2XPZA

Structure of native yeast lta4 hydrolase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
632
structure length
627
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords LEUKOTRIENE A-4 HYDROLASE
total genus 205
structure length 627
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpzA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpzA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpzA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpzA01
3P7SE 3T8FA 4FYQA 3EBIA 4KX8A 3CHRA 2VQXA 1KL6A 4ZW3A 4ZW7A 2WHZA 4KX9A 5TMNE 4P8QA 4TMNE 1PE8A 1TLXA 3B7UX 5L3UE 2TMNE 3FUNA 4MKTA 4PVBA 2YD0A 5J6SA 1TMNE 3FCQA 3FU0A 3P7VE 4MZNE 4ZW5A 5K1VA 4QIRA 4E36A 2XQ0A 4XN4A 3NQXA 3FTSA 5C97A 3FB0A 3KEDA 2HPTA 4OU3A 3TLIA 3EIMA 1ZDPE 3CIAA 3B2XA 4K5NA 3Q44A 4K5OA 4XN9A 1TLIA 3CHSA 4MXJE 3MS3A 4R5VA 1HYTA 4XO5A 3P7QE 4XNBA 3QGOA 4ZW8A 3T8HA 8TLIA 3FH8A 5FSJA 3F2PA 3T73A 4MS6A 4ZX3A 3MSNA 3DNZA 1H19A 1KR6A 3MSAA 3P7UE 4GERA 2R59A 4RSYA 4QUOA 3F28A 4XNDA 4K89A 4L2LA 4JBSA 4ZW6A 3T8GA 1KKKA 1LNBE 4MTWE 4XN1A 4XNAA 5TLNA 3T87A 3Q7JA 4FYSA 3QNFA 1GXWA 1KJPA 4OI5E 4XO3A 7TLIA 1FJTA 3CHQA 4N4EE 4QHPA 4X2UA 3SSBA 1LNDE 2VJ8A 4H57A 4K5MA 5DPEE 3T2JE 5DLLA 4DPRA 4R5XA 5L8PE 2DQ6A 2XPYA 3FUEA 3B7TA 2ZXGA 1TLPE 2G4ZA 5LDSA 3MSFA 5K7TA 3FUHA 5DLHA 4N66E 3B37A 5FSSA 4D91A 4XN2A 1FJ3A 5AB0A 5LHDA 4KXDA 3FU6A 1EZMA 1BQBA 1THLA 1QF2A 1KTOA 1U4GA 3CHOA 4B52A 1QF1A 4NAQA 1KEIA 3P7WE 5CU5A 8TLNE 2DQMA 5LIFE 1FJQA 3FUDA 1FJWA 3P7RE 3FTVA 4WZ9A 4ZX5A 5JVIE 2WI0A 4MWPE 1LNEE 6TMNE 3SE6A 1LNFE 3LS7A 7TLNA 4R5TA 2HPOA 3B2PA 2GTQA 4XN5A 4Z7IA 3DO1A 1FJUA 4Q4IA 3FORA 3FV4A 4XN7A 4Q4EA 3NN7A 1LNAE 5JT9E 5DYFA 4HOMA 3QH5A 4N5PE 1OS0A 3MDJA 1Z1WA 3NQYB 4KXCA 4FKKA 3FXSA 4PJ6A 3FUFA 5AENA 4XMXA 3FUKA 3FH5A 3T2HE 3T8CA 4F5CA 4XO4A 3B34A 3P7PE 1Z9GE 3FXPA 4TLNA 4XMUA 5FWQA 1L3FE 3T74A 4KX7A 5A3YA 4KXAA 1PE7A 1KS7A 4KXBA 4XMZA 3FTUA 3EBHA 4QPEA 3FLFA 1KJOA 2XPZA 3FTYA 5HQDA 3CHPA 3FU5A 1KROA 3DBKA 2A7GE 4K5PA 3FUMA 3FHEA 2TLIA 4GAAA 5FSPA 4ZX4A 5DPFE 1SQMA 4K90A 1FJVA 4XMVA 5TLIA 5BPPA 4XMTA 6TLIA 5JSSE 3T2IE 1NPCA 3FUIA 5FXNA 3FH7A 4QMEA 3QJXA 3TMNE 3ZI6A 3P7TE 1LNCE 3FTWA 3B3BA 1FJOA 4K5LA 4D9WA 3QH1A 4PU2A 3FUJA 5JXNE 1Z5HA 4FYTA 4NZ8A 2TLXA 1QF0A 5AB2A 3FU3A 3FGDA 3FVPA 4M65A 4PW4A 4TLIA 3DO2A 4TNLA 4ZX6A 5JS3E 3PUUA 3T8VA 4FKHA 3B7SA 1GW6A 3FTXA 4XMWA 3N21A 3DO0A 4ZQTA 4FKEA 4R7LA 5LWDE 4FYRA 1TRLA 1ESPA 4J3BA 3U9WA 3EBGA 1HS6A 3FBOA 3T8DA 3FULA 1PE5A 1Y3GE 4XN8A 4RVBA 5L41E 3B7RL 5LG6A 4OW3A 3FTZA 3Q43A 3NQZB
chains in the Genus database with same CATH superfamily
3MXVH 2MHAA 5DMKA 3H7BA 3UO1H 5IKCB 2OXGB 5GGQH 5I8OH 2H6GA 4WI0B 4UIMB 2ZAHA 2CZNA 4FFZA 3KLAB 2B8OT 3LEXB 4EBQH 4C0EA 4G7SB 3EH2A 5CWSA 3W9DB 5ESQB 1Y8MA 2NYYC 3Q3GB 4N5CA 2VR5A 5AJDA 2IAMA 2V5FA 3SKJH 4MNQD 3MRQB 5SWZD 1HYRC 1RPKA 2E8ZA 3OPZH 3CZFB 4HPYH 4KROB 3DRQA 1EGJH 2Y7QB 5CZVL 5DZNA 3MLYL 5FFOA 4G23A 4PJHB 5KVGE 4AR9A 5BT1A 1JZFA 3NQPA 2Y24A 3E1ZA 1NUDA 1QBLH 3ZPDA 3T2PA 1F4XH 1AXIB 1I1YB 4P4RA 3Q78A 3CN1A 2NNCA 2ITCA 4XN2A 1N0QA 1U3CA 3CFBA 3KCWA 5F0JB 5ABAA 3JTSA 4M02A 3PFUA 4KDVA 3K46A 1ORSA 1TETH 3N0AA 4JY4A 4F58L 4W1TA 4RX4A 5DD3L 3QARA 4KWUA 4UQ3A 1FIGL 4QXGL 1KELH 1Q1JH 3CVHH 5ENWA 3FEXA 4K0OA 5CLZA 2P7TA 3AWEA 3CXHK 5B8CC 3FXIC 1SLVA 4DN4H 2GCYB 3CVQA 1O1RA 3KW8A 3T3ME 5AB9A 2NUPA 2DYPB 1UADC 4LZKA 1T03L 4IEFA 2B4CC 4JFFD 2D9QB 3K81A 3D9MA 3AUWB 1F11A 4AYSA 3O8XD 4JFFE 4L3ED 4ODWB 3E32A 4ONOA 5IEKA 2UX6A 4UWHA 2NW3A 3IDYC 1MCFA 4NWTH 3QDGA 5DHYB 3C12A 4GH7B 3T3MF 3B1TA 1JN6A 1H8LA 2K1MA 5K39B 1GPOL 4DVRH 5BW7C 4NSKB 1PJWA 3SDDD 4FG6C 3T9WA 1F4YH 3G2SA 3MRCA 5I9QB 3VB8A 3VXMA 4QXTB 5GZND 1BA9A 3UZQA 4PYGA 4NSKA 4CCAA 5H37A 5HVFB 2DQIL 4AIEA 1QBLL 2MQ3A 3DGCR 3CZNA 4N9GA 1YMPA 3MA9H 3BH8A 1HINH 2UXGA 1UHVA 3BAEL 4M8UA 2OI9B 4M3HA 3UZQB 4I9XA 3O4LE 5D7JA 1L6XA 5IROC 4U1IA 1MLBB 5AB2A 4CDNA 4W9HC 1TNMA 3J2PA 1R33A 4Y4HA 4J0UA 2Y1EA 1FGVL 2A9AA 4XI9A 3SI5A 5C09A 5DJYA 3H9HA 3QVAA 2BHZA 2AMUA 3ZHXA 5IQ7L 4JKPL 4IK7A 4WFFD 5D72L 2ZUQC 5AQAA 3ECQA 1H6FA 1V27A 2ZCLH 3R06B 1FO0H 3MRIB 4BE6A 4GSDH 4NPKA 1JZ7A 2W60B 1WBXB 2C4FT 4YDNA 2F53E 2C3WA 1QSED 2JI3A 3PHOA 1A6AA 4NO0D 5HY9B 3N42F 2FB4H 3C6LC 4TPRL 4WFED 1DFXA 3UTSA 1IGCL 2J5LB 4PBDA 4Z78B 4TF4A 5K9KA 4NGHH 4WO0A 1E8YA 5D2LE 4LOUC 4Q58C 3T5VA 1HSAB 2V2WB 4TSBL 3BP4A 4P2OC 2HG5A 4ODTL 4GBXA 1LEGA 1MCOL 2HUEA 2VJ0A 3CSYB 3GGWA 1CMOA 1CGXA 2FVNA 3UX9B 1WFTA 2QZQA 3PDOA 3M1BB 3QOUA 2Q86A 4KROC 2PXYD 3C3QA 3NRPA 4PGCA 4MJ5B 3BPCA 3FO0H 4G11A 4KJYB 3VMNA 3BZFA 1WAEA 3E4BA 1MFCL 5CMYA 2YD9A 3A4DA 3UROR 5C07E 2A6IA 1MWAL 4HLEA 5E6ZA 1ECYA 1XEDA 3IPBA 4JVWA 4ERSL 4PRPA 3VXQA 5C6WH 4CZ2D 4HZLB 1NFIE 1L0YA 3MOAL 3REVA 5JHLA 5BV0A 5T3XD 1BZ9B 4ZN6A 1I8KB 4UT9L 2XWEA 3IN0A 3OMZA 3RPIB 3QI9B 4KKPA 5EA0L 1O5MA 4NUPA 2ENQA 2EIKE 3IMBA 5IHWA 4MJ4A 2J1KA 2GUOB 3IJYA 4MA8L 12E8H 3CH8A 5K9KB 2FQDA 4PJIF 4PI2A 1KCKA 2PGGA 3SO3C 1X4ZA 4P46A 2AQSA 1PYWB 4AM9A 1ZA6A 5DULA 3D87B 3L4YA 2R27A 4W9ZA 3RWFB 4Z76B 3BX7C 4RMRA 3RUGB 3FV4A 1HHIA 2CMRL 2IBBA 2MPAL 2W80C 2C5ZA 5IHUH 4PS4H 1WIUA 5I6XB 3R8QA 3HR5B 1OCOE 1BF8A 5DRWB 1QRKA 3BPNC 4GCNA 3QIUB 4PI0A 5CMWA 3IKOB 5DHVH 3U7AA 1K2DA 3AG3E 1PKOA 3L3JB 5IY5B 1K5HA 2XWBA 5AL8A 1YNTA 4EXKA 1NBVL 2NNFA 1PL3A 4O2FB 2X70A 2YN5A 1EEQA 3SCMA 3WSQH 3KHQA 1MFAL 3GHBL 5LGJA 2WVSA 2JLPA 5CJOL 5JLZB 5JSSE 4HWEL 1HJCA 1FHNA 1OCCB 3EBAA 1J8HA 1K5NA 3BVUA 4G8LA 4N9OB 4WW2F 2B16A 2GKIA 4S1DC 3SE9L 3HC3L 1MVUA 1Z5HA 4AXWB 3FO1B 4Y1TA 8FABA 1E67A 2FO4B 3X17A 1TJCA 2YZ8A 1OTSC 4HJTA 5C3TA 3VXSA 1QZ2A 1FE8L 4M62H 4I6GA 1SRDA 4LEOB 1AS8A 4M9OA 5T5NG 5IJDC 2VDOB 3VXUB 2ERJC 2CO7A 1IAIL 4PH4B 1R5IB 3KPLB 4KNUA 1C5BH 1MHCA 1XVSA 5ENWB 5DMKB 2ENJA 5F9DC 3OMNB 1G9NL 4I1AA 4YR6A 4OW3A 1YMMA 4EKJA 2A3TA 1KYOJ 1NCTA 3CVCA 5B3JF 3NA9H 1NGYB 2AZUA 4FHBD 1KL6A 2VITB 3TWRA 4G72B 2NY5L 1SEBB 1S9WB 1IBFA 1JYWA 2DLTA 1TZIB 5ESVA 1WZLA 5TPWL 4GG6B 3IKKA 3MV8B 4JO5A 5KSBF 5D1QE 3SD2A 2I2OA 3P4OA 3F6IA 3WXVH 5BRQA 3NIGF 4ZMYA 1A4BA 2ED7A 2LU3A 2NY3B 4IYPA 3D0VA 1HXYB 2AJUH 3OZLA 4Z7NF 3KJ4C 4YC2C 2BNUA 2Q86B 1KN4L 5JA8B 3QNYA 3ARYA 4JBSA 2ORBL 5SWZA 3BXNA 3ZKMD 1DVUA 3QFJA 3SPCA 3B9AA 1A6TB 2XDHA 3AY4C 3L5XL 1S5HB 1FVDA 1G6RH 4K5MA 1RSYA 1KTLB 1JVLA 2VDRH 1Z5YD 3GBNH 3MZLB 3QJFA 5BV7C 1IM3A 4P2RA 1YYHA 2ZCKH 4LKCA 5KYWA 3LY7A 1B0GA 1NPJA 2I9LB 2WN2A 4GKZA 4PHZA 4JDZA 1ZHKA 1IEBB 1NCAH 1IC5H 5F7YC 4PJXA 4JNXA 1ASPA 2LUHA 1TTAA 2GK0B 3L82A 4XX1E 5BVPH 5DD6B 3KSQA 2FGZA 4YSRA 1T21B 3BAKA 5BZDB 1EEZA 3D4GA 1FBIH 4N2HA 2Y3AA 3SSGA 1J9SA 4MA7L 4J2XA 1Z9SB 4NWTL 2ZUTA 3WD5L 1LGVA 5HJDA 2Y07H 4PGBA 1CE6A 3H9YA 2X6MA 3TBSA 3QUKB 1QNZH 2BIMA 3ZVVA 4CBZA 2YPLB 3LDZA 4G71B 1KFGA 4ZS7H 4CC0A 2BWIA 2XN9E 3CR3A 4ZUTB 2WUCH 4EI0A 1WWWX 1S8DA 2FATL 4GRLA 5H94A 4PRHE 1KIPB 5HQDA 4PRID 4ZDHA 2QSCL 1TYQG 3D85B 1AANA 3K2MC 4PJGA 3VSQA 3IRCA 3ALWA 1OAUL 5B39A 2C1PA 4XRCA 1KJ2B 4WENB 1A64A 1OD9A 1XB6A 1CC3A 3C60B 4UZUA 3TFKC 4ZMTA 1CXKA 3H8NA 3SHFA 1WZKA 4ONGH 2XHEA 1FLRH 4S10A 4BX8A 4FQXC 5I0VA 1JZGA 4D9WA 1KIUB 4OSUL 1IMHC 4F7TA 2VR7A 1V05A 3OKYA 2R39A 2VKWA 4L8SC 3KVDD 4ODXB 2VDLB 3D69A 3IAGC 2F8VA 2A5UA 1JNHB 3ISWA 3DX6A 2EUVA 1GGBH 5D7LB 1IFHL 4LVOC 2JSFA 1NWOA 1AY1L 1SMOA 1DLHB 3N43B 2LE9A 3HR6A 3RZCB 5TFSL 1G87A 4H20H 3U82B 3ARED 1D6EA 1D6VL 1NL4A 1UGKA 3Q8AA 3LQAC 2JB6B 3WU1A 3CHRA 2QTEA 3NIFB 3EDEA 4HD9A 1DN2A 3QQ4A 3ZGHA 4LKXA 4XPFL 1AIFA 1N2RA 4MZ3A 1IAII 1A6WH 2MOGA 4KKLD 1X5AA 2D3LA 4LUPA 4GRMB 1UEYA 4B0ZA 4K8RH 2BVYA 1M3JA 2Y5EA 3DOSB 3IE4A 3MOBH 5FGRA 2AGJL 1B3JA 2O6DA 1GW0A 2IFUA 5JPMB 2YXFA 2C9QA 3NCJH 1CF1A 3MRJB 2D0HA 3DRQB 3CLWA 3ARVA 3HZVA 4WY7L 2J43A 1G6RB 2DLIA 3KPRA 1J0KA 3DX6B 2P58C 2X05A 5CBNA 3MRDB 2E2EA 3DC0A 1U3HA 4WSKA 2XPYA 3ILQD 3TWQA 3TO2A 4QRRE 3VFSA 2DZOA 1DJHA 2F7QA 3I6SA 4NP4H 4MB5A 4XVSH 1WWAX 2P80A 3KPRE 2VE6B 4U6HA 4JJ5B 4LVNC 3KD7A 3DV6A 4YFEA 4RDQF 4N24A 1KGWA 2QHRH 3UACA 4OIAA 4ZMWA 3DSFH 5GGTH 3VFMA 2WI0A 3FO9B 4H88L 1I75A 1CVSC 1NM9A 5CEZD 1BZOA 2L0DA 4MJ6B 5F3HA 2NZ9D 3HW7A 1FL5A 3L4ZA 1RP8A 1A9EB 1SDYA 5DFTA 3VXTB 3NN7A 3NT0A 2EUXA 4Y5VA 1ZEAH 5FA4A 4CAGA 2OTUB 3NGBC 2ADFL 4QHUB 2EXYC 1TYEB 3ABKB 1YN6A 3IDYB 4DN3L 2OMNA 3GSNA 4N2LA 4ODHL 4ZPVA 2YMXL 1MCPL 4QAMB 2Q6WA 1LDSA 5ELIA 1IZKA 2WXNA 2LW3A 4C58B 2BIQA 2DTMH 3D06A 3TCXA 2G2RA 3KPSA 4AGQA 2BY3A 3QUZC 1I3UA 2PF6A 5TE6L 3RWHA 3VFSB 5HDQL 3JWNH 3SPJA 4HWBL 5A6MA 3ESLA 3BUYB 4W68A 2WZ0A 3SQOL 2WXGA 4WUYA 3MZTA 1WZAA 4HU2A 4L37A 4CUCA 3BGMB 1CICC 4XCYA 3S5LA 5L88H 2FD6L 5EH1A 3CUPB 5AN8A 3ANLA 4C8XA 2GC7C 4WK2B 5J7CC 2W0KA 3W9FA 1MI5E 4LKCB 3HRAA 5KYWB 4C54A 4AVXA 1RFDL 1YRKA 1L0QA 1RK0B 4YNYB 1V7NL 3C9NA 3DMMB 3E8UL 4RMUA 1HHGB 3D48R 5F9OL 1KACB 1C5DB 3TPKA 4OV5B 3H42H 4LSQH 3KPRD 3ZKSD 2VSOE 2FJGB 2P2CP 2WYTA 2YRPA 3T4AA 2BNQB 4NDMA 5LWYL 3ZSTA 3CHMA 2VDQL 1MH5B 1S7VA 4XXDA 3SKNA 4A7GA 3ZYJA 3JWOC 5AYUH 5E99H 4Y19B 3AY2A 1KGJA 2NY2C 4PB9H 4N2OA 3EJYC 4ODHH 3U7WH 3QP3A 1TLKA 4PCKA 3EYFB 2X12A 3BDXA 1EJ6A 3EFDH 2TSAA 4E36A 4JFHE 5E00A 3VFWA 4ZTOL 2HPTA 2X41A 3C2AL 4G1EB 4YVQC 3RDTB 1J5HA 3P54A 1TU2A 4HIJA 3QGOA 3CDYA 4PFEA 2CHDA 4U7MA 5DHVA 5AYQA 3S96B 4DOHB 3H7LA 1N64H 3TURA 3ZE0E 4NBYB 5BQ7A 4KHTH 3RNKB 3V5DA 1Q9LB 4BZ1A 2DIWA 3T0EE 4M7KH 2CUHA 4YHLH 7TLIA 3QE5A 1ZVYA 3I2CL 3DEPA 2A6IB 5DD1L 2NXYB 4M8QA 1B3IA 3B7TA 4BE5A 3OR7A 1HL9A 5FPIA 5EUKB 4TV3A 4ZFFB 1B4RA 4J8EA 3MLTA 4F9LA 1NA8A 3FPXA 3RAUA 2BEDA 4O02A 2XEEA 4JCWA 4XCEA 3OR6A 5JVIE 4ELKA 5I1KH 1OP4A 1L9PA 3SEPA 2WWMC 1CURA 1Z3XA 3MREB 1PSKH 2FLMA 4IOIA 2ODIA 4DQOH 4ERSH 3DX7B 1FC1A 2HJLB 4KXKB 4ZO7A 5IHLB 3V52H 4N5PE 5JR1H 1QR4A 1F8TH 1BQHG 2MKLC 2M83A 1YNLH 2X4QA 4YIQB 4N2DA 1GZHC 3BPLC 3NRQA 1RJLB 2X4UA 2APBA 3HNTL 3N1GC 5E2JA 3RTQB 5JXAL 1UXWA 3NEEA 4K5PA 3VTTA 4W9FC 1RUMH 1FLRL 4QOKB 4NZUL 3ZRCC 4D8OA 2GIXA 3TPUA 9CGTA 5MEOB 1ZA3A 4OV6F 5FYJD 3WTXA 2H0JA 3A6BL 3KH3A 2P43B 1NI1A 3GSWB 4JM0A 5HYJA 2PTTA 2YBGA 1CS6A 1II4E 5KSBA 3I85A 4Y4KA 3WNJA 4PS3A 2JB5L 2ZX7A 2WTOA 2B59B 3Q2LA 4G6AD 5BV7H 1S7WB 2YPLD 3V9EA 3D18B 3MGBA 3QPXH 4TS6A 4X0NA 2KLTA 4UINH 4F2ME 1B4JH 4HMCA 4AE0A 4PJ9D 1D5BB 4FP8H 2B4CH 2QQLL 5E70A 4J8RB 4JZOA 3NVQA 3ULAB 5I0YA 4HCIA 4NO0A 4UAOC 5IVXB 3HKFA 3J7HA 3L8QA 1MKFA 1OAXH 3QB7C 1FV1B 3T5XA 1VF5C 4G82A 4Q52A 3ZTNL 2WSDA 43C9A 4CN1A 1GGUA 3L7FB 4IULA 3QZLA 2C34A 2OCCB 2OMUB 2WNXA 5HSFA 5BMFH 1BMWA 3L2NA 1RVFL 4HUWB 4LGSB 5T33H 1KYFA 4P07A 3G04A 4HKBA 5CKGA 2R0ZH 3R4DA 5DHEA 4YOKA 3S37H 4CRPA 3JSSA 3TS8A 3CVIL 1BOGA 3IU3A 3DSNB 5I66A 1MW1A 3CVUA 4R2GC 3PXJA 1N9AA 3QFJD 4E85A 4PTTA 1W72B 3V6ZB 4BKXA 3S7JA 4QRUB 4XAWH 3MJ6A 5IQ9A 3MKGA 2JMRA 1XL6A 1R3IL 4KK9D 4Y1AA 3SE4A 2VXSH 3QEGH 4TN9A 4Z7VF 2AFNA 3Q9QA 4ZTPL 5MENA 5HBBA 5CZXD 5EKQD 3IHVA 1Z0MA 2OJZH 3VFVA 5JTWA 4G9DA 4HQDA 2F1AA 2BIPA 1CPUA 1PLCA 2C3HA 4M6ML 2J72A 5AL0A 4X9BA 3AADB 3MCLH 4J3WA 1LK3H 4PJ8C 5T1LA 1NEZB 4F2FA 1TQBC 2VDML 4P2RB 2AQNA 3CFMA 4KOCA 3T71A 1OZTG 4OAUC 4UT6A 3UBXB 3AABA 4FABH 2A99A 1TJGH 4DK6A 3RL2A 4GJTB 4JFQB 2VNCA 2QKIB 1GR7A 3PWJB 3F00A 1FFRA 1N0RA 5D5ME 4EI5B 1U2VG 1U9KA 1TTBA 3HVNA 1RVFH 4WZ9A 1WCQA 5DWUH 3N50A 4XCNA 1QA9B 3HI1A 1UD6A 3DJ9A 4PEEA 5FO2A 3DO1A 1FJUA 2BS71 3F04A 1W72A 4PYHA 3V6ZA 3QUKA 2VC2L 4XO9A 5GS1C 3TEZA 1JCQA 1I9EA 2ARJQ 1XGQA 3G08A 4PJBB 3OGCA 2JQMA 3GRWL 3S36H 1JZDC 2JEKA 2DTML 4GAYB 4AOFA 3QEUA 3BPOB 3ECVA 4MD0B 4GTTA 1FYTE 3LNEA 5DF0A 4V1DD 5TE6H 1PZ5B 3NSFA 4LSUH 4F2MB 4HF5H 2VLKE 4Q94A 5HJGA 2PQNA 1DUYA 1KJVB 3CPLA 4WHYH 1TPXC 2B0SL 3VFRA 5EOQH 2FH6A 1F18A 4FTVE 4NZRL 3ZDYB 3QJOA 3OPZL 4HPYL 3UQ3A 5EX3A 2GABA 4ZTEA 4XMVA 3R1GH 5E6IC 2DRUA 4FQ1H 2NRDA 2X4NB 2ZJSH 1AC6A 4RCVA 1TMQA 2OI9C 2VDMB 3GSQA 1XGUA 1F90L 4HWZA 4K23L 4R3SA 3C5SB 4JCLA 3MHZA 5D71H 1ETJA 1MRDL 2EO9A 2YUVA 3PHQA 5F6HJ 1P6FA 5HI3D 2CHWA 5KCMA 4C56E 2DI8A 1CL7I 3PVLA 4GXVH 4Z7QB 1PNDA 5JHLL 4MAYB 3DO2A 2HRPL 1JXGA 3QXAB 1YQVL 5HGBA 5JMND 2J5LC 1S7TB 4HZAA 5ICUA 4B97A 2ZXDA 4OKVA 1OGAB 2CUIA 5CLTA 4DZBA 2AXGA 3OLGA 5CFAA 2HRGA 2F2HA 3MLSL 1H9VA 2IDCA 2WLLA 4EE2A 4NUGL 4V11A 3FTZA 2YQ8A 5GRJH 1A6AB 5HY9A 3SDDA 3VSVA 5KWYC 2L6JA 2Z31D 2N1KA 3N40P 4P46B 1XT5A 4X5XB 2ARWA 1SW6A 4HVBA 1AG0A 3VFRB 4XC3H 1WT5C 2Y06L 4K94L 1DBJL 3SE9H 5C6TL 3F7PC 3WUWA 3O4LA 1YMHB 4U6YB 3LRHA 2G0LA 1PKQA 3VM7A 1I7ZA 1YCSA 3HBZA 3MSPA 5FF6A 3DV4A 2UWEF 3MYVA 5CD5C 2P26A 4AEIH 3C8KA 2WXJA 3I3EA 4G6JH 4P3DA 3V5KA 3VRJA 4DVBA 1NKOA 3ULUE 3EYQC 4KK6C 3LV3B 4AITA 1ELRA 2CXGA 1PY4A 5LCVH 3J8F7 4KQ4H 2YK1L 3NYKA 4MDIA 5DI8B 1R17A 2I07A 4LLWA 1I3RA 4M1GH 5ACMA 5ITBH 2AJXH 2NY0D 1JP5A 3MGOB 2VXTL 5BUAA 5AW8B 5J90A 3O41B 3HAEG 4M4RB 4KXZI 3TIEA 4YDOA 3M1OA 3P7WE 4N2GA 4NNPH 3GYZA 5L2KD 1PCSA 3RL1A 3H4FA 2MRYA 3QDJD 1BXAA 1B89A 4PHXA 4TSAL 2HFEA 1KLUB 3K2UL 3Q3GA 5IR1B 1LO0H 2QVIA 5ICXA 4AM0A 3SDAA 4PJ7A 3S7DA 1DVFC 2VL4A 3AZUA 3QH5A 2MAOA 2HTLC 3DUUA 4ZXBD 5IKCA 3GZSA 3QIUC 1CZ8L 2OAAA 4PRHA 4QHLB 4MTMA 3EHBB 1H2UA 5LDUA 2FF4A 2EDNA 5ECJE 3NIDB 4IJ3C 2MRIA 2GSGB 4RG9A 3K0WA 4HKBB 1HZHH 5B38G 2LLGA 4GKSA 1YEHH 4GAAA 5E8OB 3EO1A 3MA7B 1SQMA 3HE6C 3PF2A 3JSZA 1R4XA 1RZKC 1T1YB 2HRLA 2NT1A 2PTUA 4S1QH 1E9QA 1ZJBA 2H1PL 3N41B 3CC5B 1F00I 5FZQA 2NY6D 3NAAH 2VSMB 3ABGA 3Q7AA 4E9XA 4E0RB 5CCHE 4YAQA 1K8IA 3VU1A 3ULSA 5JBIA 1JI1A 3PHQB 4MXWL 3RB5A 3NSXA 5DMIL 1HEZA 2ZUYA 4YNYA 3U2SA 3FVPA 4BWRA 5HQ8A 4R8WH 2J1ZA 3CVNA 2WQ8A 4Z77A 5EO1B 4G42B 4IGBA 2ITDB 3LSOB 3RWGB 2GI7A 1EO5A 4EAEA 1OCZB 5DUJA 4AV7A 3A06A 1OWMA 4IKKA 2GFBB 4YE0A 5TF0A 3HFFA 3P4LA 1UWEH 5BQDA 1A7PH 3WQSB 2BHUA 1XGPA 3D12B 4AQZA 1MI5B 2A6JB 3VMOA 4YQXL 3ATEA 1BZ8A 2JXMB 1G9EA 3W9EB 2RMNA 3UT7A 3LN5B 5EIBE 4WHTB 2VDQB 5KW9H 4DKAA 3ZSSA 4P5MB 1TLIA 1G9MH 4XBEL 4B95C 5LWYH 2HVJA 3ZMRA 3CZJA 1WEJL 3IJ8A 3NJLA 2A6DA 3MLUL 4WUUA 2BNQE 2Z0UA 4PJBA 4MASA 2OL3B 4Y4HB 1RZGA 2BNRA 2W9EH 3S7BA 3Q8BA 3IMSA 3VXRA 4FHKA 1T89A 5MERB 1P2CB 1H2TC 1IAMA 5KANI 4O1OA 1AQDB 5IHHA 3ARBD 4KAQH 2XWTB 3SZKC 2EEXA 5C0AD 2EIJE 3GNML 2HMID 4EZLA 2OFQA 2DBLL 5EUKA 5CJXC 3Q73A 1QBBA 4HQQH 3SGKA 1IKFH 2Y6TE 2F19L 4MGXA 1UJ3B 3BQUB 5J3HD 3MKQB 3QORA 2ZSVB 3AS8A 1SJHB 1LILA 2X4SB 3I6LD 2GJZB 2VCOA 2VRAA 2DQEH 4RAUA 1NDGA 1AJ7L 2IANA 3O8XB 4MX7A 1KWGA 4LUNU 3BIBX 4ETQB 3V5HA 5DVLA 4K55A 4Q9CA 3BOVA 4CW1A 2I32A 4OM1L 3T0EC 1DUYB 1KJVA 3CZLA 5JNYB 1SOKA 1OARL 2D7PA 4FNTA 4F7MB 2I27N 4BWWA 1J10A 1UZ6E 2LTQB 1BJMA 4N1HB 2WN3A 2Q8AL 2K9UA 4BTAA 4YSOA 5HYSB 1ZT7B 4JR9H 5A3YA 3MV01 3VD7A 4E41B 4ANXA 4BT9A 2DIBA 1PLGL 1JVOA 1T1XB 1AO7D 3D3MA 3P2DA 1LWRA 3FU8A 4PREA 1RPQA 4ELMA 4EPSA 5F44A 1UG3A 2IQ9L 2L8AA 2H5UA 1OOWA 5BJTA 1MCBA 3MRBA 2CDGB 3N85H 4I3SH 4DUXA 3DSXA 3VWJD 3OVUB 3VTAA 1HWHB 1DDTA 5GHWH 2C9RA 1UJ3C 3BQUC 2X1OA 2OMWA 4Z95H 1G4MA 3UIZA 3P0YH 3FB5A 2B59A 4AIXA 1AGBA 1D5ZB 1D7BA 3MGAA 3MZGB 1NMAL 5E4EB 2XJKA 3B7SA 1O1SA 1CTOA 2VGLM 5KZCB 4K3GA 5LWDE 3TBVA 3PQYE 3SQBA 3STZA 5E1QA 4KBQA 2Z64C 3PWVA 3ATDA 4NRYA 3JXIA 3L22A 3JWNE 3LRMA 2CBOA 3DK2A 3HLAB 2P5WD 4GO6B 4CSSA 5I18L 3CXDL 3TZVB 3EOTL 1B4TA 1LDPH 3VA6A 4UDUA 3WXXA 5GRWA 5B8CA 3OC5A 4U05A 1ZTXE 5FB8A 1S6NA 3TEYA 1QAWA 3OKOB 3ARBA 5ENPD 2VAAA 3D3VD 2VMFA 4RNRB 4N68A 4PLJC 4YHIA 2V5MA 1QSFE 3TBCA 3UM0A 1H3UA 4IRJC 2FEEI 2AK4E 4D9LL 2WMPA 4EOWL 4XNBA 1BVKB 1JV2B 1V7MH 2H6PA 1MJ7L 3IMWA 3U0TA 4JNDA 3F2PA 3UAJC 5C8JB 3HG1B 3VD5A 2JKSA 4IDLA 2CA4A 2EVIA 3EFOB 4BFNA 1A5FL 1OO2A 3TO4D 4OI5E 2ETWA 1AO7A 3RK6A 4HXAH 4K8RD 3P69A 2YFOA 4P3CL 1ACYH 3D39D 4EZMA 2ZNXA 2N59A 3Q5TA 3UBXI 1NCHA 1K85A 3LXCA 2A38A 4XO8A 1ITBB 2VJXA 3FUHA 1WM5A 3T09A 5FSSA 3RY6A 4CJ0A 2KZWA 2Q3XA 4NYLA 5SX5K 4I9EA 3FP3A 4X4MA 4M6AA 4C4BA 4M93B 2AVPA 2R51A 3NOIA 4EUPA 3GJFH 5FYKE 1JF6A 4E9WA 3ZRFC 3U1SL 4MD4B 2WO2B 4F2EA 3EOTH 1E4XL 1K9TA 1OHZA 2MH4A 2QPUA 2PM7A 2FBRA 3D85D 3EJUA 4UMGA 3UDWC 3V6OC 5AOZA 1WICA 4DVRL 2BSSA 2DMGA 3OAWA 1BDYA 3FEYA 5GS0D 2NQ3A 4CNIA 3FU7A 1JFHA 4RWHA 1A7OL 1M7XA 4GT7A 4JDTL 4M5ZL 5ICYA 2AQTA 2D03L 4H8WL 3N9GH 1J9RA 3CZGA 1D5XA 3EYFA 1ZAGA 1AO7E 3I50H 2JLBA 2CBQA 5KJMA 1EERB 2A6DB 2ZZUT 2BVTA 1R9FA 1N9PA 2NY5H 4QPEA 2WVUA 1L9TA 2IGLA 1T04A 4ODVH 4BKLB 4FNLL 4CT4A 3T9KA 4OB5H 2QPDB 1GMIA 6TLIA 4R4NC 1LXMA 2JKJA 3ETSA 3FB7B 2VUYA 2VL5B 3OAUL 2HKHH 2VN6A 5ANMA 5ADOL 4PU2A 3Q4AB 3U46A 4YMPA 2I6HA 1FL3B 1DLHA 2JCYA 1EJFA 1E4JA 4MMXC 4ZYKB 4RCAA 2E7LA 5D6DA 1C5DA 2HT2D 5GSVA 5HPMA 1EUUA 1XCWA 1CIUA 4U49A 2W91A 2EAEA 1JGVH 3MRDA 4JO8A 5SWSE 1WFMA 5E2WL 5F9WB 2EQXA 3MX3A 1T0NA 1X5LA 5IBTL 1Y18B 3ZHFA 2V8LA 4WV1A 2R1WA 1IBZA 2XKNB 4AYFB 4KX8A 3T8KA 3IDNA 4MLIA 4P46C 1SN5A 2P8MB 2YD7A 4RA0C 2JB5H 3CVWA 1FL6B 1DCEA 3BEEA 5DRNB 3TASA 1K2DB 1I53A 3VRLE 3WUWG 3MBEB 3U3WA 3LH2L 3Q2WA 2P5EA 1INQB 2KS0A 4XMLL 5CM1A 4Y19E 1AIFB 1D3CA 2BHYA 2IWFA 2VRQA 3CSGA 4QRPA 3AS4A 1ZLSL 1BVKA 5E51A 2OMXA 3BSHA 3KZ8A 4FP8L 4DKTA 2E9IA 5C08E 4P23B 5EEWA 3NJFA 3DOSA 1PD0A 3CAFA 5LBVA 4UTBA 4OJAA 1RZJC 3ZT5A 2UZYB 5BRZB 4XNAA 2IWKA 1ZT7A 4B89A 4NWUL 2A4EA 4MVBD 1MI5D 2KDGA 4JM2C 4Y9GA 3FO1A 2FAUA 1OVZA 4Z0BL 5ADPL 4OGAD 1IKFL 2Z35B 4RGNC 2OYPA 1D9KC 5I1DB 4ABWA 4BESA 1MW0A 1JNLH 4HHGA 2VYRE 4Y16C 1ZHKB 3DGDA 3STZB 4MX7B 3DECA 1NGQL 1SLXA 1DQVA 2JJSC 3CFDA 3SY0A 4AEHH 4CU6A 4OSUH 4L0ZA 3QUMA 4HK3J 3JV6A 4Y9BA 3CK9A 2O61B 2B08A 3I50L 4N5QA 2WSPA 4A2DA 1NA0A 3BP6A 4AT6B 2DL2A 3DYOA 4L05A 1NTDA 4LMQI 1WAAA 1OARH 4AL8C 1PDKB 3V0WL 4BYHA 4ADGA 1MREL 3LMJH 5K9QG 4JFEA 5AW0B 5J89A 1Q94B 3W0WB 3FXSA 3R19A 2C3VB 2VZUA 2UY7B 3P4OB 2Y36H 3RX8A 2SEBA 3GBLA 3VFPA 5GRYA 5IVNA 2ATAA 2XN1A 1N70A 3IRPX 4N0FA 3ONKA 4LLDB 2L0TB 3K2KA 2QFPA 3KGUA 5DK2A 1D8EA 4NJ9H 1CGWA 4X6CB 5HYFA 3UM3A 4Q9BA 4GTVA 1IGIH 3MJ9H 5D2LB 2NY7L 5F7AA 5PAZA 3OAZH 3FH7A 5D2NA 2UWEE 3AY4A 1KIUA 2X87A 4FCHA 1MHCB 4IHQA 4HCFA 3GBDA 5FM5M 4DPAX 5ID1A 1R5WA 1WC7B 3RDTD 3N21A 3D05A 1FVDB 4JB9H 3RWGA 2X4RB 1GH7A 4JFDD 5D9SA 2ITDA 4FQCH 2CLRB 5BV7B 2H1PH 2B1OA 1KXTB 3H1ZA 3K6IA 5C0IB 3VTYA 2G3ZA 2DQFA 2L0IA 3NJKA 2I9LA 5DUML 3V4PB 1T22A 2OTWA 5AAMC 1ONPA 1NCUA 3J07A 3S3PA 1N12A 5DMIH 2PW1A 4UQYA 4HJGA 2ENSA 4NOFA 4MA3B 4OFDA 1M7UA 5DJCB 2W81C 3W5NA 3WKMH 1U2CA 4J3VA 3V0HA 3MKRA 5JHDB 1RK1B 4LASL 5ANRA 3QKYA 2E6PA 1ZEAL 4DW2L 5I82A 5D1XC 4GRLC 4HMDA 4XBPB 1CE1H 1QKZH 1FFOB 2A6KA 4UTAL 2DBJA 5MEQA 3HG1E 4MBRA 4AENA 2WXLA 3S98A 3RVWC 1OB1B 4CMMB 2G75B 2J3SA 3FQ2A 1OT8A 2CK2A 5DS2A 2E46A 5EBLA 5C71A 5IJVB 4F3FA 3CK7A 1BD2B 1FFOA 2JJTC 4P4KC 4AH2A 3ULVE 5IQLA 1YPZB 4P5KA 2NY1D 1MJ8L 3O3AB 3ARWA 1FZJB 4K9JA 4WO4D 4HZLA 1GC1C 2Y6SD 5IMKA 4ZFZB 3T0VA 4FQJH 1Q0XL 3O3EA 1BGXL 4R7XA 3SPHA 4FERA 8TLNE 1IBHA 2QVFB 4NHUB 3KEAA 3P7RE 5HGDB 5J9PB 3NBNA 1PCXA 2X4SA 5FT9A 2EIKB 3MR9B 4K7FB 2AITA 6CGTA 4HS6B 2WD0A 4Y6RA 1CTMA 1THCA 4R6UA 2EDDA 1LEKA 4PJDA 4XN5A 4FFWC 4I5BB 5LN8A 3CG8A 2Z4QB 2NY4D 3CQFA 4WEMB 1SFHA 4NAQA 1HYSC 1WPCA 2FBJL 2HVKA 2OSLB 2H8PA 3VWJA 3KEZA 1CCZA 2BSRA 4MLSA 4AQOA 3PXHA 5E8DL 3IMUA 4O2FA 2V7HB 4F8LA 4U33A 2FO7A 3US0A 3PEUB 2Z8RA 4RMQA 1UJKA 2NXPA 2EIZB 5GRXG 5A2LH 4YPGB 2WP3O 1MHHA 5HTSA 1FZJA 3Q0HA 5JO5B 5EF0A 2ZKXA 1D7FA 5IBUB 3TWVA 1S3KH 4JFPA 3NABL 4YPGA 1NFAA 1QBQA 1MCEA 3H6JA 2GT9B 1Y1DA 4NQVB 2CGZA 1PZ2A 1Y7VA 2BP5M 1WFOA 4H1LA 3ZHEA 4HJ0D 2C9UA 3DK0A 2R1YA 1EBAA 1FH5H 3JTSB 4KO9A 4WSGA 1CBJA 5E5MB 4YXKL 4A03A 5IHUL 4TUUA 2MCAA 1NEZA 4ZNEA 2A9MH 3KLHC 4IBVA 4NXSA 3DTXA 3EYOA 1FAIH 1PFOA 1ETZB 4RMTA 3KJ6H 1HU3A 5EU5A 4D0CA 4BSWA 5DVPA 4HKXA 3WMQA 4F7CB 4TTGA 4XX5A 4LVNB 3PPSA 4MNQB 5J8OA 3B9DA 1ETZA 2RG8A 2PW1B 2KH2B 1CLZH 1DO6A 1O6TA 4UQAA 3RX9A 4QRUA 4DGVH 1HCFX 3DHJA 3ARDB 5KBNC 2E47A 4GG6A 2C5DC 3VLDA 4HXIA 3JV0A 5INDA 5T3XL 4HUVA 1XX9C 2OV8A 4F33B 5MENB 5IJBC 3RDJA 1AR1C 4JW3A 1ED3B 1XAKA 2IOSA 3FDWA 3DIDA 1KCBA 3B4NA 4HLJA 1QVOB 4MBGA 3NJIA 5DJAB 1UH2A 4B27A 5IFJB 1NCCH 5FV1L 1MEXH 1QSFA 2R1YB 1FNEB 4WTZG 3RTQD 3ARGA 1IKNA 3O3BA 3IDJB 5CSBA 2FEDC 1SBSL 2GJJA 2O30A 2OMTA 3VSTA 4JGMA 5AIJA 4PJ7F 3TGXA 4D9LH 4I2XE 3DVFA 4IRSB 3BW9A 2K4WA 5KW9L 4UCFA 1M71A 4OCSH 4BH7A 3ATBA 1AP7A 4RGOL 4Y4FD 1U93A 3BEWB 4ZOCA 5I1IH 1WD9A 2QPEB 3HOGA 4AY6A 1X7SA 1UH3A 1PDKA 1IQWH 1CUOA 4NKOA 3DMMD 4WO4B 4WW2A 5DJYB 5FC9A 2ADFH 3RL2B 3QK0A 4LSRL 1H5BB 5JHAA 2F53A 5EDXA 5T1KD 1ZLUK 3E3QE 4I1PA 5FCSH 4KU1A 1MOEA 4W9EC 5AW5B 4AKPA 4GA1A 2X1PA 1H5BA 2VXVH 4Y19D 1SYVB 4JL0A 4M9PA 4PJ6A 2H3NA 2HG0A 4NBXB 2CRMA 5K39A 3T65A 1SM3H 1P53A 5L8JB 2FT6A 1S46A 2J09A 4LPWA 5BMFL 3VFVB 5DMJB 4QOKD 1VERA 5KYXB 4ZS6C 4JK0D 1LK2A 1EYHA 3GLAA 4A6YB 5F93C 2RAMA 2Y2WA 2MJWA 4PTTB 3KLAA 3LEXA 1U6AH 2PWHA 4Y2DD 3VGAC 3RRNB 5CCMA 2Y0SA 3ZTJG 1M4KA 2BERA 1JGUL 1OB1A 3QR2A 3QJVB 2R15A 3QNXB 2EIZA 1NCBL 4M3JA 1JXDA 3EJZD 3TWCH 4DP2X 1AFVH 3EOYG 3TA4D 4JDTH 4Y6CA 4M5ZH 4ATWA 1FUNA 4P9HH 3GMQA 1OSPH 1ZV2A 2X1WL 2G3MA 3E9TA 1BWWA 3L9EA 4PS8A 4RFOH 1YEEL 4QT5B 3EJJX 1SY6H 2DYPD 3IIEA 5KSUB 2NR6D 1SUHA 1IVLA 2FJGA 4NAMA 1CYXA 3TTYA 3EH5B 2IBGA 2VWEE 5C0ND 3ILPB 4FXGA 1OK8A 5ITFA 3EBGA 1N5AA 3GK8L 3VXRE 2CIIA 2VLRB 4WKZB 4FC8A 1S7XB 3QEQA 2E74C 4DGUA 2EDKA 4XCNB 4RGNE 4NUMA 4PGDA 3JVGA 4LCWE 5LJYH 4F7CA 4OLUL 1F1AA 4H26B 4HS3A 2P8MA 2IAMB 5I23A 1KG0A 2EILE 2ESVD 5FQ6A 4HIIB 3L95B 2ENYA 4PWIA 1KTRL 3AXIA 4IHBA 2AJSL 2E9WA 2NUPB 4UIMA 1N3NA 1DVFB 3TEWA 3LVTA 1E40A 1U91A 4GA0A 3BWUF 4OD1L 4DX6D 1JV5A 3JYBA 2BP8A 4XMKH 3B7YA 3DVNB 2DM7A 2A7BA 1UKSA 1AYOA 1Z9MA 3SYAA 4P5KB 5B1JA 4Z7OE 2VUKA 2DQCH 2EO1A 1FVEA 2FWOA 1O7SA 2VDLL 3MJ9A 3UXFA 2FFLA 4TUJB 5FQ8A 3DXMG 4BETA 1IGMH 3DKHA 1YDPB 3GK8H 3RZCC 3WHE1 3C09B 3OR6B 3ESKA 1UN8A 4I2XB 3I3BA 4JFDE 4G8EB 5L4FA 5LQBH 4GMJA 1N18A 4S1RH 4YDZA 1T20B 4L9PA 1G4RA 4Q7DA 3TBBA 1SF3A 1EHAA 2HRPH 5FR3A 1CF8H 2AEOA 1PD1A 2B1HH 2BSCA 3FCSA 3UEQA 1BLXB 4DI3A 1MF2L 4WCYL 4Y5YB 1JCSA 1P1ZA 3DO4A 4GQRA 4PJEF 2XLLA 5GXBB 4POYA 4J7RA 5J11C 2I9TA 3LHAA 4OQTA 2GBTA 1R34A 2P80D 3DXAE 4U1JA 5D70L 5HJ3A 1NCBH 4GS7C 3VQ2C 1LO2H 3S4SA 1QUNB 1S5IL 4KXAA 1PAZA 25C8H 4A1GA 4G6KH 2F54B 3BKYL 5I0ZA 2NW3B 4IBLT 3FTUA 4XC3L 3QRFM 3WFCL 2VOTA 5DRZA 4L2YA 3ZZSA 4JL2A 5AVUB 4BWTA 1DQDH 3OM3B 4S1SH 4A3VA 4YH6A 2O5ZL 1IT9H 1CWVA 2WWOA 4X6CA 3O45B 3AG2E 2DJSA 1BPLB 4DKDC 3ZE1B 5ACLA 5TPWH 1ORQB 3IMVA 1ZT1A 3F7VA 4FF9A 2H0PA 4KJWD 4IGBD 5AYTA 1PBYA 4OZIB 2BINA 4AIZA 1XGZA 1MDAA 3FN9A 1G7MA 3DHPA 4LP5A 5AOIA 2AJUL 3QUGA 2WUCL 4GB9A 4Y4KD 1JHKL 4K73A 4Z3TA 4NO3B 1KN4H 4APFA 4M7LH 1G7LB 2WNGA 5ICZB 1FO0A 3P40A 4JO1H 1T2QH 5F96L 1RP3A 4PUCA 1Q4NX 4I9WD 1E43A 4N90E 2HZHA 1IGIL 2GK0A 2R0ZL 3ZE0B 2H6HA 2NLJB 2V7NB 3D52A 3ZYMA 4JG0L 4NFBA 1P4IH 4O9HL 2FO8A 4TNVK 5CR8A 3WFBH 1TZHA 1KV7A 4AZ8B 2L7EA 5D4IA 4JO4L 2R02A 3C8DA 4AQ1A 1HWWA 3CFJA 4NCDA 2QKIC 5LBSH 2BSSB 4FCAA 4HORA 1BREA 4G2AA 3GJEA 2VH5H 3ETBJ 3TO4B 3GD1C 3BKYH 2TRYA 3HRPA 3FCQA 1OANA 5AOMA 4RLYA 3EYVA 4YDLB 1AGCA 2R2EB 5HI5D 5C0AB 1WBYB 3UCQA 1E0OB 4RMVA 4LSSH 2YQ3A 2F58L 3VFOA 3B95A 4ZUWA 4W6XB 1XH1A 3P2TA 5FINA 2LNIA 5ARGA 4LU5L 4M7ZC 2E7CA 4Z7NE 3HEIB 2J55A 1AWCB 5EBWA 4OJCA 3TV3H 1C1EH 4Y5XA 3CZEA 3BRGC 3G6JA 3GBEA 4TLKA 2PCPA 3KE0A 4A7VA 3TONA 3Q7JA 1NC2D 2RFXA 3ZKQD 4RMSA 1KJPA 1PZUB 1P5VA 4B96A 3SDXA 2KBGA 4ZUUB 2GAZA 4UANA 4Y89A 4LRZA 1YEHL 2XTJC 3BU8A 3D3VA 4HPOL 4Z0XA 3AROA 4X4KA 5G05J 1WAAF 1AP2B 4OLEA 2EUWA 2CDGA 1URIA 3RZWA 1BM7A 3WS6A 3RIBA 2QV4A 4EIGB 2VDPB 2AEPL 4L0PB 2BJMH 5KVEH 3E80A 4N3BA 1TJIL 2XGSA 3R4RA 3FUDA 4NI6A 3BG0B 2EC9U 3KWVA 3H2QA 5L9DL 5EEUA 3H2PA 1PAQA 1TJXA 3H85A 4NN6B 2OMVA 3ASNE 4ODUA 2VLLA 3BLPX 2GFBA 4G80B 4XTRD 4F7PA 3NCYS 2JJUA 1HQRB 4YX2L 3L4VA 3NH7H 1XGRB 4BEPA 1YSOA 1R46A 1A6VL 1KB5A 2I1JA 4Q6IA 2BFGA 4NC2B 1IAOB 2PW2B 2W8CA 3GIZH 4GA2A 4GINA 3S4SB 5IBLD 1DVSA 3KS0H 5F9JB 5EORL 1BQHB 5JLZA 3LPPA 2Z93A 3FY4A 3LS4H 3MUJA 5CLWA 5KZCD 1RULL 2XTSA 3X14B 4KQ0A 3D85A 2AABL 4U6VL 5IB1A 2OZ4H 1GSMA 1AYRA 3JZ7A 2VO5A 4HT1H 3E6HB 3O6KH 1ELWA 4GKLA 4IOSA 3T5WA 4R83A 2O6CA 3LEVL 1A14H 1VFMA 1EZVX 4FDWA 4IN3B 2ZE0A 3BC9A 2WLMA 4PW4A 1FPTL 3C6LB 3HG4A 1T83C 3S3CB 3D8MA 1WV7T 4GEJA 3FTXA 5GJTL 2WAQA 3DO0A 1YN7A 3U4BL 1JHTB 4FQHB 5CN1A 4CN6A 2QSTA 4GQ9L 4JJ5A 5DFWH 4XNZC 1NGPH 3ZQXA 1DBJH 4KJQD 4MDJB 1U8NA 5HHQA 2YWZA 4P9HC 1SN0A 2EDEA 4XP1L 1GY1A 3IXTA 4NT6A 4GEIA 4W9JC 4XP4L 5E6YA 3OXFA 1F5WA 4ETQA 2WHZA 3BN9C 2X10A 1SVCP 4NRYB 4TPRH 3TV3L 4ELMB 5DJXA 1OSYA 4X8XA 4DHLA 1T4KA 3MXVL 1TKWA 2NT0A 3OJDA 2NZ1A 3SQVA 4UDUB 2CG3A 1XZ0A 2UWJG 2R69H 4NKMA 3IS0X 3B2VH 4BK5A 5J13C 4KTDL 4L5FH 3BXNB 3H56A 5JXED 3ZKXC 2XWBB 3ZYZA 5EC2A 1PMYA 1F6AB 2B20A 3DIFA 1L3NA 5E23A 4DJAA 1G6RA 3BZ5A 3EZ8A 4RH4A 2JK5B 5HHPB 3FQNB 3ZX1A 5JDJA 1A3QA 4JN2A 3CLEL 4F57H 4TNVF 1YDPA 2QELA 3UGEA 3AQXA 3M7OA 1P1VA 3LZLA 3QWQB 3KYKH 1AP2A 2DJ4A 1FO0B 1JNNH 1LF8A 2WBJB 4FXTA 4HWBH 4J8FA 5J1SC 1VIWA 1NFIB 2QADD 2P9LG 2KCLA 4X4YA 2JVUA 2FJFA 3VFMB 3VW3L 2CSPA 5TF1L 4HI8A 4PJXB 1AZCA 2ZXQA 4PRHB 3DSVA 2C0MA 4DGIH 4OCYH 1MRFH 2WB1A 3P3RA 1QUNA 2HKAA 1MFDL 3FCBA 4AR8A 4QXWA 4XP9L 4F15C 3HS8A 4QTHB 3GXMA 3AG1E 4ANUA 3MDJA 2ESVE 1ZLEA 3B2VL 3D25A 3RGVC 3WFZA 3ASDA 3EAKA 5E6SB 4AG4H 3WFCH 3DUHA 2G3NA 3FH5A 4DX1A 1NAKL 3PWPE 3MMEB 4ZPTA 1T66C 5JDSB 4XMUA 4QQIA 4FG0A 5I18H 3GDCA 3OB0K 4A63A 5I8CA 4ABVA 1OPOA 1X3WA 1R6VA 1DQQB 1B2WH 2YUWA 2XRAL 4L4VA 3QBTB 4LAQL 4UTAA 3D0VB 3NJGA 2YD4A 1JHLH 3K7UA 5DGRA 3CV5A 3CVPA 4H2CA 5IHZA 3W37A 4DEPC 3TV8A 4TUOA 2X4NA 3ZGIA 4JD2G 4NRHB 4I1OB 1IRAY 5I73C 3WJJA 3VLFA 2NTSP 2W5PA 4GQ9H 5I76B 2YA1A 5LB1A 4AKQA 2VSYA 5EEYA 5C07D 4ANWA 2HP4A 4PJ9A 5AVTB 4ZMAT 1EX0A 3ZQWA 3HC3H 3I4RB 2X4TB 4YSSA 3MU3A 3FGDA 3N04A 4NUJB 2DM3A 2HJKB 3IU4H 3WIHL 2XQYA 2AGJH 3S3SA 2N7SA 3ARZA 4OT1H 3UJIL 3TBSB 4X80H 3ILDA 2BFVL 4QAWA 2JD1A 1RW2A 1D9KB 4I77L 3PGFH 1B9KA 2PUSA 1N95A 4DP8X 3Q8CA 1S9KC 1AHWB 3WTWA 2BCKB 1IGFH 4RIRA 3FCTA 5F7MC 4B60A 1T2XA 4AGPA 4MMZC 2IMMA 4MJID 2PR4H 3CVLA 3ZHDA 2B1AH 3ZR6A 5IG7B 1M7IB 1UGNA 3OXSA 3KEDA 4HDIB 4HXBH 4LPCA 4PWGA 3THMH 2AS5M 3VFNB 2X3MA 1X9LA 1TJFA 1N3NB 5I19L 2YNQA 1IC7L 5JOFB 1OAZH 4U8VD 2QQKH 3KYAA 5AFAA 1U8HA 1TQCC 4PRDB 4YXKH 2BKGA 2ZF9A 5MERA 3VFNA 1JF1A 2F68X 2WHVA 3BPNB 3J5PA 5AQ9A 3QQDA 3UPAA 1BX2A 1SF5A 4I0PB 4JRYE 5EZJB 5L0QB 2IAMD 4BSJA 5F89A 3COOA 1YNLL 3QCUH 5IB3A 1UATA 3TEUA 4NKDB 4MDIB 1UCBH 3ZDWA 2EYTB 3O4LD 5SWQA 2AEPH 4OZHB 3SBRA 1TOXA 5D1ZC 3QZNA 1QNIA 4OFVA 2Z91B 4LSVH 2RIKA 4DP4X 2P28B 1S7RA 5GGTA 1YUHB 1QSEA 1A4AA 2MAPA 4WAFA 2LFGA 3JUEA 2EYRA 2WP3T 3U0PA 1F4WH 1FGNH 2R7EB 4XOCA 4TULH 3IFLH 2GJRA 4JFYB 3WEOA 3IJSA 3PPEA 1Q1PA 5KN5B 2BLFA 2BP3A 2G30A 3NZ8B 3OD3A 4UYPA 3TIDB 5DQ9A 4I5BA 2EO7A 3FORA 3FQTA 1GGYA 3Q9NC 3O6FC 4FFVC 4PJBE 2Q9OA 3GSNH 3RGBA 5FW6A 1IC7H 2A74C 4OM0L 3QG6B 5EPMB 3I9GH 1ONOA 1Z0NA 3RWEB 5DEGB 4OI7A 4UWGA 5E0QA 2Q3ZA 4OLWH 2AABH 3NFPB 1I1AC 4K2UH 1KC5L 5F89B 3UCRA 4OCSL 1HKFA 3R9MA 1UD8A 4A63B 1M57B 3IETB 2IG2H 3I3DA 3QNYB 5I1HL 3I74A 1K5NB 3LS8A 4DW2H 3FS9A 2XSKA 4ILIA 4KJPD 4AVIA 4QWWC 1DJZA 3UG3A 4A39A 2PTTB 4L8BB 4BJLA 1J86A 2XX1A 1V10A 4PV9B 4DZ8B 4TXRA 1BPOA 1THAA 4FL4B 3IGKA 2QFCA 4URKA 2CAKA 1TJHH 3EFDL 5KJLA 5LNEA 3B13A 1DANU 3WY2A 1K3IA 5I0XA 1C08A 3IDJA 1PKQE 1IAIM 4G3YH 4NEHB 4WRLA 5MEQB 5BRZD 4G7RB 3AC0A 1TN8A 3JWOL 3ZTCC 3CTTA 2CKBL 3TIDA 1V3MA 1SDDA 2WYZA 4MHHG 4MZ2A 5C92A 3SGEH 1YMMB 1BD2A 1KB9J 4AH2B 3IMTA 3QAZC 2HKFH 3AUVA 1A3RH 3OKMB 4LEBA 5DA4A 3RHWF 2WGXA 4B8CB 2LAAA 5C0CB 4AK1A 2XY1A 1YECH 1A6ZA 3FK3A 3ZL2A 2NY0C 1I8IA 1DFBH 3PGCB 4X7CC 3GT6A 3K80A 1BFTA 4N22A 3V6OA 3BUIA 5E08L 1NGXA 3MLXH 2JQAA 5HHOE 3RTLA 3B8SA 2V2TA 2LT9A 4OU3A 3OKEA 2EH8L 1CFBA 1HINL 3G5VB 3DIFB 3LYAA 1DUZB 4JQVC 3UIYA 1KCSH 3TJEH 3TN0C 1KB5H 5T3ZE 4TM9A 3FOMB 3GGWB 2XV3A 2VQ2A 2CO2A 5LGHH 1H19A 3D25B 4QHNB 2XPIA 1CD1A 3CLEH 3U4EB 4F57L 2DYRB 1BVLA 2MFNA 3OKLA 5LBSL 2NXZC 2A83B 4IBWA 4PGCB 3FOMA 4OY9A 5HGHA 4AIFA 3RX5A 3WAKA 1L7TH 2OV0A 5DO2C 1VFBA 3QDGE 4Z3FA 5IMKB 1N94A 3RNKA 1VA9A 3T2JE 3BD3A 2BOCB 1SHSA 5BO0D 4K3JL 2KPWA 2OXHA 3HUJA 3ZXAC 3SKUD 1KCVH 1EV2E 3DSWA 3MCKA 3LXUX 3K4AA 4IRSA 3HVEA 3D51A 1MXDA 3L6FA 1R75A 4PUBH 4FMFA 4Z7VB 4E41D 1OE3A 5IJVA 3WQRA 3AITA 3CLFL 4O02H 2Z3FA 2CPCA 1MHEA 5I71C 3ZDXE 5B3SE 1YUHA 2JKNA 5D6DC 5E4EC 5AW3B 4BZ2L 4Z7NB 5F1NA 4AEIL 1NC2B 4ARFA 4FFYL 4KKBD 2LU7A 2IDQA 1A1OB 4MS8D 4OD1H 5JUEL 4N2FA 1PS3A 3ARFB 3O2WH 1IUZA 4K7PH 1JFQH 4JFZL 3VYNA 1SEQH 3AM8A 3LHPL 4XN7A 4HKJB 1PX4A 2D0GA 3CLJA 1V3LA 1ND0A 4NRXA 2C8NA 4UQ2A 1J7VR 3S34L 2BVOB 4L3EE 3GSVB 4XB8A 3MREA 3FUFA 2J07A 4JKKA 4NZJA 2V7HA 4NQCE 4YXHL 3ZXPA 1ZU2A 2A83A 3EHMA 2FHBA 4GI6A 4MA3A 4X4ZA 2QPFA 4AYFA 3NAWA 4H8PA 5J6GB 4HS8H 1YPZE 4AQ8A 3HG3A 4JB8P 4RETB 5B1CA 4NNPL 1KJOA 4EN3A 4G43A 4NN7C 4I4WB 1QR1B 5F1OB 3VO0A 2F8OA 1QACA 3SHSA 1GTNA 5IG7A 4C55A 1UCTA 3MNZB 3CKBA 1GKOA 1FZKB 4UQ9A 5BQ7B 1GMEA 3WHXA 1J87A 4QFVA 4OCWL 4GW5B 3IEAA 4X6DF 2VLMD 4ZYKA 1WFUA 4WU5B 2H4EA 3PL6A 3P73B 3APNA 12E8L 3OX8B 5T1DL 2ALAA 3QH1A 4EO5A 4PJCE 2BVUA 2VB5A 2IEPA 5J9PA 1QF0A 3DA0A 4X9IA 4ZOBA 5GSRA 5IWLA 5IB4B 5J56B 4M61A 1QTSA 1D9KA 4FFYH 3INOA 1SMDA 4G9DB 1UENA 5AZEL 1U3JA 4KKCC 3EH3B 4X50A 1ORSB 4BKSC 3IJSB 4JKLA 3H6AA 3C98A 4KT6B 4MDJA 5HHQB 3WHE0 1DZ0A 1JWMA 2X4QB 1GGBL 1KBBA 1WD8A 2DQHL 1GL4B 3TFKD 1NFDA 2P7TB 4TUMA 5C0CE 2FBNA 3VXPA 1DQLL 5IVXA 2XVBA 3Q5MA 3QWRA 5FYKL 2B6CA 3NIFE 4HS8L 4MZNE 5FA3A 4KVMA 5AW4B 3QUML 3CZKA 2Q7FA 4W81A 3D4ZA 4LEEA 1DVZA 1RK1A 1VACA 4ACTA 3TVMA 5J13B 4JFEB 1E6OL 3T73A 1NMCB 4YVNA 2ZF8A 5FUZL 4XZUA 2R8SH 1S7WA 4HEMA 5CINH 5CP3A 3LQAH 4NQUA 1CFVH 4QXTA 3TCTA 1LNBE 3NJMA 1G9MC 3FT2B 3DX1A 4B9FA 4XOAA 1Z9OA 4KC3B 5IQ9B 3Q48A 3L16A 3E2HB 4X5QA 1RP9A 1NC4A 3GYRA 1CFNA 2VXQH 4AGOA 2X6AA 2X4PB 4WUUE 3FFCD 2ZWLT 4YGAB 2CO1A 2X1QA 2DMHA 3NK4A 2OW7A 1WFIA 3QUYA 1FI8C 4K3EH 4U4BA 4KPHH 1XSKA 2W9DL 2B39A 3AAZB 1NZRA 3FQRB 5DBKA 1UWGL 2F58H 6PAZA 4JFYA 2CO3A 2MTPA 2WUBH 4M5YH 2WBJA 3DPYA 2YQBA 3CQQA 2DS4A 2C2LA 4AV0A 4P5TC 2D7TH 3TOPA 5ICZA 1R47A 1XR8A 4PJCF 1XH3A 2LSVA 5TGBA 3MRHB 4K3DL 2AJVH 1RJYA 4UNIA 3SBPA 1JPTL 5MENE 5DCCA 2VMJA 2WCSA 2EKSB 4WWKC 1MIEH 4HBQA 5D71L 3U1QA 2FEJA 5CBEA 3N42B 5EILA 4HUWA 5A7EA 2FNBA 4MQSB 3HAEA 3HPLA 5T5FL 2X6VA 2VSNA 3NIGB 1U3NA 4TLNA 3X3FH 1A5FH 1UOWA 4HH8A 4YSAA 2FJUB 3VW3H 5B3NA 2JLLA 1XD1A 3MBEC 1CFQA 4FLOA 1FORL 1EO8L 1O6VA 3O6LL 4R9HA 4ME2A 3POCA 2X6UA 3WUZA 2F74B 5KS9A 3L5WA 1W8OA 4JY6A 1FA4A 1HC1A 4QDGA 5D1XA 4APQC 3GMNA 1V8HA 1JSYA 5HHMB 3SDCA 1FG2B 1QEWB 4ONHA 4HAKA 2H32A 5BS0B 3C60A 1QX1A 2DYSE 3LQMA 4BKTC 4GZDA 3IM1A 5JYLA 1IC0A 1Z9LA 3N1MC 1BPVA 3ETBF 1W91A 4JDVB 4I2ZA 1JF5A 1UXMA 2WCPA 1MUJB 3GSOB 2J4BA 3MRFB 3H0TA 2JJTA 3V2OA 4V2CB 3IDUA 2J4WH 3MGTB 5FKAB 2UY1B 1YECL 4R7LA 2G9HB 2Z31A 3EGDA 1LEIB 1HL4A 1P0SE 3V6FB 2WLKA 2WJ5A 3N85L 4I3SL 1G5GA 2DWTA 3A4EA 5CAYB 2MKWA 4AE1A 2YAHA 4GRWB 3G5YB 2RJIA 4KQ4L 3HE7A 3VCLB 3BESR 2VSCA 5AVRB 1CICD 2FYYA 4MDRA 2LVCA 3E30A 1TYJA 2R23A 1WAPA 1BD2E 3FDHA 3IPFA 2J8UB 5C09D 3V0FA 4M6OH 5E8PA 5A43C 4KXZH 2QJ1A 5C97A 4U1HA 2VXTH 4KGLA 3UJIH 4LAJH 1AOZA 2KZTB 4IKJA 4LLQA 2RKKA 3DPDA 4W9GC 4JG9A 1LO4L 2PO6A 4PWEA 2NY5C 5F9JA 3AU1B 1MFEL 3VNZA 1QPXA 3L1FA 1MUJA 1UG9A 4TRPL 1ZLUH 1KIRB 1TQUA 4UOQA 1RZQA 5K1NA 5ERWB 4GQQA 4XP1H 2B1AL 2ODHA 3QJQB 5D1QB 1RZIB 1I9JH 3ISYA 4H25B 5DPEE 5DO8A 2IJ0C 4IJTA 4Y2DB 1RSFA 3S8FB 2IEJA 3IK2A 4QOKA 2SODB 4RGNB 2M63A 5JPNC 2ZD0A 1AAJA 3OKNA 4B50A 2OL3L 3GPSA 2J6EL 1IQDB 1EJ8A 1TNZA 2AXJA 1G9NH 2WWKO 4UV7H 1WZ1L 4X9HA 5GZOD 3C6LA 4W9RA 4I0KA 2R2HB 3CCHA 2ZUXA 2I5YH 2BRRL 2PCYA 4AY0A 1BVOA 1BIIA 4PGEB 1SJEA 4W70A 2Y4UA 3ESPA 2ICEB 1C9SA 4ZFOA 5DZAA 5ISZE 5E75A 4JQIA 4WQOA 4NO3A 3VUAA 2XA3A 3LZOA 4LKXB 4QJ4B 2GJ6A 4QXVA 4CW1B 1UOHA 2J6WA 1E42A 2F08A 3BH9A 4QNPF 3QIBD 5A2JH 1PSKL 4DO6A 4U3CA 1VPOL 2WCGA 2E6QA 4QEGA 1RZKL 3ARBB 2FDBP 5F0PB 2XQYG 3TWTA 1A8JH 5DYOB 5IW6B 1HZKA 2E9BA 3R0NA 1WBZA 2VN4A 4LOFA 4JS7A 2NSZA 2MCG1 1FO0L 5HGAB 4GKNB 1XL4A 3HBQA 3DX8B 5JPNB 3EOAB 5EU7E 2TLIA 2XTJE 2V3EA 1R24A 3IGFA 1LE5A 4BUHA 5D1XB 3AS1A 1HSBB 3QUXC 4QRSA 3HUJF 4NGHL 5DZPA 4F80A 5E2TL 3MOQA 1AGBB 5DZVA 1AGFA 3RPKA 3HXEA 2XQBL 2JH2A 4YLBA 3SKOB 3NACH 5FM8A 1TIUA 1RIHH 3HRZC 4HX1A 5I6MA 5IVZB 4NFDA 4AUYA 4WDIA 5K69A 4ABQA 1JNJA 4KYOB 5KWDA 3DROB 2WZFA 4ILGA 4PLKD 5MEPA 5E8NB 4D10C 2AK1L 4J3BA 1N67A 2EXWC 4G8EA 4PV8B 2XRAH 1CLZL 3FULA 1K4DA 2ILRA 4WW2C 1JHLL 3NQZB 3ZNGA 2PLTA 2Y22A 5E56A 4I85A 3ZGQA 4X9GA 5LN4A 3ZKXB 4PV8A 2OTUA 1RZKH 1MG3C 4G3YL 1BD2D 1SEBA 4GBXD 4FMVA 1HNYA 4PP1C 3UT8A 1DQMH 1OL0A 3BN3B 3QQXA 4TNEA 4MNHA 4L1BA 4NNXA 4HEPG 3NZHH 3BE1H 1H5BC 4ADIA 5C3LD 3B2XA 1J9CT 2WMPB 4EBAA 3OG4B 4P2QA 2BNRD 3EFFA 4EF3A 1A3RL 5KVGH 2Z92B 5CCGE 2C9XA 3ZBMA 3M17A 1P7QD 2F54A 3C2SA 4U7KA 4A2FA 4CU8A 3HCVA 2GBAA 4PTUB 1CFNB 2BNQD 2E7DA 5CIPB 4JFUA 1BVLB 1YEGH 5FYKU 1H2VC 4UF7C 2Z7ZA 4LRIA 4M5TA 5C1DA 2ZOWA 4TOYH 2IXQA 1NEUA 4JDVA 1E4WL 4PJEE 4ONFH 4J8YA 5I1IL 1KXVA 4FQCL 1O7DE 2RCSL 5J1TC 4X5WA 3JUYA 4NO2B 1RZ8A 2QSVA 3KDPB 3TA3C 3CDFA 1F3JA 4ZZKA 2R4RL 3PUJA 5I6PA 4WEUD 2G2PA 5JZ7C 5E24E 1DE4B 1KEIA 2CIIB 4WKZA 3EIQC 2H6FA 2A1WL 5F1NB 3FTVA 1OSZB 1HH9B 2D4DA 3L3HA 4GT0A 4FXGC 2C7FA 2PCXA 1KT0A 4L8DA 1FFTB 1C8PA 3HAEB 3HPLB 2ED9A 2WSKA 4BFFA 1WWCA 3MFFB 4UILL 3AS0A 1KPRA 2NQDA 2AXZA 1CVRA 3RWFA 4ALAH 1IILE 4LRNL 4PREB 4XWOC 2PCPB 3MV11 4ORZC 1JRHI 3OTTA 3QYMA 3FOLA 5IV2B 4G8AC 4RGMC 3QEQE 2VISA 4JKMA 3RASA 5C08A 2JJWA 2MQCA 3FZUC 4BX9A 2HA1A 4LLYA 3WGUB 3FYEB 2NTFB 4DEUA 5A6LA 4AEFA 5B39B 4K90A 1JZJA 3B5TA 5FTPA 3O2DH 3REVB 3MNZA 3TYGH 4KQ3H 4N6RB 4FGMA 4LEUA 4PVNA 4X6BB 3WHXB 1AHKA 3Q9UC 2I07B 2D7QA 4QMEA 3LQZB 3B9KC 1NAML 4A1SA 1PEZA 1EHNA 1A65A 1W0YT 3BZDA 5C7XH 3MEKA 4LLVB 1BYPA 1ZHLB 2XNAB 4APXA 3ILPA 4FXGB 5ITFB 2VXQA 4JA7A 4I2XA 2YD8A 4Z7QE 4H1LB 4LGPB 3KDMA 1A7QH 4BQ6A 3GLZA 5A3IC 2XIIA 1YY8A 1R0LA 5IW1B 4H40A 4JN1H 2FLBT 4LDOB 1A1NA 2XEVA 4LLMA 5L41E 2ID5A 2ADJB 3GI8H 3Q1EA 1F6FB 5B3JE 4WO4C 1T1WB 4XB7A 3W2DL 4YHNB 3MLWL 1TJMA 2JCWA 1UWEL 5F7HA 1PYWA 3FT4A 1UASA 5G04J 1CN4A 4HG4K 1PKQB 1EXGA 1LO3H 1LO4H 4WY7H 4ZMVA 1A3LL 3GXNA 3WMPA 3MUGB 4NQDB 5DJ2B 3KMDA 1FT2A 4FQXA 43CAA 5BW7A 1QFUL 5BXFB 4GIPD 2PTVA 4LP4A 3LKOA 4W9LC 1E4XH 1MVUB 2VW7A 4HHAA 4IMLA 5KJ7E 2Z34A 1I9JL 3W39A 4YHKL 4K89A 1BVNP 3UYOD 1DEDA 1N0XL 4GZ3A 1PZDA 1GA2A 1I31A 3RX7A 4AV5A 3ZQ9A 1DFBL 3KPSD 4PB0L 3T2NL 1L6ZA 5IF0A 4X2UA 4L8BA 5D7LD 3MGOA 3U2SB 2D03H 5JORB 1HCZA 3VD9A 2DZNA 4LDCA 1PY9A 2BS9A 4ODTH 1CXLA 5FKPA 5IROA 2FK9A 3ENEA 4IGBB 5AAWC 5I6XC 1E9QB 5KBAA 5EU3B 5IZ7A 4PG2C 4IBUA 1QHOA 3GUFA 5A7DB 4BH7B 3BEWA 1NCOA 1FSKC 4HH9A 1NGWA 3RWDB 1A6PA 3ML8A 3D9OA 4TNWF 4WFEE 3AU5A 4WNGA 4OJYA 3UTTD 3ZEFA 4JHJA 2C9VA 2WQSA 4P23D 5C0DA 2X5PA 1OXJA 2O5YH 3MV9D 3DIVA 4TLUA 4YL4A 2P8LA 5DJDB 4DF9A 4K3EL 5ADOH 3ULUC 2X2IA 3RB7A 2NCMA 2IGTA 4AQ1C 2VITA 3MA5A 4QO1A 3MRKB 1F2XK 3NCXA 5DUPH 5F7BA 5MHSE 5MI0B 4Y2LA 5JMRA 3MRIA 1IT9L 3IT8D 4MD0A 3TBWB 1OWNA 4HZ1A 2DH3A 5CCKH 3GKZA 2KCKA 4HOUA 4M6NL 5DUMH 4N0CC 2WXHA 1G9HA 5JW4R 1MI5A 1KGCD 4X9YA 1ODAA 2EZ0C 1IM3B 3OKKB 4FNPA 4FTVD 1XHHA 1M1XA 1I8AA 1PZCA 4YDVA 2NXYD 2YWYA 1BOYA 2WZAA 4WI8A 4ES8A 4R2GD 2UZIL 1DQQA 3EYUL 4J23A 4GYWA 5KVDH 3VJ6A 3ISMC 3WKPA 4UT9A 4PRPB 2FQFA 3AACA 3PFQA 3ZE1F 2ZGGA 2VQ1B 4KK9C 2RQ8A 3QHFL 2ETCA 1F86A 4R90H 3NAAL 3PUUA 1NMAH 2DKMA 4D9QD 1WC7A 4X6CF 1KDJA 3QNZB 2VSXE 2YBRB 5I16B 4Y5VC 4YBQC 1HOCB 5CJOH 1GJIA 1TITA 4B9PA 3DX9A 4HOXA 3NEOA 2OP4L 5C0IA 4RRPM 1YEJH 1UM6H 1WFJA 3MX0A 3DETD 3VM5A 4LVHB 4JX0A 4Y8DC 2R4SH 1FNLA 1HFUA 1NZNA 3QG7H 3MLPA 2ADGB 2X6FA 1XV8A 4XNYH 3HR5A 2EJ1A 2NPLX 4OLXH 1J0YA 1ACXA 4GAYA 2ERJB 3HNTH 4PV1C 1LNUA 3VMPA 1N0XH 3ZTJH 3GSNL 1RZJL 4GZCA 2X89A 3SGHA 3D09A 4P4KB 3IFPA 4A37A 1W6WA 3QS3A 2N0MA 8TLIA 2R29L 4UTBH 4WHCA 3F2LA 2ZCHH 5D7JD 3QEQD 1XBRA 2ZYHA 4E5XB 1LQBC 1OTUC 1PIGA 3W0WA 4CDMA 1SY6L 1VDGA 3ZLQC 1G0XA 1NEPA 3QHZL 4IJ3B 1EANA 3SCMC 2M2DA 1KCUL 5C09B 3WYRA 1D2PA 5AQBA 1R3LB 3VG9C 1CR9L 1ZHLA 2WBJD 1X5HA 4Y2DC 3SY0B 5DTFA 4WV1B 4KI5F 1HAWA 5E6ID 2A0LD 2NMSA 3QUMH 2EEDA 1EZMA 1BQBA 3BSZL 4M00A 4P2OD 1NSNH 1X5KA 3ESUF 4BCXA 3X1NA 4A6YL 5F3BA 2Z7YA 4FQIL 4ZFGL 1IVTA 5J0BA 5DJ6A 2XZTG 2R0KL 3QR1A 5JHDD 1JZ4A 5CU5A 3WN5A 5AVQB 2NY4B 2PP9A 4MJIE 2VZOA 1KTKE 2OXGA 3CMOH 4AP2A 5D4HA 3U0PB 3WFEH 4WI0A 2CALA 1WTLA 4KFZC 1QTPA 2JF1A 3LCYA 4FQHA 2BFVH 2AXWA 2ARJA 1AJ7H 3RVXC 2K3TA 3BH9B 4DETA 4LLAA 5IFAL 3QS2A 1YJDH 3SGEI 3VE0A 5E08H 3UINC 2OZ4L 2ADIB 2YJQA 4JZNA 3SDXE 3V10A 1EFXA 3ME0B 3V2XA 5F88B 1T1WA 1JDAA 4YHNA 1UURA 1QZ1A 1E5BA 3HZYA 1F3DH 3F7QA 3CN2A 2VDQH 3CHPA 2QC9A 1AIZA 2NDFA 4K5AB 1DSWA 1PG7X 3KNBA 3A67L 4JRFA 4XPAL 1XFPA 2FX9L 5JHMA 3NK3A 2WJ7A 5DPFE 5TLIA 3MCLL 4N0FB 5K93A 1JF1B 3RVVD 4PJGE 3QRGH 4UM9A 2J6EA 1L5GB 1BZ7A 4BQ8A 4QRSB 4DNLA 2D8KA 3F64A 4ORGB 1XGYL 4K5LA 2ITCB 4YE4L 5FM4A 3D18A 1IFRA 1J0IA 2NX5E 1M2VA 4HJJH 5EZOH 3HB3C 3WL9A 1HH6B 4JO2L 4MCMA 3ARGD 3POHA 4WTQA 4B0MM 4K0RA 2ZAIA 6FABH 2QHLA 4WNEA 3KXFB 3ARDC 4D8PB 1WUZA 3CLFH 4O02L 3LDBC 3CVIH 3JV4B 4LL9A 4EUPG 2VZ3A 1U8QB 1YAIA 3QDMA 4XPGH 1OUVA 3QCVH 5CMAA 5FYJL 3T1WA 3I9AA 1AR1B 4QCIB 2C9SA 4L4TA 2CDEB 4WJG3 3OKMA 1BIHA 1KBWA 2WWNA 4P2QD 1JXFA 4X83A 1AZZC 2OQJB 3GRGA 3FONA 3ULYA 4FQQA 6PCYA 1R3IH 4H0HB 4MKTA 1NKRA 4X99A 4Y19A 1MSPA 1MJUH 4U1NB 4DO5A 4CA4A 2GGFA 1OTSD 2WAHA 3WIIH 2VM3A 1CXIA 3ZN3A 1S78C 2D7OA 5CILL 1Y1UA 3SY2A 1J8HD 5GGSB 1SYSA 3QYCA 3WXVL 3QJRB 1ZDQA 4B9ZA 1OCRE 5IHZB 1O6SB 5KYYA 3UP6A 4N2MA 1RK0A 2J12B 1XGYH 4R8WL 3G6JB 4QYOB 5HDRA 4DESA 4PY7B 4HSQA 5D7JB 1OWOA 2EDHA 2E3VA 3LPFA 2EXTA 3VRIB 2GRMA 1JNNL 4EN2A 3DO3A 2BIOA 3D4CA 4PJ9B 3MA9L 1DBMH 4HCGA 3ATFA 3S5LB 3Q6GL 3QO0A 3A22A 3MRGB 4P99A 1M56B 3HIZA 4KRMB 1KNOA 2ZOTA 5KNHD 3RKPA 3QWRD 1J1XL 1OAKH 2OW6A 4XNMA 2ZONA 3UAEA 2J9QA 1U3YA 2VIRA 2YRLA 3SPVB 5I17B 4GYBA 3WG7E 4OCXH 4HUXB 3RU8L 2B9BA 1KCRH 3L3GA 1C5BL 5A16B 4L8SA 4AJWA 5ITZF 4LARL 5DLMH 4XMPH 4S11A 2ZUVA 4NQED 2F37A 4KRPD 1NANI 4MD5B 3T4YA 1G7IB 1C16B 3OC8A 4GG6F 2WLZA 1YAZA 2P5WE 1LNFE 4XNZB 2VERN 4YGVA 4DGYH 2PETA 1AI1H 4G1MA 1S3KL 3D7PA 3A6CH 2CBPA 3B3IA 4AQEA 1ZV5A 2FWSA 5FLVA 4JFHD 1ZS8B 2PUQT 4KVCL 4PJ5D 1N5YH 1DSFL 1SJVA 1IM9B 4XP6L 3UPVA 3WY3A 4QRPB 2P5WB 4NKIL 1IGTA 1TVHB 3A3YB 5AJLA 1U8PA 3FN0H 1KEGH 2CJ3A 4YE4H 3FU5A 4TXVB 4YIQA 2DI7A 1T5WB 5DRNA 3VSUA 5EZIH 1BP3B 4UB0H 1K8KG 2DM4A 4KH9A 4UIKH 3JT1A 3QXDA 4Z7WA 4X7SH 4L3CB 4PJ8B 1FYTB 4HKZA 3GUTB 3TTSA 2ZUUA 3SOBL 2VMDA 3UIPC 1HYSD 2HLFD 2ZG1A 3GMPB 3N0PB 4CYMD 5GRUH 1FIEA 2BVPB 5DEFB 1EEYA 3B2UC 4TVPL 5E8EB 4PBVC 4XE5B 3OZKA 4F37F 3V7MA 3HZVB 1U3HC 2YMTA 2ZQKA 2HKHL 1H3LA 5J5EA 1JZIA 5ENSD 1TNOA 5I5JA 4KZEH 5EOTB 1S9VA 4OM1H 3HS9A 3ASGA 1IGYB 3NH7L 2Z35A 4LHQB 2BO0A 2X44D 5I1DA 2YFNA 4E2OA 1BVNT 3PWVB 1U8NB 2H2SC 5I74C 1K3ZA 2FYYB 5EULV 4ILDA 3ESNA 4JRYB 4ZAKA 4EIZC 5I1JH 4NQ0A 5L4JA 2MCPL 4X6DE 2WLNA 3LS4L 1YN6B 2B0OE 2X6HA 3MLYH 5A2BA 4AI7A 1EO7A 3V79C 3WTSA 2DW5A 4UZGA 2IGFL 5KSAA 3CVDA 3WKML 4XI0A 2A5EA 1QSFD 4Y7MA 3G6AA 1GGCH 3VXTA 1ZE3H 2WBWB 1I3GH 3TT1H 2XOTA 5GISH 4YWGH 3L5HA 4Q96A 5IEHA 2IU1A 2P46B 3QPQC 3KEHA 2WANA 4K7PX 4N2EA 5DQDH 4MFHA 2SEBB 3CK8A 4MTWE 1A4KB 3C5ZA 3S8WA 4GMTH 2JV6A 4XH2B 3RWIA 1GXWA 4O60A 2PABA 1AHMA 3RO2A 4OF5A 4JHAL 3GRWH 2C4FU 2CCWA 1HSBA 4U6HB 3GXDA 3WXWL 4NJAH 3LN9A 4FQLL 5E4AA 2HFGH 1JUFA 1LP9A 2CK0H 3MYJA 3RVTC 2D0FA 2OA9A 2WVVB 4LNVA 2NNRA 2I85A 1ODUA 2D4FA 4NZRH 5JW4N 5ISZD 4U0UA 4G42A 3K2IA 5G4MA 3VX0A 4BXVA 3FHAA 5LIFE 4DKFH 1Q0HA 1DSYA 3AUAA 2PO6D 5INCB 1SLWA 2NLJA 3T4AC 1PZ3A 4WHDA 3FB8A 3WO4B 4UI9J 2R69L 2GROB 2Y7OA 3O2VL 2DQIH 4AW7A 2J5WA 3MRLA 1TZIA 3AB0B 5E1GA 5ESVB 1HZHL 1DC2A 2XZCH 5DC0A 2ROYA 5IW6A 3KPQB 3U0TB 1JERA 2ED6A 5HXMA 1HQ4A 5KBMA 5DFVC 1IB5A 1KJ3L 3EBHA 1LYQA 1OD7A 4H0IA 4P57B 1MCPH 4DKEH 5EIQA 1WS7A 1U33A 3QRGL 4XP5H 3KH4A 5DD0H 4FLQA 3EHQA 1AZRA 1GYWA 5CD3B 3O45A 3A4FA 5B39G 3KYKL 4JL1A 4WNQB 3VTXA 1WG0A 2XS1A 3EU9A 2WWKT 1RIUL 3TM6A 5ABDE 3ALXA 3GSUA 3P7TE 1E3XA 3QIBA 1HN1A 3F5WA 4Y8AA 5KUMA 2H32B 1OSEA 5CCKL 1KIRA 3WJMA 4I0CC 3AQDA 4PCSA 4TQPA 4R26L 4DKFL 5FUCE 3RRMB 3CFEA 5D1QC 1SOXA 4FKEA 1KT2B 2B7DT 3LB6D 5D5MF 3WJMB 1NCAL 4XP9H 3MKQA 3QORB 1AVAA 2IOLA 3OLDA 4V33A 4AZ8A 2YK1H 3DO7B 4NACA 1MJUL 1UKQA 2YPKA 2X7LA 1JWSB 2Z7UA 3OHXB 1ZVSA 1W16A 1S7XA 1IQUA 1KZQA 2P47B 2V5QC 3HMWH 1J1OL 2WM9A 5D0OD 4QIRA 2XN9D 3CSTA 2ICWJ 5KSBE 4HRNA 2F8XC 1IGTB 3URZA 4X8QA 1PEWA 2EIEA 4PJHE 1NLBH 2ZKWA 1KN2H 3CHSA 1GSKA 3MJ7B 4U96D 2PN5A 4OF7A 4AZUA 5KBDA 5HYSA 3RYMA 3K71A 2IPUK 2I26N 4WUUB 2BVQA 2J4DA 4M56A 4Q0XH 4DEPB 3TH4T 4WJKB 1UTDA 1ZS8A 2BDNH 3RGVD 1WAAE 4Y1AD 4AYDC 3HG5A 1IAKA 4UAHA 4LNRB 5I1LB 4DSYA 5EA0H 5IFHH 1ECZA 4KKAD 4ZQHA 4IRZL 3I4GA 1E7UA 1G5AA 3FRPA 1JV5B 2AAAA 3IDGA 2KDYA 1J1PH 5DD3H 5DLLA 1NC4B 1OEZW 4QRBA 5IBTH 5IB4A 4AX3A 3P9LA 1JZ3A 2UWEA 2FGWL 2ZXGA 4MAZA 2BY0A 1BSIA 2LVEA 3LZFH 3FAWA 5DTFB 4M1CC 4LF3B 3V2AR 1OHQA 3ASNB 3H0TB 4U6VH 4MCZB 3LS5H 3SBTB 1IGYA 2GRNB 4Y6SA 1EHXA 4G83A 1P1ZB 4HLZG 2DY2A 2Q7YB 1OCWL 2YPVH 1FJWA 5EU5B 3QWWA 1XIWA 2APTA 4HKJA 5KANG 4CL7A 1P9MA 1ZGLB 3Q15A 3PQYD