BM7A 3DMMC 2EDWA 5C07B 3CQGB 3MRGB 3EIQC 2KATA 1A4JA 1E9PB 5DMGC 2P52A 3C60B 4K3GA 5F96L 5F44A 1LK2B 4TLNA 3ZRCC 2VKWA 4GG6B 1BWWA 2AABH 1RPQA 4CCAA 2APWA 4X5WA 2YGOA 3DVFA 5BZWA 2OZ4A 2NXZC 4Y2NA 5DJ8B 1A21A 2Q5BA 1N0XL 1EQWA 1UXSA 1XF2B 1ADQA 1I3UA 2PYEA 1MW1A 1ZE3C 1A6WH 3EJQA 4DGYL 1DFXA 4NPKA 4L1SA 1T4KA 1O7SA 3UTTA 4PUBL 5F7YC 4P9HL 4O2CB 5K39B 3VQMA 5D7JC 4WJKB 2OR8A 3MRIA 4BERA 5FO8A 1HHIB 5J89A 2AXZA 2BUGA 3LIZA 3UFIA 3CQCB 1VESA 4WI3A 1I1AD 5HRYA 1Z9PA 3ZE0E 1EHLH 3WFCH 1TTFA 4V1DB 4D0DB 4N5ED 2P28B 4U8VD 1BQLH 1T1XB 1UXMA 2IFUA 3VGBA 3T2OA 3KXFA 3UTSE 5IMMA 2ENQA 2YBRB 4NZFA 4UU9B 3VXUE 1JPGB 4NQEE 5DDHA 4BDVA 2FX9H 1BEXA 2Z8SA 3BQUC 4HFUL 4OUUA 2ZXDA 3RNQA 4AYBA 5E6IB 3EOAA 2Z31B 4O60A 4JN2A 4N8CL 3DA0A 1C08B 4HPHA 4GS7C 1QBML 5FUCC 3GHBH 1KIUA 4OCYL 2JTDA 2L7QA 1UACL 2JK5B 3T2LA 4KOBA 3QDHA 2DLGA 3WN6A 4UTAH 3KPRA 4JPSA 3LB6C 5ABZA 2X89A 3WTXA 2XUWA 1P5VB 3LQAH 3VWKD 4TL5A 3PHOA 2GBVA 2QPEB 3T74A 2ZGDA 5JBIA 4PJ5D 1MY7A 2WZPD 5CJBA 4DGVH 3NRQA 2Y1FA 1S2EA 4YHLH 2E2EA 1KIQB 1TR4A 4Y4HA 3TA3B 2PR4H 3TIEA 2NY6C 4PREB 1KXQA 4B8CB 1TRLA 3L3HB 4MNHA 5HD8C 1A1OA 1NGQL 4YN3A 5HJGA 4QCIA 1PX8A 1SA5A 4JO4H 2NSXA 2VGXA 3VFTA 4JQVA 4ZX5A 4ICWA 2NW2A 1JZIA 3Q9QA 2WXFA 4GSXA 4F1SA 4IKNA 3IPFA 5IQLA 3L5WB 5IQ9A 3RWGB 1NZNA 4OM1L 1GL4B 4IOSA 3MFFB 2XKSA 5F6IC 2DLIA 3T4AB 1U0QA 3H4FA 4LVNC 4A6YA 5B7EA 2DMBA 5E6ZA 1ZLWK 2UZXB 5SX5H 1DBMH 1OAKL 4LQFL 4EPZA 3T0DA 1F2XK 3MV9D 1CG9B 4LGPB 4L37B 4PAZA 2R0WL 4X5QA 3ZYLA 2UXFA 5KG9B 4KK6C 4R8WH 2O5ZH 3M46A 4HZLB 1EFXD 4XOBA 1AGCA 3E80A 1FPTL 1WC7A 3DSFL 4OGXH 4YSDA 3KPQB 2K8QA 2Z4QA 4PJ7E 1OTSC 4OZFH 4JGMA 4NBYB 3F8UB 2XVLA 4R0LC 4NNPL 3ULUF 1JV5A 1CVSC 1Z5HA 2RFAA 4PJ9A 3KPPA 3O81A 1INQA 3ZYJA 5C0DB 5TMNE 1YEKH 2BXZA 3PGCB 3QUXC 5JW4N 5EEUA 5L0QC 3SGKA 2P42B 4LLDB 4F92B 3CVHB 1MZYA 4JQIA 4YBQC 4YMPA 2V4HC 3NYKA 5B4MC 1F8TL 1FGVH 1XF3A 4PRHB 3RA7H 2ZT9C 4BINA 4TLKA 2AKRA 3PEUB 3RSEG 1IM9A 3GMMA 1AJ7L 4N3UA 4H8WC 1DSWA 4PJIB 4Z7VF 4OQTA 1CF8H 4NXKA 4MAZA 4F3VA 1AXSB 5EO9A 2OSWA 4Y9EA 4PRIE 4GUOA 1TCMA 5IG7A 3NJVA 2ETCA 2ZIRA 3CHOA 1JPFA 2HFFB 2J73A 4NWUH 5GJSL 3JWDC 1VKXB 3I3DA 2EABA 1TZOA 3FWVA 3TGXA 3FCQA 4I9CA 4A7GA 1A7BA 3MO1A 1AWCB 4KI5E 2XIBA 2UWEB 1LD9A 2O5XH 4FMFA 3ZYIA 3IJ9A 5EBLA 3MYVA 1L0QA 1TFHA 4WTQA 5DRXA 5KJRH 1AZBA 5AD0A 2ZKHH 4OY9A 1ECZA 5CMAA 1KB5H 1KC5L 4JDZB 4XNDA 2FULA 3Q47B 1L0XA 1UYWL 2Q7NA 1GIGH 4M8QA 4PLJD 4TSAL 5GIRB 4PLKD 3VJ6A 1S9WA 4KKZA 3S7FA 2DD8L 2D9QB 2W38A 3HRZA 1UJKA 3X3FL 4JK0D 5BW7C 1MX4A 5ANMB 3RZWA 2CFZA 3CFUA 1HIMH 3IAPA 3VXSB 4BTAA 1PMYA 3BG0B 1I1AA 1KUMA 2XCMC 4GFTB 1TLPE 4XNUL 5KS9E 3HS8A 4U07A 2X4UA 2OV0A 5D7SL 3DTUB 5B1BE 1C9SA 5TDNA 5JPMB 5I8KH 5EU5B 5H94A 3T6ZA 5CFAA 4JANB 5IHHA 1I4FB 3NIDE 4RMUA 3FUKA 5DS2A 4YS4A 3UTMA 3CN1A 3I6KA 1KCUH 4Y6RA 1TNYA 3S7GA 5HP5A 2R03A 2BY2A 1FE8L 1UGKA 2VQ1B 2B61A 5JDJA 1MCIA 4FTVD 4XMPL 5DT1H 4CADB 3TBTA 4JGJA 1NCBL 2UYLA 5EZIL 5TQ2L 3SDYL 4G5AA 4P5MA 2NNFA 3E8VA 3L5HA 3E4BA 3NAAH 1OAJA 4KH9A 4P5KA 2WIIA 4CC0A 4ELKA 2R2BB 4PJDF 2DTSA 4U1MA 5LBSH 3TH3T 5HHVL 1BZDA 1XH2A 4ZYKB 3VWKA 4HQQL 3QH3A 3ZRHA 4N0FB 1IGTA 4H2CA 4NKOA 5BNXD 4XEIG 4GW4B 2NMSA 3EH4B 4NO5A 1Z5SC 2WZPA 1DCEA 1U8OA 4M5ZL 4E5XG 4AICA 2E9JA 3A67H 3EFOB 2H2SD 2P1YA 1P69B 3V4PB 3IKKA 4LPYA 1PKQE 1VLXA 4N5CA 1F3JB 3DPYA 2VH5L 3CLEH 3JV4A 1WAAE 3TBWA 2DQEL 1EHNA 3CFMA 3V4VA 4O5LL 3DGCR 5TQ0L 5FYJL 1UXLA 4E68A 2PQRA 4DW2H 1E42A 5JR1H 4L4TE 4ATZD 3HHSB 3O6MH 2XN9D 3OG4B 3PGFH 3EADA 2IFGA 2PCPB 2BIMA 2EYSA 2P5PA 2RFXB 3NSXA 1WDYA 4PTTA 4QRSB 1KJPA 1GMIA 4WSJA 2VSXE 3FUEA 2F1AA 4ODBD 2LLGA 3VGHA 5IMOB 1IAKA 3OGCA 5I66B 3NA4A 1FYHB 4NFCA 5I71C 2GPZA 1MFEL 2VIRA 4JM2D 2G9HA 4OLVH 2PMZA 1FC2D 1DSFH 1MF2L 3MV9A 2X4SA 1YMHB 4G8IB 2BNQD 2BEDA 1UA3A 1I9JL 4FE9A 3UBXI 1JPSH 3DX1A 2YPLE 4LOUC 4YQXL 1EFXA 4L1TA 3RLSA 4A38A 1HILB 3ARYA 4S0HA 3IETB 3T08A 1PY1A 1BQ5A 1NMBL 4YBLB 2Q10A 4PTUB 3QUGA 3RUGA 2IBZX 3PWVA 1RUAL 1GVIA 4CSPA 3IIEA 3PE3A 2HFGL 1RIHH 5DYFA 2OCJA 4Z3EA 1Z9LA 2JKRM 1F4WH 2OXGA 5I6LA 3AW5A 2F8XC 1CDBA 4DUIA 3LXBA 2HUHA 1L5JA 5T3XH 2EE9A 2XG5A 1YNTF 2ZNXA 1JGVH 3W2DL 3D33A 3QJHA 15C8L 3ULQA 1MRCL 5T3XE 4UMSA 4AH2B 3GNML 4WNEA 4F7MA 1G43A 5KSBF 1RXLA 3VRJA 5JNYA 4U1GC 4C56E 2BFGA 4HC1H 4XMKL 5LG6A 1RVFL 4NUPA 1D9KD 1BD2B 1XGRA 1U3HD 4NAQA 3Q1SL 4XNMA 2I9TB 4XP1H 1SDYA 4MVBC 2DY2A 4C8XA 5KYYA 5IJDC 2K3HA 4OCSL 4ZD3L 1UZGA 4OB5H 4WUYA 1CC3A 2FK9A 4GRLD 1MWOA 3V0FA 1A7QL 4NM4H 1CD1B 1J0JA 2WBJD 3A3YB 4H26A 3TT1L 5KYWB 2YXWA 2BS71 4QUOA 1VFBB 3GJEA 1MFMA 1MZCA 4J3OG 3V31A 2WLHA 3S96B 4FQ2H 3Q6GL 4RGND 1I1FA 1YYLL 1OSPH 2PL2A 1EV2E 2QJ1A 1RZKC 1T2JA 4HWNA 5BW8C 2Z8WC 3MV7D 4XIFA 5FQ8A 4ONGL 4N9OB 4N2CA 4OD1L 4PGCA 1B0RB 2DQHH 4HS8H 3DHUA 1TO4A 4G7VH 4FP8L 3S3SA 1OCCE 1TPXB 4LSVH 3RQ3A 4K71B 1SW6A 5C0BD 1SN0A 1KY6A 4WNSA 1L9MA 3AU8A 1OGTB 5L4IA 3DIVA 3LKUA 1M7DB 4JFWA 1U2YA 4IOFD 3GXFA 2XZQH 3SD5A 2UVEA 2GJ6E 1J0YA 3VDCA 5EOCJ 4J1UB 4Z7OB 4H20L 3FN9A 4EUPB 2DWXA 2V17H 3QRGL 4JNXA 5DBKA 2YXFA 3WNJA 1MCPH 2G30A 5GZNC 4FTVA 3SE8L 1NBYB 3CFQA 5JZ7D 1TZGH 1NMAH 2BWQA 1QBQA 1YMPA 4LESA 1D6VL 1PJ9A 4RRPG 4ZJ9A 4LASH 3ULUE 3MV8D 2AI0L 4CW1B 1DQQB 3PREA 3TPKA 2NY4D 1H3UA 3HC0A 4KK9D 3QPXL 2Q6WB 3FQXA 3RY5A 4JA7A 4UQ2A 4J3OD 4YO0B 4ANWA 3ULSA 5F9OL 1BYPA 4UB0L 2I1KA 4PJBE 1U9KA 2HAZA 1OCOB 1UKQA 2P8MB 2DJUA 4Z7VE 1NKOA 3VFWA 1A3LH 3VSVA 1QTPA 3F28A 1IGIL 1MFCH 3L5IA 4M5YL 2DV6A 4LEUA 4Q0XH 4CDRA 4KRNA 3LPGA 3ZHYA 2X6HA 1OLZA 4ISVB 3IDXH 1DVXA 4P3CH 3E30A 4ME2A 3TNMA 3W57A 3IPBA 2AS5M 4Y1AB 5DU7A 2IJGX 8TLIA 3WE6A 3S4SG 3ECQA 4PS3A 1QO3B 5F3HB 2WAHA 1FYTE 1ZANL 3D2UB 5DVPA 2VR7A 1ZHLA 4QJ4B 2QSTA 2Y2TA 4F7CA 3MJ7B 3ESVF 2N0MA 2H3NA 4P5RA 4JKPL 4JM2A 2JJWA 1EWHA 4OD2A 1IBZA 2WWKT 2B0OE 5CUSL 4AUUA 3STZB 1IFGA 3ILQC 1AGFB 3QORD 1E7UA 5CJ5A 4X7SL 3LPZA 4JN1L 1QPKA 2JH2A 2QTEA 2FAUA 3DVGB 3QI9D 4BJLA 3QNFA 1JUQA 2O61A 1GS6X 3QPQC 4QXTA 4Q2ZB 4ANUA 3VFRA 5JMWA 4I0PC 1RL1A 5AW3B 2V2WB 5C0JA 1A47A 4HOMA 3FT3B 5DRWA 4E5XA 5HHME 1HQRA 1A4AA 1PLCA 4G8FB 4CA4A 2DWYA 1VA9A 4UM9B 1CDCA 3WKNA 2MWCA 1K5WA 1A5FH 5DCCA 3P4NA 5EWIL 1TQTA 2EIBA 3VRIA 3SHSA 3PXJA 1MHCB 3PJNA 4LNRB 5BVPL 5MEQA 3UT7A 5BPPA 3CVQA 4LSPL 1TIUA 3L7EA 3VD7A 2P45B 4U7SA 4U8HA 5FKAB 3GRWL 5C0CD 4MA8L 4QXUH 3NTCH 3D3VB 3OGOE 3BEWB 4OGYH 2R0ZL 3BE1H 3RGHA 3T0VA 4RFNC 1PAQA 2IQAB 5IMKA 3CK8A 1D9KA 1ZHKB 2RIKA 1AQDA 3DEOA 2Y5TA 3HLKA 3ILPA 2B77A 4HA1A 4PWHA 5AKSA 2NQCA 2ODIA 1WGOA 3PWUA 4MZRA 3ASNB 3LEVH 1TNUA 2WO2B 4MRBA 4NO0D 3VMNA 4GRLA 3CVIL 3L1OL 1BVKB 4Z76A 3OX8B 3DX6A 3SZ6A 4IOIB 4AYID 2WBJA 3CPLA 4N2KA 2XZDG 1KEGH 4JZYA 4PFEA 2CHZA 1HZ4A 2H45A 4J6RH 2BC4B 4MGXA 4ZS7H 2XWDA 1NAML 5AZ2H 3G5VB 2OYLA 3FHAA 3MV7A 5KVEH 3B34A 2XA3A 2C1OA 2JJUA 4U1JB 2KPNA 1OB1A 1IJ9A 1ZPLA 2IDCA 2OMVA 2PETA 4P46D 1P53A 1VERA 3GSWA 4GKZB 5E6UB 5DJAB 2H0EA 5HLTA 2YSTA 3O2DH 5C0BA 5EUKA 2CO1A 4NENB 4ZFGH 5DVKA 1O1TA 1ZTMA 1MHEA 1ND0A 3DV4B 2EP6A 3UTQB 3BDXA 2YFNA 5GS1B 1TJGH 4YZFE 4YZWA 1IJNA 4PBDA 3DRQB 3HN3A 5ALBH 1XIWC 3FFDB 4ZS6C 4XPGL 5DHVB 1AGBA 4JZNA 5ESQA 4G8EA 3NIFB 4OF6A 3SDCD 3Q7AA 1I8MB 2G4ZA 3NZHL 4UBDD 2YMXH 3S37L 1XHHA 4WFEE 2C3VB 5E99L 5I1EH 5IVXB 5LWYH 3BZDA 4G1MB 5JOPD 4NKIL 1FN4A 2GBAA 2ZF8A 4F37F 5F3FA 2H8PB 3MLZL 5IJVA 2ITDB 1NZRA 4NPJA 3HKFA 3DJSA 1U8PA 1U8KB 2VDNL 3O3BA 3LJNA 2AJSL 3CDGA 2J5LB 5MEOB 1RUKH 4RLDA 1WIOA 4Y1TA 4PJ8B 4J2QA 5E4EB 5EBWB 4GMJA 3M1BB 3L9EA 1NJ9B 3ZR5A 2GW5A 4KT6B 3L45A 5KSBE 1G7PB 1Q9OA 3T77B 4M7KL 2L3BA 4PB9H 2QYUA 2VRQA 4HH8A 5FFOA 2YMTA 1P4BH 1PZ5B 3BRDA 3O9WB 4PJEA 2CGZA 4F7KA 4JGNA 3B9KD 3DSWA 4PJFA 2Y07L 4EI0A 3C98A 5HPMB 2XX0A 1JFQL 3RJVA 2XYCA 1X9LA 3ZT5A 4C59B 4P5TB 3V0IA 2H6HA 4ERSH 5EZLB 1MKFA 3AU5A 4K3EH 4RRPA 2JWYA 5JYLA 1FVDA 3VG9B 2BP5M 4M7ZB 2FATL 3QORA 2JB6B 1EMTH 2N1TE 4S1DC 2R1YB 5HYJD 2D0FA 2EVIA 8FABA 1XV8A 4WI0B 2LXMA 1KTBA 1RZ7H 3QI9A 2IMMA 5HJBA 3WIHA 3WIIH 4FTDA 3S88H 3M17A 5EN3A 1XCXA 3ROOB 1XVSA 5DHDA 1BI8B 4DSYA 3B37A 3CFCH 4EIZC 4XOCA 5B1KA 4UUCA 2ZSWB 2JKSA 1EUUA 1A7OL 4BFJA 4F7AA 4WHYH 5TPWL 1D2PA 1T04B 3P2TA 1S7QA 5AW1B 4L9LC 2GRNB 1J0KA 4GLRI 2DM7A 4E41E 4E9VA 4WNGA 3O4LE 3AM8A 4GAJL 3K0WA 3SSBA 1GMEA 4UDTB 5C0CA 4FHKA 1J8RA 43C9A 3QIBC 5F93C 3S4SA 4V2BA 3CUPA 2KI6A 2PW2A 3PJSA 4LEOB 1LEIB 3A47A 4BY6A 2ED8A 1T89A 2VTFA 5T1LD 2H3KA 3KYNA 1BZ9B 2OMWB 3CVWA 3LKOA 3UPAA 1OTTD 5D4HA 4JMNA 2Y5QA 4O58L 3EGSB 2BHYA 4NO0A 1JI1A 1TTAA 1O6SA 4AQ1A 2NTSP 4U6XB 4HX1A 1FAIL 1LP9F 4YX2H 2G9KA 1D5MB 1NCJA 3A22A 2QBWA 1UZ6E 2EKSB 3RAJH 1KZOA 1RK1A 1PD6A 3Q7JA 1CICC 3F12A 4OZHE 3RGVC 3TEZA 4M48L 3ECWA 2CU9A 3EW3B 3E6HA 3AQXA 4EKJA 1H8SA 2YOAA 3MRRB 1X5ZA 4G6FD 1Q0QA 1BPOA 1X9UA 1FF5A 4FNLH 1OEZW 4N5PE 4UCFA 4Q6IB 1WM5A 4UNVA 4P46A 2J56A 2Y0BG 4JJ5A 2A77H 1ETZA 4S1SL 2PW1B 1FSKB 1LL1A 4TUOA 4W6YB 5I1IL 4AZ8A 5MP6L 1BI7B 5IEHA 3QO1B 5C6PB 4XMVA 1XF5B 5E2UH 5DJXA 3EKCA 4U05A 3IDJB 5TE6H 1BLNA 3JWOH 1DO5A 3GBML 3CSYB 3IFLL 3QRLA 4DTGH 1GOHA 5ISZD 4F2MA 1HINH 3MRMA 2VDLB 2E0IA 3OMIB 3SDCA 4JX0A 4YDNA 1WUNT 3HI1A 5D2NC 1S8DB 2J49A 1P7HL 2B39A 5EMYA 1YEGH 5T1MB 1KPUB 3BWAB 3FUDA 2FX7H 4WNJA 4N4EE 1KJMA 3IRPX 5FYKH 3UKUG 3C6LB 3ZX1A 5LVEA 4YGVB 2DQTH 2G5RA 3L13A 1GR7A 5AWNH 3LY9A 4XX1G 3BAEH 3G2SA 5CHNA 3T0EE 4GO8A 5HDQH 5FYKE 4MAUH 3TWSA 4XBEH 1PY0A 5JOFB 1DN2A 1IEBA 4U0UA 3FQWA 5I74C 4BUGA 3G08B 2J57A 3B9VA 2J6WA 4PRDB 4BCXA 3KPSD 4Q9QH 1CYWA 1J48A 1G0XA 1G7JB 1KTDA 4XWGL 5F97E 4Z0BL 1BGXL 3HMWL 1IFHL 2WWMD 3BEVB 3CKCA 4FFWC 2H3XC 2XQBL 2HN7A 4XPHH 5J9PB 1A1MB 2MAPA 1P9MC 1NAMB 4K9EC 4S0TD 2VDPL 4WK0B 5L2KE 1CLVA 5AAMA 4NC0B 3QIUB 2F19L 2WBWB 5GZOD 3RNKB 5DK2A 3TN0D 3K71A 2J12B 4CMHC 4OFQA 3I85A 1E9OB 2VLAA 3B9KA 3WV0A 2KL6A 3OZ9H 1H6TA 3VVWA 1H9VA 5DRNB 3RX7A 4OTXL 3OL2A 5JDSA 4LFHG 1ZAGA 4UM8A 5EOCH 4LBEA 3ARED 4MMZC 2X09A 3ARBD 4YDLB 5HGAA 3HW2A 4G7YH 1P0SE 4X9BA 2IAMD 4XTRC 3KD7A 4WWPA 4ZQKA 5INDB 4FFVD 3U4TA 2FIKA 5HYJA 5DEGA 4N2HA 4MXJE 4EVNA 5C92A 4YSOA 5HHPB 1YEHH 2DEXX 5CFHA 3PL6B 1W0VA 3L3IB 1EANA 3LQAC 3FEYA 3D2TA 3FHQA 1FLTX 2A4CA 4OLXH 1ZEAH 1SZNA 4PV8A 2PCYA 1M05B 2NLJB 5HDBF 1OM3L 4S2SB 4E9QA 1R75A 2V2TB 2Z0BA 2WLIA 3QUYD 1Q9KB 2J8UB 5I9QB 1TJIL 3NFSH 4X6CE 5T3ZL 4U6TA 1YEEL 4HUKB 2DBLL 4OZ4B 2EIMB 4BZ2A 2VCOA 3CVUA 4IHQA 1JG9A 1XH0A 4P4KD 2CHWA 1OE3A 4JZJB 3SYCA 3FQRA 3QWNA 5SWZD 4W1TA 4IRSB 4ZUSB 1B4RA 4WV1B 3EO9L 4IEFA 2X0VA 4KK8D 3RVTD 3T6QC 5K1JA 1YEJH 3PFUA 3SODB 2AJZB 1YEWA 3UTZB 3V5HA 4F1PA 1HHJA 2MOGA 4MB3A 3EGDA 3ZDYE 5T1LA 3NSDA 4Z95L 5LXGL 4LFHD 3L5XH 5GQBA 3QSKB 3UM1A 2QVKA 3O45A 4LXFA 1EZLA 3VE0A 2R39A 4U3HA 4XVTH 1H6UA 3ESOA 3FT4A 1CR9L 3ARFB 2ERJC 3U2IA 4O9HH 5JAZA 3L2LA 3QHFH 5H2BA 2KYIA 5FM5O 5HHXH 2R29H 3HAEB 4KUCF 5JLZB 2WNKA 3Q2VA 2P5ED 1ED3A 3HS0C 2W07B 4PI2A 5FDWB 1KKKA 2DJ4A 4XH2B 4F9LA 3ULVC 3Q4AB 4P2OD 5JSSE 1HZLA 4KDTC 3UH8A 3FU6A 1QYMA 4RA3A 3TWWA 1L7TL 2MCPH 1AR1B 5IOPB 1RFDL 3I6SA 4I4WA 4IU3A 3SDXA 3V5DA 4C4UA 5GGQL 5F6HI 2BW4A 5T5FH 5E08H 2HO1A 1XGQA 2MKLC 5F3BA 3L3JB 4F33B 2LE9A 3PHAA 4FF9A 3L3DB 1N3NB 4H1LG 4AV5A 1TYRA 3ILEA 3L95B 5TFSL 5JYMA 5I0YA 3ARSA 1FZOA 5B8CC 1U8LB 2CUMA 5ISZA 3GXPA 4A2EA 3O48A 1ADQH 1CUOA 3IFNH 1BXUA 2X87A 3VU1A 3RYMA 1BFTA 2NY1D 35C8H 5CF3A 1WZAA 1EAOA 4YHYC 3FB5A 1WS7A 1IBBA 3O8XD 1X5GA 2IEPA 3RO2A 4EZJA 5HHNA 4EI6A 1AZNA 2E9IA 4DJAA 1THLA 1KELH 1G0YR 2R69L 5KVDL 3ZDZB 1CYXA 1JP5A 1A1NA 1C12A 3KBEA 3ZTCC 3MR9A 2FO1A 4X42A 1ZK9A 2I25N 4MAYD 2P49B 4J3UA 2DH2A 1NOAA 3QNXB 4U1KB 5B3SE 5TGBB 3KPSA 4ZUVA 2AXUA 1KF9B 2AJUH 1IUZA 4X83A 5C0ND 1V54E 5A2BA 3D18A 2OJZL 3L3OC 2D4DA 2LU7A 3RWIA 5ANRA 1JGDB 4YLBA 5I19H 4BETA 2VC2L 4DP7X 3UT4A 2DMCA 3DJRA 2AFNA 3N1MC 5GZOA 1SUJA 3LQZA 3TN0A 4MS6A 5DO2D 2FH8A 2XTJD 5LCWJ 2VRAA 2XJLA 1XD0A 2HCZX 4TVPH 3FTYA 1TVHB 3VTTA 3QAQA 2ADGB 1BYNA 4WWKD 3HYMB 3BUYB 2YARA 4NKDA 1XF1A 3APDA 4TVPE 5FR3A 1DJIA 3S8WA 1AHWA 1KTOA 2K6ZA 3VH8B 1F5WA 3AREA 2FFLA 1TFPA 2ARWA 3ARBA 4CRWA 2FO4A 3DRTB 1X81A 3O2WL 4IYKA 4NRZA 2I7OA 4YDZA 2IAMA 1RURH 2BIPA 1IQWL 1TT6A 1I3RA 4GINA 2HPOA 2XS8A 4LSTH 5D7KD 3ESMA 3MA9H 5LN4A 5FUZL 2A38A 1GAFL 1OSZB 3BVUA 5E2WL 1LE5B 3RC3A 1G7MB 2W0PA 1KBBA 2OMBA 4J6IA 5ENWA 1GJIA 4XVUC 4W9CC 2V9TA 2OBGA 3Q78A 1I7TB 2AEWA 5EU6D 3AS4A 1SXSA 3LKQB 3S9DB 3O0RL 3QUYA 4IRZL 1OWWA 5FK9B 3PDDA 3QZBA 4YXHL 3FPYA 5AARA 2X1OA 1XZ0A 1AXIB 3NCXA 4RFEB 4A6YH 2DF3A 4LIQH 2BP3A 4P4KA 1LHZA 2RJMA 3FU7A 3RVVD 3L6FB 5DMIH 5FF6A 5SWZA 1JAEA 1QRKA 4LIQE 1CBVL 1LNUB 3BKMH 1QBLL 1PG7L 2DWDB 2JNZA 4CU6A 2XEVA 1KLUA 2AMGA 1A65A 5D1XD 3IS0X 4BT9A 4NKMB 5GGTL 1P5UC 3FL7A 4LF3A 5JIDA 3F85A 2Z7ZA 3C6SA 1W16A 1KJ2L 3BSZH 4ZO9A 4XCYB 5FJYA 4IBWA 2NY5C 3VWJB 4OYSA 1JHLH 2WP3T 3I9GL 3KJ4B 5GRUL 2NOYA 1BLXB 4NERA 5EU7C 2IH8A 4K8RH 3ZL4H 3ZE0B 3COOA 3MJ8B 1UOWA 3WNKA 3QEHA 4PB0H 1UCBH 3ZTDC 5E75A 1P7KB 1EXUA 4ONHB 4X8XA 5AVVB 1CMOA 4JQIH 1T83C 2P5EA 1FZJA 3IMVA 4FXTA 4J5VA 3KGUA 1R5WB 4WLCA 1IAOB 1JK9A 1QSZA 4JO2H 5CSZB 3MRCA 3Q0HA 4OIAA 4P2OA 5CXPA 3VXUB 4NQEB 4DEPB 5CNHA 4HIPA 3SO3C 2FX8L 4NQDE 2B1AH 4MMYB 1JVKA 4EOWL 2RG8A 1E4KA 4JS7A 4L9PA 2VR9A 4O1PA 4MA1C 5BJTA 3MOBH 2LHAA 3V55A 1QD0A 3AU1B 4JL2A 2JD0A 4WKXA 1FVHA 4GQPH 3CN3A 3V8OA 1BPLB 5AOIA 2XOTA 4MWPE 3GXMA 3H55A 4KV5F 3F64A 1YMMD 1HXYB 2Y4TA 1NGPL 3FFCE 3GHPA 2G5BB 1NC2B 5EIIG 3J5QB 4O2EB 3SYQA 4LRIC 1M42A 4NZRH 2C0MA 1ZIAA 3D3MA 3ZYKA 4AW4A 3EO0B 3EJYD 1RZJC 3RPBA 1ET8A 3O0LA 3SSGA 2K4WA 3CMOH 4NRYA 2YQ3A 3P4OB 5JHBA 1SYVB 4LU5H 1F4XH 1IGJB 1GYAA 1S6NA 3O8XA 1NDMA 1OCWH 3TCLA 1V3JA 4L3CA 2H7WA 2MH4A 1P1ZA 1I3GH 1CFSB 1MVUB 2FJGA 2R1XB 1DVTA 3A06A 2YGQA 1DE4A 4WNQA 3NFNA 2DQUH 1AD9A 1MIEH 2OQJB 5F9JA 5KANI 1WA1X 3V95A 3WQSB 2DQIH 4LHQB 2JIXB 1XGPB 3B9AA 3SB3A 4AEHH 4FNSA 3D0AA 1FVCB 3EIJA 3SKOB 5ENQD 2QHLA 5BMFH 3CC5A 3HUJB 3MBEC 3RRMB 4QXWA 1NBZB 4PJGF 3ET9F 4ANVA 2WLNA 3U4KA 3DSUA 2Z9TA 1IARB 3FB0A 1MCDA 5D7IE 2MHKA 1QKZH 2Y0SA 3DROB 2JKTM 2IU1A 4LVHB 2EH7L 2JTYA 2X41A 3QFJD 4PGJA 2DIJA 3VW3L 4DPCX 5C0RH 3AT8A 4TXVB 4Z18A 2VZOA 4JFDD 4N0RA 3OC8A 1YEIL 3HEIB 5GGRB 1EDUA 3FT0A 3STLB 4PJ7B 1SVXA 3QGVA 2IDTA 2CKBA 3TZVC 4NUJA 2HT2D 1JL8A 4NN5B 4HXIA 4WWKA 4Y5YA 3HJ0A 4AGOA 5LGJB 1X7QA 4I2WA 1SFDA 4Y4KC 3KZ8A 1UASA 1BSIA 1HAWA 4AY0A 1DBBH 1S9XA 1AH1A 4YPGB 2X7LB 3VM7A 4YIQB 5CCGE 3E9UA 1VGKA 3VXTA 1HEJC 1HK6A 3RJOA 3ETBJ 1INDL 1ASPA 4H13C 1PF3A 5E6YA 1JCSA 4AMXA 3MBXH 1NCGA 4NWTL 4UZSA 3ZE1F 4RIRA 4DF9A 3IMWA 2PL5A 2DB8A 4M62L 4PRIB 5EUOA 3U0PB 4W9JC 1QFWH 2QVMA 2YR3A 3A21A 3ULUL 2P9SG 2I7SA 2IOSA 3KJ6L 5EU6A 5MI0C 1FNGA 3VI4E 3NJMA 5ITBL 2EEXA 3B5HA 5FHBH 5CEZL 5F7DA 3ECBA 4MLSA 1SY6A 2GFBA 1F11A 4AJ0A 3HNVL 2KBGA 2C82A 5I8EA 1TQCC 4FLSA 1Y8MA 1S78D 4MCNA 5J13B 1NCDL 4XPBL 5D1XA 5L88H 1MWAB 1P4LB 1S7RA 1UWGL 5L7XL 2RAMA 4KTDL 1T5XB 4X7FC 3D87B 4J3WA 5E4AA 1QUNB 5BO1L 1EJOL 1W0WB 5IJKA 5J12C 3ML8A 3T9WA 1JF5A 3ULVF 3O3UN 3WJMB 4M56A 4L8DA 3F3HA 2SEBB 1F13A 3IKCB 5B1BB 3KBPA 4HIQA 4ZUTB 5FCUL 2MRYA 4PPTA 3VGDA 4IKJA 2WZ5A 1YYML 4FXKC 4C83B 2BOCB 1EGJH 3N1PC 3F7QA 1G7LA 4I17A 3KWWB 3MRNA 1YEDB 2O6DA 3RI5F 5LUMA 4HUCA 3T0WA 3K81A 3S6CA 3GW4A 5CZRA 1GXWA 2GIXA 2L7JA 4HBDA 1WZKA 4QOKE 3RWFA 2Q86B 1FJVA 3SQRA 3VFMB 1Y6KR 5TF1L 3RIKA 3TJEH 4H8VA 4BZ1H 3W11D 5CJOL 4F20A 4WUUE 1YMMA 4HUVA 4TUKH 4PP1D 4Y8DC 5DD1H 3UP6A 3NN7A 2EVFA 3Q2WA 3SQBB 3CXFA 3MODL 2VISA 2YD0A 3GMLB 4ZBJA 3R8QA 3U9UB 2GI7A 4KRPC 5G04C 4WENB 4YPJA 2ZCLL 3T9KA 4M7JL 3DXAE 3GRBA 4AIXA 3AACA 1U8HB 1ZT4A 4YUEH 5KJKA 1PKQB 1QTYT 4POZD 1DLFL 1AQHA 1OB0A 5ALCH 3DXMG 1D2OA 4ELMB 3ABKE 25C8L 3PG2A 3N43F 4HGWB 4UT9A 3DO1A 2AGJH 2X4PB 1KJ2B 5A3YA 2D3JA 4L4TB 5ERWB 2NSMA 4MCYA 3IJYB 4XZUB 1UG9A 3UTPD 3T8FA 1EBPA 1OS0A 1E5YA 3SPVA 3X12B 1FJQA 1AGDA 3MV3B 1IC5L 3KDMA 3MKQB 4G43B 2AK4D 4LSUL 3TCXA 1C5DA 1S5HA 1G6RH 3MRHA 4F15C 3NCEB 1G3NB 4OVUA 2O30A 3CDZB 4P2AA 4Z3HA 3MUY1 5DTFA 4Z5RA 4KTYA 4M6OL 2XFGB 3ALWA 3OXSA 3UBXB 4U1NA 4OLZL 4YSUA 2YEZA 4RISL 3LNHA 5F7FA 3UXFA 3D06A 1DDHB 4Z23A 2D7PA 3DIFB 4HUXA 3UABA 3JTBA 4KHTL 3QFJA 3O3DB 3H8NA 3VTAA 5K9OA 1JWSA 3HMXH 3SE4C 4JFDA 3V10A 2R05A 1D5IH 1VSCA 4KJYA 4OAWA 5EIIA 3RG1C 4TL4A 5I1DA 2EE2A 2G3XA 1HZHH 3RRUA 3UKRG 4WU7B 2W1NA 3P77A 3FCBA 2EO9A 2NSZA 4TRPH 4XHQA 3OKKA 3N40P 2AEOA 1Y07A 3NRPA 4HXBL 2YPKA 3RILA 3D0VB 4ODHH 4XAKE 1CFVL 4X8CA 3IEAA 5C07D 5C9JB 2B9BA 5BS0D 2ZXQA 1ZBPA 3QKYA 3MDJA 4NQQA 1OAZH 2QQLL 4MNGA 4PJHA 4P57A 4ZPTA 4FADA 4GZDA 2CIIA 4YEEA 2R8SH 1DBKH 2JJVA 3MRKB 2C34A 2DPKA 4KKAC 1ACYL 1WEJL 1SM3H 3BMWA 4HWZA 4C56B 4GW5A 2LV4A 4HIIA 2R70A 1ADWA 4HJTA 4QKXB 4Y4FC 3ECVA 3PABB 4ZX3A 1KBKA 2B6CA 3IPEA 4FG2A 3A5VA 1PZAA 2A9MH 1HQ4B 2IH3B 4HOWA 1O7VA 4GI8A 4HKZA 2YHEA 3AUWB 2UZIL 5EDSA 3S3PA 3WHE1 2EIJE 2ZGGA 4NUMA 4I13B 2FBJL 4X4YA 1HSAB 2IWGA 4NCC1 3RPIA 3Q75A 4OF0A 1Y18A 2E7CA 4OF7A 4OSUL 4EECA 4GSDH 4GRWH 3DOHA 3CKBA 4JG0H 4L0YA 3IJEA 2PCFA 1K85A 3VYPA 4OM0L 3UP1A 1RUQL 4L23A 3CFDA 1HC1A 2EACA 4WKZB 2FYYB 1UWXH 5IB5B 4GRWE 4DEUA 2VJ8A 5DD3L 3AQZA 4K2UH 1IRAY 1AFVL 1CE6B 3DK0A 3DUHA 4X6DF 4F8OA 5LLIC 1ONNA 2JV6A 2WLZA 3KWUA 4GNKB 2GQHA 4FQQA 3P9MB 5E6ID 3UAJD 3FUJA 3IT8D 3TS8A 3GHEL 4KWUA 1B4LA 1ZSDB 3DBXB 5FA3B 3ASOE 1NCWH 4NQSA 3T04D 3PF2A 1WA0X 1NGWB 2BSBA 4ZMYA 3U0TB 1DBAH 4K73A 2GJ6B 4Y5VA 5KOMC 2J1YA 2QADB 1OT4A 3FQUB 3PVLA 1K5NA 4JO1L 3V6FB 3URZA 4YSQA 1E50A 2FEJA 2BTDA 5D9SB 1FP5A 2XWZA 4FG4A 4H8QA 5I30H 5KCMA 4YXKL 4IBSA 1UM5H 2HJFA 4KVCL 4U3SA 3VXOB 3K2KA 4LEXL 1L3WA 3QYCA 1G4MA 4XP5H 5JO5A 5DRZB 3CVBA 1KENL 5D93C 2R9HC 4XMWA 3RKPA 3H3PH 1I8LA 4XCCH 3ZHKA 5A2FA 3MMEB 3LN5B 4XC3L 4BEPA 2MMXA 1XFPA 3BUPA 5IBUB 3CZUB 2XZTG 3ZHZA 1UOLA 2DCPA 4DPRA 2F8OA 4HLZH 4MXVE 2V5FA 4G6AD 1MJ7L 4KDVA 4Z7VB 1JNNL 1KXHA 2Z7UA 2A6KB 3L3KA 2ZXGA 3QCVL 1AI1L 1HWWA 5EO0B 4JEUA 5JIMA 4EN3C 3BFWA 4JR9H 4PMFA 3LEXB 5GS2H 3QNYA 4MB5A 5E1AB 3RIFF 1CZ8H 1URIA 2O5YH 5ETUB 5CGYD 4KJWD 2YAFA 3AAZB 3FSVA 2PNDA 3PAVA 1UW4B 4N2LA 1B6DA 1A6ZA 1S5IH 4UIKH 2LNIA 1FYTB 1VEOA 3BZFB 4MJID 1LWHA 1XDTT 5E8EA 4I18A 2NXYB 2OK0L 3NQZB 1JXDA 1PD1A 4JREC 4XCNB 4DP5X 3D4CA 4LSRL 1F1DA 3GBLA 3BPNB 4ZSOA 2OS7A 3QEUB 3EBAA 1CXFA 3WFEL 1V7ML 3UO1L 4UI9J 3WEXA 4I1NB 2AQ1A 1YJDC 2WXLA 2X1WL 4GBXB 2YQBA 4IBZA 3RK6A 3GJFH 4HEPG 4IHOA 4IJ3B 5A16A 2XN1A 4X6FA 1Q8MA 4NUGL 4KBPA 2ZKYA 3PE4A 1JTOA 1F6AB 2WUBL 3DO3A 1BFOA 3DYMA 1EDHA 3G3LA 2KLSA 1H19A 2ADJA 2XA8L 3JTSA 3JWOC 4NHCH 2ZYRA 4XB3A 4J3OH 5HHMB 5EH1A 3QFGA 5JW4M 2UY7B 3MCLH 2W9LA 3EFDH 2FUQA 1T22B 1TKWB 2CIKA 1S7SA 1RHFA 1KIRB 3BMVA 3I9PA 2DBAA 3C75A 5C07A 1GPOH 5BS0A 1E9PA 3K8MA 5EU3B 2YPVH 3MJ6A 4NT6B 3WJLA 3GXNA 1ZDPE 5KN5A 4GG6A 5AQBA 2F74B 5KTEL 3LHPL 3MS3A 1ZHNB 4TOYL 1OP5H 3N9GH 4IIQA 4K5CA 5FS5A 3F5WB 5DJ8A 7CGTA 2IADA 5I0WA 3BI9X 3IU3B 4G8GD 2H26B 5TLIA 1XF2A 4NN6B 3GGWA 4ZHBA 2VDOL 3A14A 3UBHA 3F84A 1XSJA 3FQNB 4H8WL 4NSKB 1JHTB 2AQSA 5BV7L 3L48A 2IANE 4QRBA 5JHDE 4LOFA 1OHZA 3VLEA 3SGDI 3JWDL 4R2GC 1MCBA 1W72L 5CEXB 3POCA 1F41A 5JXNE 3AUAA 4A63A 2WNWA 3B8SA 3VO0A 4Y2DB 4LLUB 1U4GA 3CJJA 1AE6H 2IPTH 1NCCL 1HXKA 2OMZB 4IBLT 2B59B 5J7CC 3OJMB 3DIDA 4RNRA 4X7TB 1OE1A 3V4UL 3KLHD 2YBRA 4UU9A 1JPGA 1LQSR 1T1SA 3LH2L 4IKLA 5E6IA 5DFWH 4TXPA 4L8SB 3BPOC 4N20A 1C08A 4BFRA 4XC1L 2LFEA 4YHPB 5AW6B 4O02H 1UM6L 2OCCE 3FT1A 1U21A 3WN5B 5JA8B 3O3EB 3M88A 2C7UB 4WO0A 1O7DC 1ERNA 3FO1B 4JFVA 4ZQGA 2QR0B 4LBAA 3S34H 2KHAA 1P5VA 1E43A 3HBQA 4CKVX 6PCYA 1Q9WA 1N4RA 2KMWA 2OMUB 1G5AA 3GZ1A 2KQNA 1HS6A 2EYTB 4JRLA 3LH8A 2YD7A 1OL0A 1MCEA 3QNZB 4Z3GA 2W59A 5I0VA 2GUOB 1N64H 2J20A 1Q72H 3TWRA 2VLKE 3WEMA 4Y19D 5EILA 4QHNA 4Z7IA 4PREA 3WKMH 3L3HA 4I87A 4ZFOB 5G4OA 2GTQA 3G9VA 2BIQA 3P0YL 2J8HA 5IW1A 4I77L 3DMMB 3MNDA 3R0IA 1HXMB 2MPAH 4P23C 5CEDB 3D9LA 3RWGA 4X4MA 1X5YA 3EFFB 2W60A 2J71A 4JHWL 5KSBB 4AJVA 1QLRB 2YJQA 2VDRB 4U7EB 3MAWA 4Z8FH 4PJXF 1ZT7B 3BEEA 5D7JD 4D9QD 4R5VA 1QRNB 1UJ3C 2UZXA 4R26H 4UYPA 4AR1A 1PDKA 2X70B 1ZV9A 1XSIA 2CD0A 1H2VC 3OWEA 4UT6A 5CWSA 2HH0L 3GTNA 3AADB 2AJ3B 4TNVK 3UJIH 4G80B 3VB8A 2EVJA 4PWEA 1YECH 4QRPB 4PW4A 1YPZE 5KZCB 1U30A 3RRQA 3WY3A 5LAXB 4FCHA 1ZLVH 1YEFH 2CR6A 2WKOF 1A7PH 4NM8H 4OBRA 4CGTA 5I8CA 1X5KA 2Y7QA 3CFBA 4R4FH 2EXYD 5JJ7A 2NUPA 3Q8EA 4N2SA 4N2IA 1MLCB 2WLKA 5JMND 1U6AH 3C8DA 1DUYB 3ERXA 1FG2A 1MHHB 4AGPA 1LD8A 1G9MH 1I8KA 2W9DL 2E4TA 4PJIA 4PM1A 3BQUB 1KYUA 1RULH 4ABWA 1AXSA 1OWLA 2CRZA 4EUPG 1VKXA 3PEVB 4QHUA 5JHMA 3JQOB 3CV0A 4JJOA 4E41B 3O4LB 3JZYA 3X14A 2UWEA 3KPOB 4Y9FA 5AUMB 1RU9H 1J1XH 2IXQA 2EDOA 1T6WA 4QNPF 3TV3H 2OL3A 4G8GA 1JF1B 4JDZA 4P2QE 4YBHA 2YZ8A 3N21A 1VF5C 5CIPH 1QLEL 1UH3A 5DMJB 5GIRA 2Q7YB 4PS8A 4QRFA 2A6JB 5J57B 4ZMZA 3VXMB 2XENA 4CVZB 3K2UL 3QEQB 3T4YA 1W91A 5DVNA 1FO0B 1CGTA 1PZCA 3BVXA 4FNPA 4HEPA 5FAAA 1FL5B 2EJ1A 5BUGA 3AS3A 4TPRL 5F6IB 1S64A 5C6TH 4JANA 5J11C 4LVNB 5I0DA 1I4FA 2BIIA 5IP4A 4YSTA 4YK4C 3AMKA 1M1XB 2OTPA 1OTSD 2VXTH 4JFSA 2JQZA 2VQ1A 3PPSA 1KCSL 2KZTA 1TZIA 3PY9A 3C8KB 3F6LA 3KLKA 4GQ9H 4CADA 5I0ZA 1A3QA 3V2XA 1RZKL 2FCBA 1TJXA 4NQXB 4W6XB 4ANKA 3LZQA 4ALAC 3ORJA 4MJJA 5AW9B 4KQ3H 2YD6A 4Y4HC 3U36B 5FINA 2HTLC 4BZ2H 5BOZG 4P59H 4KJPD 3BKCL 4LEEA 4RSVA 4N8VA 3T3MF 3RKVA 2A6IB 3OPUA 4ZYKA 2IG2H 4KYOB 4FLQA 3QUXB 4PY8J 1TJHL 4JEHA 5L0QB 2BMKB 1IO4C 4XOEA 4JQVC 3BKJL 4NC1C 4JC8A 3ZKMC 1SEBB 2PGGA 3QBTB 1AZVA 1E6OL 3VD2A 1VJSA 3V4PA 5DWUH 1FJUA 3KEAA 1HL9A 1KTLA 1WP6A 5CJQL 3HZYB 1KPRB 3N0PB 2I5YL 1MNUL 1E4HA 5BV7B 5C0FA 4S1QL 3T0EB 2VL5B 4NQCB 2N0KA 4OIFA 3X2QE 2XNAA 4Z7QE 2CLRB 2B5IB 4Y1AD 1XB3A 2PCPA 3DSNB 4OFKA 1W72B 3X13B 3A0OA 4UZGA 3W0WD 4JFHE 2B08A 3H9SB 4L18A 4AV7A 5I1KH 5I1JH 4RX4D 5D6DA 4A7UA 1LNCE 5E8OB 5I66A 4M1DH 3GLAA 4UYQA 5L2KB 5D7JA 3LX9A 1IVTA 5BXUA 5M95B 1B3IA 5JHLH 4GSRA 4PJ9C 1KN2L 1UA6H 2AXFB 3O6FB 1CYGA 4K8RC 5E8NB 3VGAC 3DOSA 2Y24A 4B94A 1TEGA 3D4YA 5DQDL 4FG0A 3SGKC 1JBJA 4CILA 4CDMA 3L9TA 3BSHA 3KLSA 4PS7A 1M1SA 2ODHA 2EQDA 4KVPA 4KY1L 3IETA 5A2CA 3VQ2C 5IESL 3SGJA 2WPGA 3EH5B 4B9FA 4PTUA 3ZTEA 4HLLA 2X4QB 4J8DA 1MW0A 3MCXA 1NFDA 2VM4A 4G6KH 5E2TL 2J6EA 3U4AA 5I8OL 2JELL 3NABL 2RQ8A 3C3RA 3P54A 4DH2A 4FA7B 1S9VA 1JZ7A 5KSAB 2F1BA 2FSEA 3RTQB 5KAQF 4Q69A 4MMXB 3DX7A 1A64A 4X7DC 3UG5A 3TPUA 1LNEE 1EAQA 4OCWH 4WUKH 1FPPA 1SJEA 4AH2A 4AG4H 1RZFH 4NQVB 3D3VD 3JWNC 1FZMA 1PLAA 2BF0X 2X6FA 4L0PB 3ZOAA 4GTOA 1DEEB 2R2CA 1UKTA 2X4NB 2QTVA 5ANHA 1DC2A 4X6CB 1LNAE 4HS6B 3ELQA 3P1UA 2XXFA 5FIOA 2VITA 4PGBB 3HRZC 1WAEA 4M4RB 4B0MB 4ORGA 3KW7A 4F58H 4XE0A 3L3GB 1BIHA 1NL0L 5A1AA 2Z91A 3HG5A 4YHZH 1RPUA 3GUTA 1UFGA 2XRYA 1GOGA 1I1AC 2XZCL 5KYWA 1UH4A 4IBUA 3HVEB 5CBNA 3PGDA 2NQDA 1RSYA 2EDNA 3ZDYB 1YHPA 2CLVA 2G5UA 2NYYD 3S96A 2XRAL 1MFBL 1ZLDA 2YLKA 4PS4L 2WHZA 3SE9L 3AG3E 1SHSA 1G5GA 4TLTA 5SV3A 3ZKJA 4RDQF 3X3GL 3VD0A 4P8QA 5EIQA 4NQUA 5IQOA 1R3LB 3RL2B 5DJ0A 2PZIA 4NACA 2FJHB 4F8TA 5DFTA 4DN4H 2XRZA 1NCAL 1QHOA 4LNUD 2OJEA 1T1ZA 4HCGA 4IULA 3BH8A 5FSJA 3CHMA 1XR8B 2QPFA 3TO2B 3R8BB 1ONOA 2RH0A 1BXVA 1U2HA 4R7DB 5I71B 3HZMA 5MERB 5C09E 1B9ZA 2W0FA 3N42F 2JQMA 1NGYB 2D03H 4EUPA 3VWKC 2VLJE 4WJ5B 4LE8A 3MGAA 4K3HA 1SXNA 4EZMA 3G6JF 2ZUUA 5LAPA 4AC2A 2ZX5A 1TNMA 1NBYA 1JVSA 3SO8A 3VD4A 1UZ8A 1CGUA 1AACA 1FI8C 4HIHB 4FL4C 5KYXB 5TK2A 4OZGF 5FM8A 3WFBL 3BUIA 2AWIA 5DUBA 4M43L 2Q6WA 3SQOL 4QHLA 1J10A 3PUUA 4I6JA 4FQ1L 4HH9B 4N9GB 3AU0A 5JJTA 2BP8A 12E8L 1IGFH 5JMOC 4AMKL 1NUNB 3UTOA 5FM4A 2P8MA 3MRFA 2FQGA 4X8GA 3NDZE 2VGYA 5FO7A 4PGDB 3QZOA 5EDXA 2RTTA 1XF4B 3B2VH 5CINH 3BXNB 1T0NB 4PY7A 4U1GB 1HEZB 4BFNA 1YLBB 2DMGA 5CP3A 2UWJG 4Y1AA 3QHTC 1YUHB 3FONB 4O2FB 3TBVB 1A8JH 3W0WA 1FL6A 3RU8H 5AAWA 1V54B 4OLYH 1IAMA 4IIZA 2WLJA 5F3HA 3D2UA 4RX4A 3SY0A 3VFPA 1AZRA 4I9WD 2JABA 2NDFA 1GZHA 1PFOA 4ODSH 5D5ME 3ZUCA 5I1CH 3QIWD 1AXTH 3ZKXB 3WNPA 5J1AB 5J8OA 1G7IB 3BUDA 4KJQD 4JFFE 2AXGB 2VAJA 1M2VB 3N6YA 1PCXA 2VN4A 2BHZA 3STZA 1A7RH 3L1EA 1YYHA 3VFNB 1A9EB 2CRMA 3M6DA 5D72H 4WO4B 1U2CA 3DVGA 2WHVA 1S7XB 2G2RA 4CT4A 3BJ91 2UX6A 3HB3B 3KWVA 2YK1L 4HPOL 4QXVA 3MJ9H 4UOJA 4WI8A 4WFGE 3UCQA 5E24E 1KYOK 4QAMB 2OVFA 5FOBB 1OP4A 1AP2B 4G8FA 2RKKA 2Z1KA 3MUUA 5MENE 4R97B 4UM9A 4L5FH 2OI9C 1ID2A 3FT2A 4HJJL 3NH7L 4UV4L 2R2HB 1C16A 2CBTA 4K15A 4NYLB 4HS3B 1A4KB 3AT0A 3HC4L 2FZ3B 5E2JA 4D7BA 4L5FE 4LP4A 3MA7B 5IB3B 3MNZA 2GRPB 3GMQB 4Y9CA 4UOZA 1QTSA 3BIBX 4HJGB 3D3VA 3BEWA 1FHNA 1N59B 2CHNA 4FI7A 3G5YB 2CLZB 3G2UA 2DVWA 4ZMVA 2YRLA 1EYHA 1U3DA 5EOQH 4M6AA 2CDGA 1I1YB 1BJ1J 1ZHKA 5H37G 3S5LG 1QF1A 5E56A 4PLJC 5IBLC 4PLKC 1TSHA 3OKMA 3P73A 2QQNH 3NSFA 2BNRD 3SJVE 2N56A 4DX2A 4MLPA 3TYFB 1QEXA 1FGNL 3R7RA 1QSFD 4BKLA 4HWEH 1GCYA 4P29A 2I32A 4JQXA 4PBWD 3NUKA 1CGSH 4H1LH 2XZZA 4PG9A 2BC4A 3LHAA 3Q1EA 5E7BA 3U1SL 1ZGLP 1SYSB 1IKFH 2ZX6A 2E7BA 1PYWA 2XI9A 2ZG3A 2D9CA 1Z9SB 3DJTA 2BCKA 3LKPB 3PQYD 4XMLL 2DIBA 3D1MC 5E4IA 2FR4B 5JUEL 4U1JA 4GCNA 4F7EB 2HG5A 2OMTB 3KVQA 4HK0B 2FQDA 2CMRH 2JKNA 2XPYA 1DUZA 3UPCA 2X4TB 3UMTA 2O1AA 2RD0A 1GY2A 2CK2A 4NENA 1UUSA 4MJ6A 3ZQXA 4WU5B 3APMA 3DV4A 3S36X 5DJ6A 3LN4B 3LS8A 3UTQA 5GS1A 3EH3B 3QWQB 1X3DA 5DHYB 4TSCL 3BO8B 5HJ3B 2DLTA 2XBZA 2F54D 3DDFA 4F8LA 4DFIA 4HIJB 4DZ8B 4L1DA 3UZVB 1RZPA 1YG9A 2PO6D 3E37A 2GK0B 5E9AA 1BM3L 3W39B 4DP4X 4RMRA 4F7PB 4JCMA 1IBGH 2H1PL 2C3VA 4NJ9L 4G1MA 4KVNL 4YEFA 2H2SC 4GQRA 1MJJB 1UB5B 4G3YH 2H8PA 2XYBA 2WJ7A 3NOCD 1OOWA 2BHUA 4I0PB 1GY1A 3I5PA 4UAOC 4H5SA 4KKBD 3B2MA 4ZNEE 1ETB1 2EXWD 3JVFC 4PG2A 2JCCA 3L4UA 2RBLA 5MEOA 3BAKA 4HKXB 2W81C 4PJ8A 3R0MA 2PWEA 5ACZA 5ADPH 1CFQA 3M1BA 1NJ9A 4GU5A 4PV9B 3OJVC 3LY8A 5HDBB 1G7PA 3HNSL 1DQML 1IC7L 4NZTL 3A6BH 4U49A 2JJTA 4JM2C 3P7VE 1OUVA 5IIEB 4OLWH 5BRZB 1PZ5A 1NCNA 5LCWC 5I75C 3IDGB 5AOKA 2XQYA 1NM4A 5HPMA 4OF8A 4LCCA 3GMRA 4UNUA 4HOZA 3WFDH 4YL4A 5F7NC 1AS8A 4LRNH 5D7IB 3QIWA 5CLXA 4RGMC 5EZLA 1YNKL 2JI1A 4UI2A 3ESUF 1TQBB 1YN6A 3BKYH 1I75A 2BSSA 4Z9KB 4GIPD 4LCWD 2Z65C 2JB6A 2FUTA 2FYVA 4OGAD 4KGJA 4K9EL 5F0PB 4NRXB 3SFXA 3V2AR 4LDLB 4XNXH 4DJMA 5ANLA 5F1KC 4Z77A 3ROOA 2X6UA 4A7GF 3AXLA 4PR5A 1TEYA 1C5BL 1PEZA 2ZSWA 2C7FA 2V8SE 1OGAE 4BK5A 2APSA 3UJTH 2N3JA 3OJDB 1A6VL 1T04A 3SBSA 2Z34A 1D9KC 4HT1L 3JQ1A 1I7UB 3C5JB 5TE4H 3OBAA 2GITA 4XWOD 2BDNL 3KD4A 4UT9H 3EYVB 4IKKA 1UC6A 5C0EB 4GRLC 3PWPB 3ZPDA 3IGLA 3N2JA 4MLIA 1J8HB 2WM0A 5E9DD 5AVQB 2WBJC 4OZGE 2X10A 4J2XA 2ZIDA 3WEOA 4KDWA 3KLLA 2DWEA 4UTAL 1MH5B 3P7RE 5KVGH 4FMVA 1GXEA 1BZ9A 1UWYA 4RGNC 1JZHA 3EJSA 3LQAL 4XBPA 3KLAA 1QZNA 3PIQA 2E0PA 4APOA 4CL7A 1AY1H 5E0QA 5KVGE 3NZSA 2BNRA 4LHJB 4X6BB 1WHPA 3ARFD 2M1KA 4IRJD 4AM9A 3GEWB 1QSFA 4MCZA 8TLNE 2F5BH 5EO1A 1U8QB 2XWCA 4YHLL 4PJAA 2BSTB 1RP3A 4N6RB 5BOJA 3QA3B 4FI6A 3C87A 3T1FB 5DC9B 4XXCA 4D9LH 3UT8A 3H4HA 4J27A 3FUNA 2TLXA 5C0AE 3D85B 1BF8A 4IOFC 2FVNA 1CGXA 3PQYA 3K72B 1H3VA 1V7NH 1QSEE 3NN8A 4G42B 2ZX7A 1ZOXA 1RW2A 2CDEB 1C7SA 2V2XB 1WH0A 1R9FA 2ED6A 2PYFB 1OT1A 1EXGA 1AQ8A 2HSIA 5EZJB 5JZ7C 3DSVA 3QO1A 4GKLA 2J4WH 3KM1A 3FULA 2MCMA 3PZ2A 1D3CA 1PY9A 4HCRL 5AEAA 5HHOB 2NY4C 1XT5A 3TONA 4WZ9A 4DESA 4KK9C 5EZOH 2J5WA 4WF7A 2XZAH 1ILUA 3MRPA 1TVBB 2F54A 3K8KA 4LB8A 5KVFH 5DA0B 4QOKB 2DIWA 1CXKA 4R8WL 5H37A 3S5LA 2O5ZL 2PO6A 4J3OC 3VH8G 4OGXL 1S8DA 4F3FA 1UFUA 3ULVL 3PZDA 5I6PA 4APXA 1B2WH 4YHKL 4K5LA 5KVFE 1MPAH 2IDQA 5J08A 1BXXA 2VLRB 3GI9H 4OKVB 3DETC 4W4NA 3C6LA 1OVZA 1DJHA 4YGVA 1NEUA 1DFBL 1NTDA 1LNFE 1R3IL 1RIVL 1HX8A 5D1ZD 5MHSD 4PP2B 1YEKL 2DQGL 2Z7YA 4UINH 4NPYA 2VDQB 4N22A 5DGRA 2FBOJ 1K9TA 3DXAB 4MJ5B 4PU2A 1FLRH 2PYEE 3GB7B 1FGVL 3QK0A 3IFPB 3GSRA 2WTPA 1RJYA 4B0MM 1E28B 3ABKB 3BEVA 4LCYB 3UTTE 1WBYA 4JPKL 1GW0A 5HGDA 1XWVA 3DV6B 5K9JH 4HJUA 3CVNA 5IB4A 2Q87A 1FFRA 3QIBB 5H35B 5DD5L 4NWUL 1I1CA 1KOAA 5SWSD 3RNKA 3B7TA 3RUGF 4R4ND 1E9OA 1RK0B 1OSYA 4LLYB 5DWPA 2XWJB 3OHXA 3N1QC 2VQ4A 1K6QH 2QDVA 3NJJA 3QORC 3FU5A 3T8KA 2YWYA 3NP4A 5D7HA 2O5NA 5DJZA 4L3ED 2YKLL 2KZ1B 3QI9C 5EU4B 5DRNA 4ORZC 1COBA 3I6GA 4AR9A 1G6RB 3MVSA 2ZKHL 3MGOB 4I0CC 3FH5A 2PWGA 4HFGA 4OOFA 1IAIH 3FFLA 4LCWA 1S63A 4ZTOH 3RGVB 4LP8A 3PWJB 2V3EA 2LFGA 4MRUA 3KYKH 4HWBA 1GOFA 2R23B 3TL5A 2K6WA 4MYPA 2BH0A 4KMTL 4UV7H 5HHPA 1RZGB 3AM8C 3C12A 3T8CA 3L3IA 3QQ3B 4N2DA 1V3KA 2BX5A 2VXQL 5FECB 3MNMA 3ZMEA 1M05A 4X9GA 3GSNL 4B8AA 4S2SA 2NX5B 3FOMB 3BVDB 3QDGD 2NCEA 4CNIB 5A3ID 3OKYA 1T89C 3QEGL 2QV2A 1ZLUK 2R2EA 4OZ4A 1NSNL 1BZOA 2DLEA 3L4XA 2HFTA 5DVMA 2F8XK 1A4BA 5F70A 3I4GA 4AQ1C 2A9NL 3L7FA 4IRSA 3D05A 4J3XA 4ZUSA 4K5NA 4DKFL 5E9DA 3AWFA 5HYQB 3BWUC 3KBHE 2AJZA 4L3AA 3UTZA 2EICA 2ZCKH 1URZA 1E8ZA 2R56H 3EHNA 1DBJH 3NAAL 4KGLA 1J1OH 4U0QB 1CK0L 2D7QA 5E94A 3ESPA 3GSOB 4PWFA 5LBSL 5A2JH 2D31A 2EIJB 4AK1A 2O72A 3K6DA 5IQMA 1MQKL 2KDYA 4QJ3B 3GYRA 2UY1B 4RWYL 2BVEA 1XSOA 3L9YA 3ARFA 5I74B 5KEZA 1JZGA 1RHHB 4IRJA 5DD0L 4JLRB 4ZW6A 2HXAA 4P46C 4Y16D 3HVNA 1EEYB 1FRGL 2XN2A 3CLEL 3GZ2A 3UTSD 2AQ3A 2EO7A 4YWGH 3HCVB 3D25B 5FDWA 4GRWB 3BP6B 4XH2A 3QQDA 1GYVA 1NP7A 5ILTH 5E1HB 2YAMA 4DW2L 3VXUD 5CBAA 2V0AA 1QFUH 4NQED 4Z7UE 4N8UA 4ZFZB 2WVIA 4XGZA 2ZP9A 4DP1X 1J5HA 1KULA 1F4AA 3V6OA 4AENB 2V5RA 5IOPA 4PJGB 1NAKH 1TQVA 4G82A 3SDCC 3ASOB 4QLRA 2ZQKA 2NY5L 4JRYE 1XTLA 1BAFL 4UBDC 5IW6B 2P9NG 3NCJH 5HVHC 3L3JA 1RJZB 1NANH 2VXVH 3L3DA 4TYUA 3PP3K 2GGFA 1DSFL 2EDKA 4LLQB 2JKLA 4WHDA 2VJ0A 5EBMB 3HXBA 3CNKA 2W9EH 2D8KA 4LARH 2CCLA 1NANI 2XXMB 1PQZB 3V5KA 4ACPA 3O11B 1GHFH 4BA0A 1BJ1H 2NY3D 4YHOH 1N0QA 3EJTA 2MTPA 3AQDA 1URLA 2RMNA 3K6FA 1N68A 5KW9H 5JW4R 1N6QH 1N4XL 4FAAB 3RWHB 2X2JA 4X5RA 5FYLH 4V3IA 5D1ZA 1JIBA 5J56B 4HKJB 4NI3A 4EDXA 3RVXD 4QTIH 1HYSD 1V55E 3UM2A 2O26U 3JWNE 4JZOB 3MX0B 1NA0A 5AAMC 4RFOL 4U6YB 5FYLE 1AO7E 2JIXD 1TQUA 4KMQA 5E5UB 5CD3B 3EOBB 4JM2F 1H15A 4RZCB 4ZUUB 5I5RA 1Q94A 1WY6A 3B9KC 4FQPA 4AYSA 1S7TA 5CJXA 3S35X 4V1DE 1CFBA 5KUKA 1OARL 1GZQB 5JQ6H 2L0IA 2VT0A 1RZJL 1XR9B 5HVFB 4JG1H 3OD3A 4ZAKD 4KROB 4HC1L 1KCRL 4HPYH 2I85A 5SWSA 1HNYA 4PLOB 1K8DB 1FZKB 4OCMC 3MEKA 2WQXA 1MCOH 1TVHA 4R90L 2A6DB 2HVJA 4P07A 3MOAH 2OMYB 4OZIE 4L3EA 4FKHA 3DGGB 1H6PA 3ESKA 4GIOA 3VH8A 5A2AA 1EO8L 5FEBA 4JKWA 5CP7A 2FECI 2FGWH 1HEHC 4FQ2L 2Z8RA 4Y0GA 5DLMH 4P2CG 3TURA 2WXKA 2AQQA 3BP4B 3FSOA 4UAHA 3CVVA 3PUJA 3ZYZA 1OSZA 2CZNA 3QGOA 2RCSL 5EFIB 3EH1A 3ULAB 3J7HA 3ZZSA 1BREA 3ZQ9A 1SBSL 4G7VL 1R47A 3IVKB 3NSYA 4ONFH 2XY2A 4PRID 1ZGLA 3WE1A 1JCQA 5EEWA 2PWFA 4PJ5E 4FLOA 3LKQA 2YQ8A 4M00A 4LRZA 1XGTB 3JV6B 3QDGA 4FZEL 2HB0A 1IGYB 3D07A 5DJ2B 5DJCA 2XZQL 5FK9A 4KI5D 3FH7A 3ARGD 3CFNA 2DQJL 2ZKMX 4L2LA 1OTTC 3A4EA 3G5ZB 1DQTA 4CVUA 5FW7A 2VB5A 1QQDA 2X4RA 1Q0XH 1TZGL 1NMAL 3FTSA 2Z1PA 1OGSA 4YHYB 1W9XA 5FO2A 5LB1A 3NF1A 5CSBA 4F1ZA 1E27A 5JHDB 2IANB 1SJVA 3D9HA 2EZ0D 4IDLA 4XCYA 5FV2A 4F9LC 1L9PA 1XGZA 1DR9A 1LWRA 1HE7A 2JV7A 4HBCL 2IGTA 3CFEB 2EH8L 3MV9E 4ZO7A 4K5BA 4U33A 3CVHH 2NPLX 3N43B 4Y16A 2YEQA 1E7VA 1Z5LA 3T6VA 3UTSA 1KXVA 1R5WA 4LLWA 1IAOA 3CMGA 2V5YA 5EN5D 3N06B 3KCPB 5AYUH 4AUJA 3VXUA 1KYFA 4NQEA 1XGYH 4PRHE 1V05A 2M63A 3ATDA 3HPJB 4QO1B 3HC2A 4N68A 3U7WH 5ICZA 2W92A 3FO0L 4LKCB 4MMYA 4BGLA 2AF2A 3UBXG 1W0YT 2Q76B 1HI6B 2ARJB 5IT2H 3NJFA 4ZX6A 2OCCB 2FWSA 4HUUA 1UOKA 1X5IA 3UX4A 1F58L 2CPUA 4J3OF 1C7TA 2P26A 5LWDE 2NNAB 5AQ0A 2A9AA 1HXYA 4M6ML 3ECUA 1BX2A 4NO2B 4DZBB 2G5BA 2ZOTA 4QGYA 5KNHD 4O2EA 3GSVA 4JFYB 4JFXA 3WUWB 3SKNB 2R2LA 2PTTB 1VEPA 4TV3A 2VLKB 4RMWA 3BIKA 4NZ8A 1SYVA 3FQTA 2K7PA 1HXIA 2ROYA 4XVJH 2QC9A 3SPJA 4A67A 1FVEB 4GI9A 3L4CA 2WWMC 4PJEF 3KEZA 1MRDH 4PJFF 1YA0A 3K4DA 4L4TD 1CFSA 1MVUA 3UBFA 2R1XA 4KKPA 2XKNA 2OQJA 4IK6A 3GMNA 5ANME 5GGVY 2X1PA 3CCHA 1MFDH 4LPXA 2JIXA 2QSVA 2XJKA 2F5AH 4PSPA 3TN0C 5GZOC 1A5FL 4U8YD 1WSST 3W38A 4UNTA 1HH6A 3MBWA 3SKOA 3IDIB 1UM4H 1MAKA 2ZF9A 4JAMB 4LVOB 3N41B 1EIBA 3DI2B 2F58H 2V4LA 4XNAA 4LZKA 2NY0B 3JQ0A 3BPLC 4QXUL 3NTCL 3BE1L 1AHWC 4ZAKA 2N7SA 3DROA 3AREC 2A9BA 1TU2B 1ZVHA 3ARBC 3J27A 2KBXA 2YPLD 4NXSA 4F5CE 4R83A 5A2IH 3EDJA 5ADOH 4UI9C 1P5UB 1QUPA 2IAMC 5DC2A 4A66A 4FFVC 1YPZB 3NJLA 2UY6B 1INEH 5B3JF 2VMFA 5GGRA 4JEGB 3NCYS 4KK5D 4PJ7A 3THML 5F96H 4BK8A 4BSWB 1QG3A 1JGEA 2KLTA 4OQ1A 5MEPB 1OIOA 5LGJA 4JA9A 1PIFA 5C2UB 3ETBF 1N94A 1CB4A 4OZFA 2GK2A 5BUPA 4HU2A 4YPGA 2Z6FA 2B3RA 2X7LA 5IQ7H 4J6RL 1JNHA 1UKSA 4N1CA 1ESPA 3TH4T 3V4PH 4Z68A 1U91B 3QUYC 4DHLA 2WMNA 5AZ2L 1T7VA 5LCVL 3Q05A 3TVMB 5KVEL 5IK3B 2VERN 2AITA 5T3XD 4PUBH 1AGEB 3JUZA 3KYMB 5GISH 4P9HH 3UADA 3RWEB 4KZCA 4P4KC 4MA1B 4PRIA 4C56D 3U0PA 2VR8A 3P0VL 2UXGA 2A7BA 1E4XI 3O2DL 1BU9A 2PCXA 4KK8C 4BTBA 3RVTC 1BPVA 3SF4A 3C72A 5CRVA 5LHDA 4M5TA 1PS3A 4RWHA 4Q96A 4I85A 1WIUA 3BWUF 2CRIA 5F7LB 1XBRA 4HI9A 3APFA 2CPCA 3ARGA 3H2PA 2VJXA 2EDMA 3IBEA 3HJEA 1IKND 1QAWA 3H2QA 5ESVA 3GMPA 3T3PF 5DGQA 3UYRH 3T2JE 4MD0B 4IGBD 2YMXL 2XN9E 5IWLA 2JLLA 4HFUH 4P2QB 1NCOA 3B83A 4N8CH 3ZTNL 4TUMA 1MWAA 1P4LA 2CR3A 1QBMH 2F7PA 3MLXL 4OCYH 1KB5A 2CWRA 1IIIA 1P7BA 3QCUL 1QUNA 1A3RL 4DK3A 1W0WA 4XI0A 3BZEB 3LYRA 4P2OC 2CK0L 2Q2EB 3LKRB 3MQIA 4L1LA 5KS9A 3D69B 3MLUH 4GMTL 5BOPA 1FFPA 2X0UA 2N7AA 2ZNWA 9CGTA 2HM8A 2SEBA 1RZIB 4DGIH 1PX3A 1E4KC 2BNQE 4ZUTA 1AP7A 3EDEA 4X0NA 2XDHA 4NP4L 2WN3A 3ME0A 5PCYA 4C83A 3WFHB 2BOCA 4ZUWB 3KWWA 3OAZK 4XNQB 1YEDA 1BZQK 4G6JH 3OZKA 4OUOA 2HMID 1G0DA 3POHA 3HNTL 3ASDA 2YNQA 3P3RA 4S10A 5HGHB 3PJLA 5F1IB 3FCSB 4M8RA 1OW0A 3VFMA 3P4MA 1F02I 2NY1C 4GYYA 1KTJA 1OZTG 1X4ZA 3FYEB 3HTLX 4OM1H 3IRCA 4W68A 1TQWA 1OAQL 3O8XC 1BD2E 2OR9L 1CFTA 4XN7A 2F2HA 2CFUA 4K3EL 3SQBA 4DEWA 4EEEA 4OOEA 2MJWA 2R0LL