2XPZA

Structure of native yeast lta4 hydrolase
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
632
structure length
627
Chain Sequence
MLPLSIEQRRPSRSPEYDQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGKPYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESPLPVVFSGIRIEDTDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIHGEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEILDSVDWETWLYKPGMPPRPHFITALADNVYQLADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVDRRLALATFDKFKDTYHPICKALVKQDLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUKOTRIENE A-4 HYDROLASE
publication title A Leukotriene A(4) Hydrolase-Related Aminopeptidase from Yeast Undergoes Induced Fit Upon Inhibitor Binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 205
structure length 627
sequence length 632
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01433 Peptidase_M1 Peptidase family M1 domain
A PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal
A PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.10 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease Domain 2 2xpzA03
1.10.1740.60 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2xpzA02
1.25.40.320 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xpzA04
2.60.40.1730 Mainly Beta Sandwich Immunoglobulin-like tricorn interacting facor f3 domain 2xpzA01
1KEIA 3TLIA 3CHPA 3T8VA 1HS6A 4Q4EA 3EBGA 3NQZB 1QF1A 4PVBA 4QIRA 3QGOA 4X2UA 4MS6A 4Z7IA 4MZNE 4XNDA 5DLHA 3T74A 1H19A 5C97A 4XO4A 1TLXA 2DQMA 3FUDA 2VJ8A 4TNLA 4FKHA 1QF0A 3P7QE 1GXWA 4MXJE 3QH1A 4K5PA 3P7VE 2A7GE 3P7PE 1HYTA 4TMNE 3DNZA 3QNFA 3FXPA 4ZX6A 1LNEE 3FTZA 7TLIA 1TMNE 3FBOA 3FUJA 3FUIA 3FTXA 4XN1A 5JXNE 1OS0A 4XMWA 5AENA 4R7LA 4KXAA 4FKKA 1Z9GE 5FSPA 4KX7A 1KKKA 4XN7A 3B7RL 1LNBE 3P7TE 3NQXA 1KTOA 4FYSA 3FH7A 3FCQA 4FYQA 4XNAA 5LDSA 3Q44A 4N5PE 3NN7A 8TLNE 3FULA 2WHZA 1NPCA 3CHOA 4B52A 4R5VA 4MKTA 4ZW7A 4XN9A 2XPYA 2HPOA 1U4GA 5A3YA 3MS3A 5BPPA 1L3FE 3P7RE 6TLIA 4KX8A 3MSNA 4XMTA 3FH8A 3FU0A 1LNAE 3CHSA 4WZ9A 3SE6A 4E36A 5L8PE 3P7SE 1FJOA 1LNFE 4D91A 5LWDE 5LHDA 4RVBA 4TLNA 1FJQA 3FUHA 4XMUA 5J6SA 3FORA 4ZW5A 7TLNA 3CHQA 4XN2A 2XQ0A 3T8HA 3FTVA 1ESPA 5CU5A 4ZW8A 3KEDA 3CIAA 3F28A 1SQMA 3B2PA 4FKEA 1Z1WA 1LNDE 4OW3A 4PW4A 3T8FA 1FJVA 4ZW3A 4FYRA 3B7UX 3DO2A 5TLIA 4XN5A 1QF2A 3FU5A 1PE7A 2G4ZA 4TLIA 3FXSA 4P8QA 5DPFE 5K1VA 3QH5A 3FTWA 8TLIA 1KS7A 3NQYB 4K5MA 4H57A 5DYFA 3FU3A 3TMNE 1TLPE 1LNCE 3T8DA 5FWQA 4ZX5A 5DPEE 5K7TA 2DQ6A 1EZMA 3B7SA 4HOMA 5JT9E 3FU6A 1TRLA 4J3BA 3T2HE 5LG6A 4XN8A 1Y3GE 3FB0A 4XO3A 3Q43A 5JSSE 4KX9A 4ZW6A 4L2LA 5FSJA 4XO5A 4PJ6A 2TLXA 4XMVA 4R5XA 3B7TA 1GW6A 2ZXGA 3EBHA 5JS3E 4K5NA 3DO0A 3FTUA 4KXDA 3QJXA 5DLLA 3FUKA 3T8CA 4OU3A 5AB0A 3SSBA 3FUFA 3LS7A 3P7WE 3T73A 5FSSA 3FHEA 3N21A 3DO1A 4M65A 3FGDA 3FUNA 2TLIA 4QPEA 3B34A 3B37A 4ZX3A 3FUEA 4QMEA 3MDJA 1ZDPE 3B2XA 1TLIA 4XNBA 4KXCA 1THLA 3FUMA 4ZX4A 3B3BA 3FH5A 4GAAA 2R59A 4R5TA 4N66E 3F2PA 3EBIA 4GERA 4K5LA 2HPTA 4XN4A 1PE8A 4K90A 4NZ8A 3DBKA 4XMZA 2GTQA 4MWPE 1FJWA 4K5OA 6TMNE 4DPRA 4F5CA 3U9WA 3FV4A 2WI0A 4K89A 3EIMA 1BQBA 3MSAA 4PU2A 5L3UE 4NAQA 4FYTA 4OI5E 5L41E 1KJOA 3P7UE 1KJPA 4XMXA 4N4EE 3T8GA 5HQDA 3Q7JA 5TLNA 3CHRA 4QHPA 3T2IE 2TMNE 1KR6A 1KL6A 3T87A 4KXBA 3FLFA 3FVPA 4MTWE 2YD0A 3FTSA 5FXNA 3PUUA 1KROA 4Q4IA 4QUOA 3MSFA 2XPZA 3ZI6A 4RSYA 4ZQTA 4JBSA 5LIFE 2VQXA 1FJTA 3FTYA 5AB2A 5TMNE 1Z5HA 1FJ3A 3T2JE 1FJUA 5JVIE 1PE5A 4D9WA
chains in the Genus database with same CATH superfamily
1S8DB 1YNLH 2Z7YA 4S11A 2XEVA 3U2SB 3PWJB 5JW3H 1PAZA 3KS0J 3T8VA 1MJ8L 2VH5L 4L9LB 4N1EA 3VSUA 5JPNB 1KJ3L 3EBGA 4QRRE 3MGTA 4PBWD 2OMZB 4PJDB 5D71L 4MCZB 1Z32X 5GRUH 2PXYC 3MUZ1 1I8KA 1G84A 5K9KB 3PJSA 2NNCA 3WD5H 5KSBF 3HAEB 1QRKA 5I0ZA 5DS8A 1R4XA 5B7MA 2HTKC 1RJYA 3ULSA 3VD0A 2Y2TA 5KS9E 4XH2A 2OPCA 4QTHA 4NQXB 1VSCA 3VH8G 1UOVA 4DP0X 1GZQA 1MRDL 5JNLA 3VD4A 5CSGA 2ADJA 4ZFOL 1IVTA 1FJ1A 5TF1L 3DK0A 3GM8A 4AYDC 5KYWA 4N90E 1B89A 2J4BA 1MWAL 3ARBC 4MXJE 1QVOB 4J8FA 3EHMA 5GHWL 3B1UA 5E8EA 1MEXH 1DR9A 3ZRHA 3ZYMA 4L4JA 3IDIB 4HUUB 2OXGA 2EGHA 2IFGA 5T5NG 5A6LA 3ZDYE 1AC6A 5FHAL 5JMPA 2WN3A 1R17A 2F8XC 2YD9A 1EAJA 4JGMA 2D9CA 4PJXA 3BUIA 1GKEA 4PRDA 1A6AA 4FQ2H 1YA0A 3WIHL 4C56E 4G83A 2WKLA 5JC1A 1EXGA 1TNOA 3GGWB 4HDIB 4E5XB 4YDOA 1B0GB 1XGQB 3SBTB 3VH8A 1RCYA 1KG0A 4PWHA 2OK0H 4MAYB 4BWWA 1JN6A 2X10A 3VXTA 3HUJF 4BFGA 4XI5C 3W5NA 2VLKE 1PG7X 2PO6C 2QQQA 4JJHA 3QIBB 3UTTB 2B39A 5JLZA 1MJUH 1MCWM 4HPOL 3ULUH 4F15B 1DJHA 1SJEA 2HJKA 4IOFD 1V5JA 5KSAC 1YPZA 1J5DA 5DLMH 4FKKA 1R3LA 4OT1H 3EHQA 2DOCA 4NGHL 4Y5XB 5TDOB 2R9HC 1REIA 2PCPB 3ZTJG 1DBJL 4JQIL 1KKKA 3WS3B 1KTRL 5AVWB 3LB6D 4XN7A 3L4ZA 1JPGA 5I82A 4RH4A 1ZGLM 1ES0A 1JBJA 3O4ZA 1LNBE 3L2MA 4JDVA 2CH8A 2ZWKA 1QFWM 2KBXA 3BLPX 3E2HC 4NQEB 5HHVL 4S1QH 5I2IA 3FH7A 1LO5B 1LP9B 3D9HA 3FO9A 4OD2B 2R03A 3IXEA 2LE9A 4FYQA 1FC1A 4LDLB 3I3BA 5I8EB 2FBOJ 2FEEL 2B59A 4FXLA 5DJ0A 5L8LB 2BSSB 5TQ2L 1UGNA 3SQRA 1ORSB 3LKRA 1E7VA 1BM3L 1QTYT 3K0WA 5TGBA 4A39A 3R8QA 3FCBA 5AOKA 3PE4A 2BSTB 4PGJA 2EQDA 4DGYH 3MYJA 5INDA 5I1AA 4A7GA 1OCCB 4XP6H 4JDZB 5HDBE 2Z7WA 3W2DL 4F91B 1NFAA 4FFWD 2GG1A 3WEXA 3PG2A 2X4UB 2FYYA 5KS9F 1TKWB 1RZJL 1Q9WA 2AABL 2E27L 3TN0B 4ZO7A 5JJ7A 1DQMH 2YBRB 4AK1A 3NCYS 2B1HH 4OSUH 2WM9A 4TF4A 3AXHA 5I73C 5H4YA 2P3YA 5BPPA 4YGAB 1GZPA 4PN6A 1L3FE 1NSNL 3OWEA 1DBKL 4L18A 2WB2A 3MLVH 4PCYA 4MA1B 2I24N 5E8OB 5L0QB 1L5GB 1KT2B 3APNA 3IBOA 4BIKA 3BCDA 2P80A 1J10A 3ZJAA 4XMTA 3G7TA 4TSAL 4PCKA 3SNXA 1EUUA 2Q76B 4DZ8B 4M1CC 4P5KB 5FV2A 1TJCA 2PPCA 3ZDYF 3O6LL 4P5TB 3IWUA 3GMLB 3TH4T 5G04C 3MRJB 5GS0D 2CG3A 5DWPA 1JNLH 5HJDA 5J56B 3OKNA 1ELKA 2GK2A 1J8HA 1RIUH 2BFVH 5E9DB 3V5HA 5CEXB 3FB6B 4UTBL 4ES9A 3EJCA 3IETA 4Y2DA 1I1CA 3UBGA 2OQJB 4CVUA 4U1NA 4RVBA 1CFSA 5F9OL 4Z23A 5KVFH 2YAPA 1WCBB 4AZ8B 1Q9KA 5KWDA 1XIWA 3JWOC 5FKAB 3DPBA 1X5MA 3C6LC 4NUGL 1CBVH 4JFPA 2VDPH 5FXCH 3CCHB 5I76B 2BNRD 1P9MC 3QXAA 2BF0X 2R2LA 4LLDB 2R2HA 2DWZA 2EYRA 4OZGE 4RGMB 4H20H 4GSQA 4HAFA 2ROYA 5IMMA 1OARL 3JWOL 2XVKA 1TN6A 2CFZA 1S4IA 3CDFA 1Q4NX 1TETH 4WFFD 3JTSB 4ZTOH 1KFGA 3RYMA 3TGXA 1QFPA 1H2TC 3F28A 2P9KG 3B2PA 3Q4AB 1CD8A 1CDHA 1EXUA 1FBIL 1OGAD 2ZCKL 3FSVA 3MRRB 4GI9A 5IJBC 3ZEFA 3PNLB 1F4WL 2YXFA 5ILTH 5CINL 1HE8A 3AADB 1E9QA 1I9IL 3EYSH 4F7TA 1WISA 3O81A 1I8UA 2BNUA 1MI5D 1OP9A 3X12A 4X5LA 1DDTA 1Y6KR 2D7QA 5HDBF 3TBBA 1E4XI 3C8KA 1E9PB 1AZVA 3OKLA 4MJ5A 4UT7L 3SDCD 3VSQA 4PRBA 1YEFL 4LUNU 2VDMH 4LHUD 3KWTA 4PJ8B 3ARUA 3NJJA 1JXGA 4WNFA 4M9OA 3WNJA 3SEPA 1I3GH 2ZONA 1E4KC 3VD1A 4NS0A 3K80A 1E2VA 4PJ7B 2OTWB 4TNEA 3CFTA 1LK2B 1ROWA 5JYLA 2VN5A 2V5FA 3AU1B 5IHUL 2A6DA 1OD9A 3PE9A 4JZJC 5EOCL 3X14A 2KDYA 5D7EA 5AZEH 3UTQA 2V6HA 4X5WB 4MNHB 3US1A 1K8IA 4X4ME 4HUMB 3BYYA 3EFDH 3OMIB 3WN6A 5DULA 1CR9L 2VDQH 5AYUH 4GAEA 1WYJA 3ZW3A 3O9WB 4LCWA 2P7TA 2FK9A 4I0PD 3B83A 4JFEE 3VVWA 4D3CL 5BOJA 4XO9A 1IGTA 4BFOA 2P43B 2IY0C 3T8DA 4WCYH 2VL5A 4K8RL 4OB5L 2OW6A 2XWCA 1Z3XA 4HRNA 1S2EA 2DQCL 4HMEA 3NPZB 2G2RB 2EXYD 1CLVA 2FI7A 1R0AL 3NSCA 1UKTA 2IDUA 4FQIL 1E3ZA 4LLVA 3P0VH 4WO4B 5E00B 4ZFZB 3V4VB 1F00I 3Q1EA 3FU6A 5CKAA 2XWBB 2BNQB 3T2NL 1KLUA 5D8JL 2FO1A 3QS3A 1NCHA 3PVLA 1QSEB 3P4OA 1QFWH 1TCRB 1U3HB 1WWBX 4LP5A 4XXDA 5KVDH 5ENRD 1KXVA 3D52A 2HYMA 2ALAA 2CA4A 3PXJA 1EYHA 2JCYA 4GRLD 4HJSA 4LL9A 4F7AA 4XVSH 3VLFA 2VDNL 1I9RL 4OZGF 3E6HB 2IANE 4N0UE 5C0NC 2BY1A 4X8JB 1YMMD 3MCXA 1ADQH 4BZ2A 4L8SC 5DHYA 2DLGA 3EBHA 3LIZA 3GPSA 4HISA 3SBSA 3IJHA 1D5BA 2MYOA 1JOIA 1VKXB 5T3RA 1ZPUA 3HG0A 4POUB 2W9EH 1OAUH 4FQ1H 5KBAA 4IKIA 2XICA 2Y1YA 4XCCH 4B9CA 4Y8DC 3CVLA 4MASA 3B2UC 4GBXB 1JMXA 4L3ED 4O02L 4N2SA 3LXCA 5AYQA 4J4PD 1A3RL 4KKZA 3TA4D 4KY1L 4PD4J 4M65A 2ICWA 2VC2L 2E2EA 1JD7A 3EFOA 2VQ1A 3C98A 1RZIA 2EYSB 3EJUA 3DUHA 3MRMA 4C83B 3UZEA 4ZK8A 1GCYA 1MREL 2UYLB 3IB4A 2BIMA 7TAAA 3JXJA 1OAKL 2VDLH 4OY9A 3SI5A 5C71A 5HYFA 2IOLA 4AMWA 4X5QA 3T3PE 3FC8A 3Q8FA 4KUZH 1VADB 1TLIA 4AK2A 4K9EC 4D8PB 1F3DH 2NZ9C 4EI5C 1NCBH 2GW5A 5E6IA 4WJ5B 1G7IB 3V7AG 3BVVA 3RNQB 3QWPA 2KM4A 2ZE0A 3EHRA 3CDZB 4GAAA 3MO1A 3DBSA 1MF2L 2EO7A 4WHCA 3TWQA 1DVYA 4HH8A 5GS3A 1HNYA 1ZANH 1XBRA 5MI0C 2WCPA 1L0YA 4PGZA 4EIZC 2QC9A 1JZ8A 5CEZD 2ADGA 2HR2A 5DZAA 2B20A 4PW3A 3SZ7A 4HS8L 4OVUA 4RMWA 4HC1H 4Y88A 4FTVA 4J6RL 1NCAH 2CNYA 4BK8A 4OV6F 3ZKXC 4ZZKA 2IGLA 4OFYA 1J0IA 3ZSSA 2R5SA 4M29A 3SJVB 1XNFA 1ZIBA 3L82A 3VYNA 2BVOB 1NFIB 4UDUA 4LNUD 2VN4A 2IBZY 2IJGX 4L37A 1RKRA 2LVCA 2Y24A 4NCC2 5D4JA 3WXWH 2DWDA 4ZFQA 1QUNA 1Y0LA 4W9DC 1DSWA 1LWJA 2W65A 4R7DA 4G8GB 5CIPH 5J1SC 3GMQB 1OM3L 2NXYB 5ENOD 3ASOB 2LABA 3VQ2C 1WBXA 4N28A 3L4WA 3ISMC 4PV1C 2NSQA 4GO8A 2FSEB 2PTTA 4QWWD 4BBWA 3RVTC 1G94A 4HKBA 4CADA 3L3IB 5AKRA 2X4NA 1ZHNB 2CKBH 1Z6TA 2WI0A 4XP5L 1RZGA 4YSQA 1PL3A 2IAMC 2F0CA 3J7HA 3QISA 4WK4B 4NNPL 2E59A 4PCSA 4BEPA 4PU2A 4L3AA 3NCMA 4M5YL 1NIFA 4PGBB 4WW2B 4MAUL 3VFNA 2Y0SA 3LEXB 2BWIA 2KI6A 3ECBB 3BKYL 3UERA 1SVCP 1A6WL 4DUIA 5D0OD 5BQ7B 4ZMXA 1QAWA 1S7RA 1M2OA 1FP5A 2BVQA 4OQTL 3UM2A 1CTMA 4W9FC 2Y6SD 5INCA 3RC8A 3Q9UC 5IHLB 1HVXA 3TONA 4HP5A 3ROOA 4JE0A 1OSPH 3ULUF 3FSZA 1SXSA 5D96B 4MNQB 2R69H 4KBQA 3T3PF 5KYXA 1DZ0A 1QLRA 2MRIA 4PGDA 1S3RA 5TLNA 4XCEA 5IEKB 3L1FA 1N64H 1RUPH 2X0WA 4A66A 4MA3B 2NYJA 1T22A 2DICA 5EB9A 5CGMA 1WG3A 2ETAA 1S7WB 1TZIB 5HVFB 1UACH 4BUHA 4A6YH 1W8NA 1SUHA 4WWKC 5IW6A 5DVMA 4FA6A 2YD2A 4MZRA 3HE7A 4ENED 1CURA 3PUUA 2XG5A 5CZKA 1JPEA 3IJ7A 3VXUE 3WNNA 5JW4R 3HC2A 2YWZA 3BPLC 3TVMB 4HQDA 3MYZA 1NMBL 3LN5A 4FLQA 2VZTA 2CJSA 1MCCA 2E86A 3LPWA 4PMEA 4Z5RA 5DA4A 1YEHH 4K3HA 4E9QA 5KVGE 3HNSL 4N25A 2O5NA 4U7SA 1NINA 2Q7AA 3D9JA 1MFVA 4G23A 3F7KA 3HS9A 1OGAE 2A77H 4P2RA 1FGNL 5T1MA 4TQIA 2C5ZA 2DN7A 4OM1L 4M4PA 3T1FA 3BAXA 5AFAA 1FVCA 4X6CB 3C3RA 3HZMB 4P3DA 4TPRH 4FQCL 3T6ZA 4UWFA 5BXUA 1BF5A 4RMUA 1TTRA 3FXIC 2AJUH 1OGPA 2KZTA 1MCWW 2FT6A 4QXWA 2MOQA 1BZEA 3BVTA 4XKCA 5A2LH 4AM0Q 3AFLA 3NQZB 3JUIA 1TQSA 4NWTH 4Z95H 1H15A 2NY4B 1SBBA 4MS6A 4TLSA 4QLRA 2H32A 5IFAH 3PE3A 3T77B 4DZBA 1WUNT 3OQRA 1IBFA 3KPRA 4H0IA 4AQ8A 3VVVA 3QIWB 2D7PA 3H7BB 2ICEC 5HDQH 3CLWA 1SXAA 1JRHL 4ELMA 3QWRA 5AAMA 4NN6C 1MCDA 3ILQD 5I8KH 2IXQA 3FDWA 4FI8A 3MRFB 3W39A 1I8MA 2FJFB 1KWKA 4OLYH 4AG4H 3T71A 5IIEB 3HHSB 3F58L 2N0KA 1QF0A 2HMID 1F97A 3TA3C 4JREC 4PV9A 1YY9C 3HE6A 3EADA 5E6RB 1DQTA 1JFQH 1YMHB 2Y1EA 2NT0A 4K5PA 3ATDA 5CSZB 4P2OB 4IJ3C 5FS5A 5SWSD 1UM6H 2LAAA 5HGHB 4P5MB 3IAPA 1FYTD 3O6KL 4Z7QE 3JWNG 1DJYA 1N9AA 1FNGA 2JCXA 4F2FA 3PXLA 2YMTA 3MRBB 4LCIL 1K5NA 2R4RL 4PEEA 5EBGA 3VQLA 3EYFB 3ZGQA 5CFHA 1R24B 5I75B 2EIMB 2XUWA 2WQRA 3GLDA 3PFUA 4NBXB 5DZOA 1KBPA 1QKZH 4FQHB 4G9FD 3QUMA 4F53A 3B8SA 1BQUA 2NY2D 3HMXA 3NA9L 5F1IB 1WT5A 1T1SA 5HDOA 4NBZB 1MSPA 3B5GA 4FG0A 2R1WA 4KTEH 1MLBB 1F45A 4XP9L 5L4IA 4ENZA 2OCCE 2Y06H 5I1IL 4HIPA 1IQUA 4M93C 1CL7L 3WFBL 2COQA 4U07A 5ACZA 4TQEH 3D33A 3FCGA 4N8CL 5L9DH 4QXUH 5E2TH 2AQNA 4BFBD 5JA8B 4I48B 2APTA 1CIDA 1S9VA 4FRWA 3BN3B 1LDSA 2FEEI 4KGLA 4WFED 4L3EE 3JCKC 5IESL 5BNWA 2O30A 2WVVB 5EHFA 1OY3B 5BJTB 1KZOA 2EDQA 2EVHA 1M1XB 4MMYB 5F9JA 1AHWA 3QZWA 2XYCA 3ROLB 2Y36L 1FL6A 1SGKA 1I1AA 1G9NH 5CSBA 5FGRA 3VI3B 2VDRB 4TVPD 1N0RA 5AQ9A 1VFUA 1M4KA 3D09A 1YNTB 2UY7A 5FO7B 1T66D 2E5EA 2IQCA 2QQKH 4GKNA 3SSGA 3NVQA 5BNXD 4LBAA 2PKDA 4OCWH 3GTTA 2Q8BH 2WLIB 3MODL 3RGVD 4EIUA 1SLXA 3NACH 4PVLA 2FAUA 3IFPA 3UX9B 3P40A 4JPQA 1AXIB 2WTOA 5DFAA 4Y5YC 3NJGA 4PV8A 1KB9K 1IGIH 2W07A 1KCSH 5C92A 4CGUB 2WWKO 3DSFH 3IMBA 4G24A 3S5LG 1JVLA 1U95A 3G5YB 4QOKA 1CGXA 2YMXL 4U1HA 2OR9H 5CEZE 3CLFL 3QNZB 4NZRL 1JNHA 2A9NL 4G6MH 3BAIA 3DGDA 3MV9D 3BVNA 1B4RA 1SZ9A 5KJ4A 1TITA 5FW8A 1HEZA 2GC4C 3WTTA 1JXFA 2KCKA 3ZHKA 4Z7QF 4JO4H 1MHHB 3DMMA 2C9AA 3QCUL 1NIBA 2EEFA 2K6WA 5GGSB 3M8OL 3IV0A 4G6KH 5C0BA 1DNPA 1ACXA 4ZQFA 3ZR6A 1O6VA 2ZWNA 5DRWA 4YNDA 4XZUB 3FQYA 4LSTL 3IMSA 2AAVA 5I1GL 1JVKA 2XX1A 3LKUA 3HI1A 1A47A 3E30A 1UG9A 3CV5A 3S5LA 4F9LA 2P44B 4N0RA 2HN7B 4ODXB 4Y9FA 3QUZD 4CSZA 5JW4Q 3IFLL 3FONB 4W9JC 1QLEH 1RAMA 2H45A 1CG9A 2XZCH 3PXHA 4LNGA 3Q5TA 4JEGB 3GBLA 3SGDH 3FFCA 2QKSA 1HHJA 3CXDH 2DV6A 3FWVA 4N87A 4AM0A 1P1ZA 4U05A 1EJOL 1IEHA 3D9PA 1U8IB 1M57B 1IHBA 2YPVH 3IDYB 3LQZA 4AIOA 4KKCD 2I5YH 3A22A 3TEYA 2WXOA 3Q3GA 3TT1H 1OB1B 3UGEA 3VFSB 4XN2A 2ATPB 2VSDA 3HBGA 4FQQA 2Q7FA 3RJVA 4L5FE 3QJZA 2J73A 1GC1L 2OL3B 3HG1D 4ZAKA 3ZIYA 3K4ZA 4UQCA 1IAIL 3DHPA 4N8PA 1MPAH 5T1LB 4OTXH 1X4ZA 3J2PA 4XPTL 5I1EH 4WLCA 3UAJD 3BJ91 5CCHE 2MQCA 1TNUA 3BIAX 1RJCA 3RRMB 1U92B 1B9ZA 4WEUD 5IB1A 5D1XB 2OVFA 2ZUWA 5IQ7H 3LHAA 4RQQB 2Z8WC 3OL2A 5DZVA 2QTVA 5F6IB 1FJVA 3P73A 2HUHA 1MHCB 2VZUA 2ZGDA 4G1EA 3OXFA 3HR5A 4QHMB 5TF0A 1V54E 3FFDB 4PJHB 4QRSA 4WNQB 3LS5H 3BE1H 3DX1A 2G4ZA 3PQYE 5D7LD 5DJCA 3DUUA 2R0KL 4I3RH 3FQNB 4N9OB 3SF4A 2V9RA 1ORQA 3KJ4B 4UWHA 2J21A 1M7DA 3C8HA 3HFMH 3K8LA 4O2FA 3TJPA 3ZU8A 3WJLA 1HH8A 1I4FA 4AEIH 3CPLB 4I2ZA 2I60H 4DUWA 1I7UB 4L9LC 3U6XA 3S8FB 4N8VB 2J1YA 8TLIA 1J9CT 2H8PA 2HWZL 2MJWA 2G9KA 2WVTA 3OGCA 1H3GA 3TIDB 5JPNC 2OI9B 1ZPLA 3V0AC 3QIUB 4QHUA 3WFCL 3O41A 3RU8L 1ETB1 1NFDB 2E3VA 2H1PH 4KFMA 3TA3B 1KCWA 1WTLA 2ZSVA 3SGEI 1N4XH 2R51A 5JW4N 4EBAG 1MIEL 1MWOA 3F6JA 3TBTA 1F3DJ 1Q0EA 3V4PH 1IO4C 1HYSC 1KLGA 1KB5L 2KLTA 2HM8A 4D9RD 1FL5A 4NJ9L 2FBNA 3SE3A 1TLMA 2CJTA 3PHAA 4Z77A 3TWWA 1XX9C 5IOPB 1JZ4A 1SOQA 2FQFA 2FE0A 4LARL 2J08A 5D55A 2WK2A 5H37H 3SE9H 2Z8VC 1XR8A 2IFFL 5B39G 4XVJH 1CICD 2G4GA 3BN9C 3L2NA 2VKXA 1LMIA 1C08A 3QEQD 4GMSL 2Y69B 3B7TA 3V5KA 3MRIA 3AJIA 3B13A 3MV7B 1KXHA 1HE7A 2FWLB 4ILGA 2VSCA 3V52H 4EBAA 4FQJL 5DI8A 1I8KB 2O5ZL 2JKJA 3PJSB 3DO0A 4L3FA 4D0DA 3O2VL 3FAXA 3AS3A 5J90A 2PWGA 4LEUA 1MCOL 1OQXA 4RAVB 2ZUTA 3EXLA 5DS8B 4LNBA 1UYWH 2I2OA 3KPSA 4Q0XL 3EO0A 4MAYC 3HEIB 5EEUA 4JVUA 2XX0A 4AIEA 1I85A 4PLOB 3ABLE 1WFUA 3NF1A 3FS9A 5JDSA 4RIRA 1KZYA 3QIBC 2BP3A 4QTHB 3MRQA 5FSSA 2YD6A 1FSKB 1YYMH 2WQVA 4LQ1A 4NYLA 3THML 2VMCA 4AVKA 3NG5A 1ZLVK 4F15C 5MENE 4APOA 4KYOB 2ADJB 1ZHLA 1THCA 2YPLB 1RHFA 3BSHA 1FJ1B 3FQ2A 5DRXA 2FRGP 3NGBB 4ATTA 5KYWB 3CFDA 4Y5XC 2W0KA 4G25A 3APDA 3BFOA 1AD0A 1AGEB 3LNFA 4ELKA 4ZZFA 2X6FA 3U0WL 1GIGL 4GRMB 1U8PA 3N3EA 1BAFH 3VI4E 4XPGH 5IBLD 1JPSH 4PJXB 4PRDB 3H9SD 2F7PA 1A6AB 4B41A 1ZOXA 4OCSL 2APVA 5BS0A 3NQIA 3RGHA 1IM3A 2HFGL 3ARQA 4G9FE 1DLHB 3VH8B 4N39A 1KG0B 3A6CL 4JUSA 4IU2A 2B9BA 1JN6B 4EXKA 1MG2C 3F2PA 3VD5A 2EEBA 1UVQA 2RQEA 3MOAL 5JLZB 4NUPA 4F57L 3LD8B 2WLNA 3ZTDC 4Y6SA 3ZE1B 4HSCX 5DR5L 3TJEL 3V30A 1RL1A 1YPZB 1J86A 1R3LB 5JR1H 3NA4A 2ED8A 3EO1B 1AP2A 4XWGL 5ANLA 4BERA 3TN0C 1AGBA 2FF4A 4PY8I 3ARED 2IV9A 1SF5A 4I4WB 4WFEE 5KVMC 2OJEB 4EZJA 2ADFL 1VFMA 2FH8A 4HUXA 2XZQL 1DEDA 1JPGB 3FEXA 1UT1A 1ES0B 5D7SH 5GGTL 5ABZA 4GI8A 4JDVB 3OAYK 5L0QC 4MA1C 3WFDH 1JWUA 2IBBA 2XU9A 4ZO6A 3MBED 2R23A 1Y6IA 2P47B 3B2DC 5I30H 2DEXX 3CLJA 3KYNA 4U2ZA 1FJWA 2CBOA 2DMKA 4UNUA 1BLXB 4OBSA 5HGAA 3QA3A 3WLBA 2B59B 3G5XB 3WUZA 4P5TC 3PCYA 4E9RA 2DQGH 3LKRB 4PS4L 2G75B 4FL4B 5TGBB 1LEIA 3S35L 5K9JL 4YE4L 1A7NH 4TV3A 4URTB 2X6VA 2R0ZL 4I9CA 1GY2A 4HOQA 1E30A 4RAUA 5I1AB 5INDB 2JI3A 2V5YA 5EUOA 3Q2CA 5FUCC 5J9PA 5T5FL 2FYYB 2BXZA 3D0VA 4ZFGH 1C5CL 2RHEA 1Q9WB 5AG8A 4XNYH 3FN0H 4KQ4H 1MFBH 4DEWA 3P4LA 5DS2A 4FLRA 4L29A 2CHDA 1IJ9A 2Y3AA 4NIKB 3PWLB 4R8WH 4UI2A 4B89A 4DI4A 1GZPB 1OCOE 1Z9SB 4RISL 1BG9A 1CCZA 3MV9E 4JHRA 4MQSB 3ARDA 4XMXA 1O7SA 4H8HA 1NEZA 4JO3L 4RGMC 3HFFA 4YLQT 5B4MC 5EU5A 1BQLL 3D51A 3BESR 5GZNC 4GXUM 1IE4A 3IPEA 3VI4F 1MQ8A 2B2XL 4LKXA 3EYVA 1A5FL 4UTAH 2GKIA 1OOAA 1TN7A 3JWDH 1HZLA 3NN8A 2BCKB 3OJMB 4UDTA 2AEOA 4E85A 3PWPA 3MFGB 3T87A 1J8HB 4NUQA 4OR1A 1ZLVH 5EFIA 3V5HB 1IC5H 2DQEL 3SY2A 2G60L 2WP3T 3IETB 4Y2DB 4ETQA 5I16A 3GPEA 4GAGH 2SODB 3X1NA 1ZXKA 4U1NB 4Z7OB 4P2CG 1Q9KB 3IXAB 1XIWB 1X6NA 3QR2A 1HILA 5GJTL 3DPBB 3PIQA 3LPZA 4ZQKA 4WNSA 3NSFA 1JXKA 3AACA 4PJ8C 4JFPB 1HX0A 2NUPA 4Z3IA 2VR8A 2X3BA 3PUJA 4P29A 1BI7B 2B77A 2EYRB 2R2HB 1ZLSL 4IRSD 2ZX5A 4IBLT 4X8XA 1SDDA 3HG1E 5AAOA 4GP5B 4ZQTA 2WNGA 4KVNL 3CSYA 1J7VR 4B3VA 4DGIL 3VLEA 2RFXA 3GSOA 3NSDA 1L7IH 3TOPA 3RE0A 1XGPB 5AB2A 2XACC 3X13A 5DFWH 1IB5A 2I27N 3AROA 3GHEH 1ASQA 1EXUB 3KWXA 4PJIE 2O4EA 4D9WA 2NY3B 1TJMA 4HALA 3A4FA 2PTVA 4CC4A 1E9QB 5C1DA 2N01B 2VXTL 3SDXE 4F7TB 4WEBL 3AU8A 4GEJA 3FK3A 4KXZI 3FRPA 4MB4A 3D69A 2EILB 3X12B 4ECNA 1ELWA 1JDCA 3RJDA 3C8KB 3OKLB 4MJ5B 4N0FB 4WO4C 1TPXB 2QVIA 3AT9A 3GSNA 4IYPA 3B2VL 1JRHI 2P26A 2QFPA 3PP3K 4PRBB 5D7LE 1RV6X 3OAYH 5BRZD 1N8ZA 4MYWB 5HHQA 5IF0A 2RJIA 1DUYA 4QHKJ 4GKSA 1R1CA 2VISB 4JK0D 2GT9A 3BW9B 4WJG3 3NCWA 4M1GL 1U3HC 4R4FH 3ZL4L 2J56A 1TNBA 1UOLA 4BFIA 3X14B 3AG2E 5KYUB 2DMHA 1XTLA 4ESKA 1P69B 3UTQB 3RL2A 4NPKA 5FOJA 1K8IB 2O61A 4Z9KB 5IVOA 4ACKA 4RSVA 1R3IH 3D05A 4KP7A 3AXIA 3BHBA 4LCWB 2A6JA 2P7TB 2ZSWA 1EVTC 1FH5H 4JY4B 3SCMD 4JB8P 3VG9B 3WS6A 4UQEA 1HWWA 4X4XA 5B3JE 1IGTB 2K7PA 3EJQA 2C0LA 2JXMA 1CWVA 3QH1A 2VL5B 1RVFH 4G6AD 4QXTA 5F7LB 1A64A 4NI3A 4YQXH 5CZXC 4BV1A 1A21A 4OI9A 4D9RE 1B2YA 3IDJA 3SKOA 4LLVB 3RLSA 5LXGL 1KGJA 5SWZA 4GBXC 3T0EB 3IJSB 3V0VA 3DARA 5CGTA 1AMXA 1SOKA 4HFWA 3BO8B 4YFDB 4L7TA 4KI5D 4CC1A 3P4OB 3PWUA 2DIAA 4XXDB 5C0AA 2W0LA 4HB5A 3FZUC 5DO2D 3RASA 4BWRA 3QEQE 3U9UA 1NCUA 3PAZA 4AW4A 3PWNB 1WVZA 4H5SA 4M3HA 4EQ3A 1OS0A 2CNZA 2VN6A 2E9BA 5C0CA 2OKMA 2KERA 5E03A 2BP0A 5K9QI 4AVJA 2Q5BA 5E24E 1ZJAA 1TOXA 2APSA 1SC5A 4IOSD 3K5SA 1FT2A 3I3NA 2EXWC 3ET9F 4PJIF 3H42H 3MEKA 3OMZA 2L6BA 3RU0A 2IIJA 3BG0B 3VACA 3BD5A 4QI3A 5E5UB 2F53D 3SDXF 4JRFA 5FGCE 3V6OE 4J3OG 5AW2B 2PWDA 2OXHB 4MJIE 4OLUL 1QI4A 5IB2A 1IBGH 1P2CA 1GGYA 3CKCA 4M61A 2ICWB 3U64A 1C8PA 3OZKA 1PBYA 3EFOB 4LLAA 4YVNA 1RZIB 3MRMB 3KJ6H 2QPEB 3BPCA 2A4ZA 3LZNA 3VXSA 3ONKA 3LEWA 3ZDWA 2X4QA 3QDJA 4KTDL 1MFUA 3IK2A 2G0LA 4IGBD 4UV7H 5FUZH 1JDDA 3H9SE 2FWUA 1LVEA 3HS0B 2X1XR 1KEGH 5FB8B 5D4HA 4QJ5B 4ICXA 2DYRB 2NXYC 5E6IB 2YIHA 1G9HA 4WSGA 2A4CA 4MSWA 2WXPA 2W92A 3VGBA 1MNUH 1QBMH 2ZKMX 2XQYK 1CD1A 3NIGE 4FCAA 2PXYD 3QDGD 3P7RE 5B3JF 1LO4H 2BP8A 3D5OF 3MRGA 3PP3H 4Y4HA 4A2FA 4JY6A 1ZGLA 3CFUA 1U2VG 3K9IA 1FWXA 5DVLA 5FQ7A 2ADGB 4MTMA 5I0XA 2XTSA 5FW6A 4JXTA 2HTKD 2AWIA 3CHSA 2B0SL 4FTVB 4AYSA 1ZT7A 3K1KC 3EJSA 4M7JL 1Q72L 3WJJA 1K5HA 2ZCLL 4S1RL 3ZKQD 4WW2C 3QPXL 4DP9X 1ADQA 4PAZA 2WBJA 2R83A 4NQCE 3M1OA 4UDUB 5GGVH 4OLXL 3ARBD 4IHOA 2AJSL 2WVSA 3KXFA 1ACCA 1BECA 2DWDB 2ZGGA 3UINC 1JF1A 1QUNB 3CTTA 3GEWB 3LNHA 3MV11 4R7DB 4UQIM 4WUUD 5CCMA 5H8DA 3ULUL 3PREA 4FZ8H 5JO0A 2LLGA 1WBXB 2QV2A 4OT1L 3IRCA 4OZFH 1P1VA 4AJVA 1BEYL 2PTTB 4JN1L 3EHBD 4PG2A 5D96C 5T1DL 4CADB 4HKBB 3HXFA 1KB9J 1W72A 3B9VA 1THAA 4GOSA 1F5WA 4FFYH 4YFEA 3K91A 1TJGH 4PR5A 7TLNA 4L1HA 4B95C 1KGYE 4F8OA 4H0HB 2KT6A 3AABA 3V6BR 4C4KO 4Z76A 5JQ6H 4S1QL 1QNIA 5I6LA 4XI5D 1HU3A 1IGFH 2ZOOA 2PO6D 2WUBL 4TUMA 4QJ3B 3IVKA 2CR3A 3NZ8A 1S7TA 4GQQA 3MV8E 4MXQD 1TO5A 5I1HH 3N1FC 4PB9L 5EU6A 5KSAD 3VTAA 2X4PA 4HA1A 3CH8A 4XMLL 5IJKA 4LCTA 2MOGA 3V79K 4PSPA 2VZOA 3TVMC 5F8QC 1S7RB 1CIUA 4LE8A 2Y1GA 1YA5A 4NHUA 4B60A 2ZXEB 2WWMD 3KBFA 4YO0A 5HYJD 2ZUYA 4PJCF 3AGWA 5DURB 1S3KH 3ROOB 1WZ1H 1WFOA 1YEGH 3AWEA 4G8EA 1PY4A 5FYLE 3L9YA 1RI8A 1TJIH 2JIXA 2I69A 4UOW0 5KYXB 1DQML 2BW5A 4XMPH 4HT1H 2CUMA 3EF7A 3FBKA 3GK8L 4HC1A 2YEVB 3ESUF 3VD2A 4DKEL 5TH2B 1L6PA 4OGYH 3VWKD 4AL8H 1VZIA 1T22B 4KK8D 4J3UA 3NIGF 3M46A 3IDUA 2G3ZA 4F2ME 5EZOL 1YEDA 5F88A 2WQ7A 1KENH 3UMNA 3NBNA 3CVNA 1IFHL 1UM4L 5LCWC 3HE7B 2NQCA 3MV01 1JCQA 3U46B 2NY4C 5CIPA 5D6DC 2H0JA 4LPWA 2GEQA 1HF8A 3QUGA 2FBRA 5SWQA 5IROA 4KMLB 3LRMA 1ONOA 3LN5B 4G3YL 5SX4I 3MXVH 1J5OL 4PJFA 5DUPH 3QUYA 5LNGA 4N2IA 2R29L 2CKBA 3QIWC 4IHBA 2F54B 1ITCA 3SKJH 3OKOA 4UT6A 3T2HE 4OI8A 2C2LA 2HKAA 2QZ5A 3BKCL 4P2RB 3W0WA 5ICYB 5T1MB 2HX7A 3BSZH 5C7XL 2O5YL 4KK5D 3T1FB 2IO5A 3ATEA 4U6HA 4P3DB 2VN3A 3BRFA 1RK1A 1AG6A 4L2LA 1ONPA 1SZNA 2XWDA 4N3TA 2WYTA 1HZKA 3V7MA 4NFDA 4OCYH 4U1MB 2CJ3A 2NYKA 4WI8A 3DDGA 3IMVA 4R5XA 2KZTB 4OJCA 4F7CA 5GS0H 5ICXA 1CTOA 3LQAC 4P2OC 2A83A 3UQ3A 2ZXGA 3TT3L 4LT7A 3FRUB 2R1XA 4JM4L 3J5PA 1MFDH 4NJAH 5ALCL 1O9VA 3CK0H 4ONFL 5I1KH 1AANA 4WWOA 3MACH 1SXBA 1FVFA 1NZRA 3KPRB 1LD7A 5I75C 1TUPA 2C1PB 2Z92A 3C6LD 2A4EA 4LP4A 4GAJL 1XF4B 4ELMB 3E8VA 1P5UA 4MS8D 1HH6A 1V05A 3I85A 4X83A 2JV6A 4FNTA 4OIIH 5AUMA 5DUMH 1YHPA 3W39B 4CBZA 1JZDC 3N21A 3VA2C 5MEOA 4A6YA 3UKRG 3Q49B 4FQLH 3VMOA 4L2YA 2CDEB 2HRPH 3GZSA 4AITA 2V17L 4PV9B 3HE6B 2RJMA 3AJ7A 5E23A 3C9NB 3EDFA 4HWBL 4QFVA 1WUZA 4PYHA 1FRGL 4ALAC 1RZKC 4C4UA 5KJNA 2EXTA 4JEUA 2IC2A 3T0XA 2A73A 25C8H 4KI5E 1NJ9A 2G2PA 3KPPA 1BXUA 1FNGB 5JHAA 2Y07H 2L7JA 3D39B 1DLFH 2KBGA 1A4BA 2BHYA 3LRGA 5E6UB 3L4TA 2BWDA 3QPQD 2JMRA 3SPGA 2JK5A 3S88H 3IIEA 4UMSA 5E6YA 4XKBA 3ZQWA 5AQAA 4PWEA 1VFBA 4AIFA 3QUMB 3OKMB 3T1WA 2BS71 3ARFA 2X88A 2OMWB 3VDBA 4N1CA 1GZHC 2R1WB 5HJGA 2GABA 3P0VL 3IDGA 2P5WA 2CO6A 2F5AH 2EE3A 1LO2L 1ZVYA 4FABH 2IPTH 4MNGE 5ADPH 4DRXE 1NGQH 2AEQH 1KC5L 4K8RD 5ACZB 4UQXA 1UT2A 2J71A 5FGSA 2ED9A 1EF1C 1N95A 2FX7L 5H2BA 4ABWA 4MJ6A 4P9MH 4ATWA 4F9PA 4WKXA 4ADJA 2F53E 5EORL 1S9VB 4JGUA 1QATA 2K3HA 2WLZA 1JZ2A 1KBBA 4P46A 3HZKB 2GTQA 2ILRA 3KL5A 2CO7A 3L6AA 4GSDH 2BERA 4Z7WE 2MQ3A 3NB2A 1AHWB 4GQPH 4ZO9A 3ETSA 3FO0L 5AL0A 5EU7E 3DI2B 1FL6B 1OSYA 1HWHB 2VLJB 1AIFA 43CAA 3KH4A 1MDTA 5IM7A 2N1KA 4K73A 3PNRB 3ONLA 2UY7B 4PS8A 3LHPL 4GKNB 1TZGH 2BLFA 3H1ZA 5ETUB 4GQ9H 1WQVT 4YDNA 3DXAD 5DJYA 5C09A 2M26A 3MSAA 5G55A 3BCFA 1AMYA 3IFPB 4NZUL 3VQMA 1JYWA 1MW1A 4JKKA 2DIBA 4PV8B 5C0ND 2W07B 3FDHA 3VM7A 1XL4A 3RFZA 1PYWB 3QDGE 2JJTC 5F3BB 3US9A 4HKJA 3P7UE 4GA0A 3RB5A 1U95B 3MVSA 4QOKB 5GGVY 2XC8A 2YMOA 4U1HB 1KJMA 1F86A 1CK0H 2NRDA 3VWJB 1JNHB 3IDYC 4XX1E 5T1KA 4X4ZA 3K71A 2C4XA 5CEDB 1U3NA 3VB8A 4N4EE 5E6SB 4W9RA 1BW8A 3UPVA 1UZ8A 4O9HL 3DYOA 2IEJA 1HEZB 1U8CA 4HGMA 3D2UD 3B2UD 4JPKH 1T3FA 3MRCA 3PJLA 3DROA 2B16A 3VXMA 1YAZA 2VXSH 4LXFA 3DMMB 1U93A 4TRQA 4WI3A 2DAVA 3LRHA 1F8TL 3PS6A 1CLOH 1QASA 5DRWB 4KXBA 5ID1A 2FQDA 2GSIA 2O1AA 4APQA 3NOCD 5BT1A 4A03A 1FQ9C 5DEJA 2GIYA 1CXHA 2NY0B 2OL3L 3HI1B 2RACA 3S5LB 1ZT4B 3CU7A 5D1XC 5FKPA 4YHML 4NC2B 3S48A 5ENPD 5F6IC 3WMPA 1CG9B 1VEOA 4YDJA 2QSTA 4RGNE 4N6RA 3D85B 3EH5B 4LPTA 1HHJB 4JFHE 2YQ3A 1W91A 4ZUWB 4AM0B 1EH9A 1P1ZB 1PLGH 1R5WA 2NZ9D 1BXAA 3KGTA 3L9RB 4HKZA 5EEXA 3VSTA 3QXWA 2EDBA 5IFHH 4EUPG 3Q3GB 5L8JB 1YQVL 3WOVA 3BZ5A 3KJ4C 4Z6AT 3FHAA 4FQQB 1JHLH 4JFDA 4W9ZA 4HXIA 4GTOA 3EGSA 1J8SA 1OGSA 1CFBA 3FTYA 5C6TL 4Z7WF 2ERJB 3BGMA 4XP1H 5D7IA 1QFUH 1E4HA 1WIOA 5CEZH 5IQLA 3LRSB 3TCLA 1EHLL 1V7NH 2OI9C 4QRQA 4JPWH 2WZPD 5E2VL 3QIUC 4NB7A 2Z31B 2UZIL 1BMZA 1OP3K 3WXXA 1EIBA 3O4LE 2BVPA 5HYJE 1U58A 3EKCA 3KYMA 3HN8A 5IB1B 3UTPE 1JNJA 4PG9A 2W0PA 3P73B 3C2SA 2D2CC 2EIKE 1AAJA 4G1EB 3HR5B 1PFOA 4QRSB 4HLZH 4NOFA 1E6OH 4Z7VA 4Q74A 3P2BA 3KSQA 4P23D 2LAIA 2OYLA 3LYAA 5DJCB 3DUUB 1EGJL 2GUYA 2YHEA 5T1JA 3RVTD 3TBCA 4HVBA 2C3VA 4PRIA 4FXGA 1O9ZA 2X6MA 4O2FB 5A2AA 4FFZA 5ISZB 1NC2D 1UOKA 1ZTXL 2FBJL 4GNKB 4Y19E 3IGAA 2IAMD 3OKDA 5LUMA 3TURA 1FFTB 1OSPL 3G6DH 4CDMA 2JJSA 2H8PB 4L4VA 2XBZA 2Y5QA 5E2UH 4A2LA 4N3UA 3O41B 1N64L 2YLKA 2K9UA 3WKQA 3KSLA 1RUPL 1KPUA 1NCGA 1AWCB 3BPOB 4MX7A 1T04A 2ZSVB 3WFEL 4DF9A 4BH7A 2ZXQA 1S7SA 3WG7B 1PD6A 5FJYA 1YEIH 3A4AA 3PFQA 2OYKA 1FO0H 1UWEH 3TBTB 2X4TA 3BUAA 2E46A 2YPVA 1KLGB 4UQDA 2R56L 5I15L 4WRLA 2A7GE 1VACA 4Z77B 3FF8A 3NZUA 4TMPA 4Y9BA 1T0NB 1FSKC 4M48H 1AE6H 3MSPA 1SBSL 3HW7A 4HBCL 3QNFA 4KHXL 4M5TA 4GRWB 1CFTA 4E41D 1XR8B 3NGBC 4QO1A 3EYOA 2ZCZA 1KB3A 1EO8H 2CCVA 5A2FA 3ZRFC 4I9EA 3A47A 4GLRI 1G9MC 3C2AH 1TMNE 5CP7A 4IRZL 2EDFA 2PMZA 2YZ1A 5CBNA 2WYZA 4J8SA 1JGUH 2DYPD 4IOIA 3V5KB 2UWJG 1OWLA 3QWWA 4L8BA 3VG0H 3WLWC 1YQ2A 4L0ZA 4HS6B 4PIBA 4R4BA 5DI8B 1UEMA 5JYMA 3B3IA 3I6GB 5AG9A 4HHAA 3L7EB 3NJNA 5EF2A 5F1SA 4UV4H 1UM5L 1WFJA 4DGUA 4CDRA 2P42B 4OZIE 1IMHC 3KPSB 3EO0B 1DDHB 4GG6B 2HJLA 4YVQC 4X5PA 4D9LH 3UKUG 2OX5B 3O0LA 3GD1C 5JUEH 3MREA 5JDSB 2HJFA 5B39B 3PV6A 4NYLB 1IV8A 3OAUH 3LD8C 2NNRA 1DQDH 1IARB 2MRYA 3RJQB 4ETYA 5ENNA 3CFDB 1KGWA 4JVPA 5FO9A 3S7FA 3L4CA 3QHFL 8TLNE 1H9VA 4GKZA 3SBQA 3SBRA 4F37F 1AD0B 2PWFA 3LS4H 1MCBA 5FR3A 1HFUA 3KH3A 5I24A 4KVCH 2VDKH 1P7KA 3HIZA 1FZMB 2XOTA 3I75A 4Z8FH 3IKCB 4NNXA 4K94C 2H9GA 5HHPA 2YK1H 4NP4H 2JKSA 2GJZA 2W59A 2ZJSH 3NCEB 5BS0B 3V4PA 1BAWA 1N0LA 2XHNA 4KVMA 3DTDA 4NQWA 5KSBA 5GISL 1H6TA 4GFTB 2CGYA 3W9EA 4EKJA 4IU2B 4DTGH 4HI9A 1P4LA 3INUH 3PV7A 4K94L 4FL4C 5IR1A 4YDVA 5A7DB 1UVQB 1L9PA 1UM6L 4Z1PA 4DAGL 2BDNH 3IDXH 8FABA 4DSYA 2OCJA 1A6TB 2O6DA 4AR9A 1UJTA 3TNNB 2D0HA 1JV2A 1PW3A 1Y6MR 2ETCA 4C0EA 1AP2B 2CHZA 5BVJA 3P0YH 1EO7A 2ENJA 2QGBA 1NC4D 1CS6A 4R90H 4BRJA 1NKOA 1PSKH 1N5YH 2WXRA 4HUXB 1QKZL 3O3DA 2DQTH 3JZYA 3GLEA 5HHMB 3TA3D 1MCPH 1MFAH 3EOBA 4CNIA 3S4SG 1YY9D 4ZXBA 3H6JA 1CXIA 5FZSA 3FUHA 4DVRH 2BSCA 2H4EA 5FO8A 1Q1JH 3QQXA 3KYNB 4PFEA 4DP7X 4HJEA 4X6FA 2WO3B 4IU3A 4LSVH 4G26A 2WXFA 4Y1AA 2NXPA 2OM5A 3Q5MA 4X5RA 5CJOH 2CAKA 3O6FA 5C7ZA 3LMJH 3HUJA 5D1QA 4HJJL 1LEIB 3CFEA 2EIBA 2GHWB 3DXAE 3B7YA 3OMAB 4OZIF 4RAUB 1HZHH 1K85A 2EH7L 2FD6H 1FA4A 5C9JA 3G6JE 3EOTL 2I32A 2ESVE 2UVFA 5J9PB 4PRHA 2DKMA 3SOBH 2R17C 1DUZA 3C60D 2P9LG 3D0VB 5CU5A 4Y2DC 3UM1A 5DT1H 4RBPK 4ZO8A 1F56A 1UHVA 4JX0A 3FT1A 3LN9A 3EJNA 1IEAA 4L29B 5AZUA 1XIWC 3GI9H 4AQEA 2H26A 3ZRCC 1KGCE 5CCKH 2DMCA 1CFQB 1N67A 2EKSA 3U4AA 3T08A 2EICA 3CSTA 1JGIA 2D2OA 4ANKA 2X5PA 2Q8BL 4MB3A 4CAGA 3CZSA 4HJGA 2HX8A 4O58H 1HG5A 4G43A 1Y07A 5EU5B 1N52A 1QLFA 1RIVL 2KL6A 1I7ZA 3NFSH 4FNLL 4UAHA 4QRRA 1S7VA 2J25A 1FN4A 3NPSB 3Q8BA 3CMOH 1IGIL 3KEAA 1WAAA 4IM8A 2ADIA 2LNIA 2DWTA 2XRYA 3EYVB 1B0IA 5F21B 4QTIL 2PPAA 3IU4H 3NN8B 3N85L 4UDTB 4KJWC 2PQNA 1R19A 3NQKA 1NIEA 2Y1LE 4P8QA 2NY3C 4GYOA 5EFIB 3NSXA 1R5VA 4TVPH 1JPTH 3C5RA 2VRKA 3N2JA 2X42A 4ETQB 5I16B 3FL7A 3FT0A 3TG4A 4MCNA 1E27A 2EINE 4AYFA 2JCCE 1JUQA 4NO5A 1EQWA 4JHWH 1OAZH 2VN7A 1F02I 1HILB 2V5TA 5AW6B 1TPXC 3PIQB 5AVTB 2H6HA 2GW1A 3CVHA 4Q7DA 1CXFA 4PJAE 2JB5L 1SOSA 4LNRA 4ZQKB 2CRZA 4U1SA 5K9OB 1NBQA 4W9GC 5HD8C 5HI5C 2YGQA 2NUPB 1CFVH 5DO8A 2E4FA 4YR6A 3QYMA 1SDDB 3VXRE 3CSYB 1Z5LA 3GSOB 3IJ8A 2ED7A 2WINB 3X13B 1U0QA 2UWEE 1R3KA 4C56A 4YSCA 3G2TA 3RZCA 1F4XH 3GSXA 4DW2H 4BA8A 4MJHA 4YL9A 1VESA 4UILL 3VG9C 2GJJA 1T7YA 3ARYA 3N1GC 4MBGA 3RWDA 1EAQA 2F61A 3WIIL 4EI6A 4R7NA 3Q8AA 2VLKA 4G5ZH 1D5MB 4G8KA 3E6FA 1FAIL 3UL4A 4XAKD 3D69B 3NIDE 1FIGL 3Q78A 1A1MA 5D66A 3G6JF 3DX7B 3CVYA 4GCOA 3I3DA 3GSNB 3T0EC 2QDVA 5I1EL 3TWYA 4DP6X 1N8ZB 6PAZA 2YSTA 4GKSB 4YDMA 3SBWA 3ABMB 2GT9B 1MZYA 3ILEA 4UTAA 1MHEA 4BFIB 1TO4A 1KXVC 3EOAA 1AZRA 4M4RA 4YBLB 3ZU7B 3GLZA 1X5AA 2HZHA 35C8H 1M71A 2J8HA 2R0LH 4GSUA 4Z7UE 4CJ0A 4TYUA 5F7NC 2ENYA 3BHBB 2A6JB 4AZUA 2ZSWB 3BE1L 3FUNA 4ZNCD 4ODSH 4E9TA 2R4SL 3HPJA 5A2IH 1T0PB 2QELA 3UPAA 2V4LA 1GVIA 3O2DH 1G7JA 4RBPH 5IWLA 3B34A 5DVPA 2ORBH 3GBML 3I84A 4ODBD 2A74A 4TM9A 3FUEA 2VDOH 4B8AA 2R7EA 2VDPB 3AZUA 5E9NA 1SY6A 1XGUB 3IDJB 2KQMA 3SKOB 1CQYA 2PP7A 5F0PB 4N2LA 2L8AA 5SWZB 3V0VB 3E32A 1I75A 2ZUSA 1U6AH 5IBTL 4UZGA 5IVXE 4HCIA 1AZCA 1DANT 2GRRB 2I7SA 2BO0A 3NJIA 5BO1H 4YFLI 2X87A 1XF3B 2H6PB 1O6TA 3PWUB 4LEXL 1LXMA 2XV3A 2OS7A 3AU0A 5C0AB 1Z2KA 4IBUA 4PJAF 3FB5A 3L81A 4F27A 3U9UB 1SJVA 1A6ZB 5DHXB 5E2JA 4CSTA 3UZEC 3WTYA 3MLRL 4H5SB 2VB5A 1A7RH 3GKWL 2DW5A 5C0CB 3PHQB 2BP0B 3JVGA 4MA7L 3HS0C 3IMRA 1G43A 1TU2A 2BZCA 3L1EA 3VFOA 1EJFA 1FPTL 1T20A 1IILE 4RG6A 2UWEF 4G7SB 5E6IC 1CGWA 3KLHD 4M62H 1CLZH 2CK2A 2PP8A 5ENWA 4AGOA 2ZUUA 4UF7C 4BSVA 1IBZA 1N4QA 4JG5A 3BH9A 5ITBL 5BOZG 2XCBA 1NCDH 2V9QA 3N91A 2FL5B 5JMND 2XQBL 4ACTA 5EEWA 5DK0A 4JO1L 3NIDF 1GGIH 2BH0A 3WNKA 1RU9L 4KROB 4A38A 2VLRE 1ZE3H 4DX2A 5A7BA 4KK9D 4GXUN 5DVNA 3FV4A 4JQXA 3MNWA 4UU9B 2MOWA 3BPCB 3VXSB 3MLSH 4F8PA 4L9DA 1RUAL 1I1YA 1AJ7L 4OZGA 1D6VL 2X4OA 1BQBA 3QDJB 5LXVA 2ZYHA 2F8YA 4RCAA 3BN9D 4DOHE 5CJQH 1HO8A 2QQNH 4YPGA 4XBMA 5L2JA 1H6UA 3GJFA 4GZCA 5I6KA 4WFGD 8PAZA 4UWLA 3GS0A 1SM3H 1RURH 1UH2A 3TPKA 3NH7L 3X3FL 5IQOA 1CVSC 2EXSA 3QUXD 1CD1B 4F8TA 3K81A 1ZGLB 2BP8B 3MRGB 3I3EA 4JY6B 1HCVA 5HGGS 1XGTA 3LZRA 2W38A 1KJ2L 4PS7A 2J5WA 3G5ZA 2J4DA 1CE6B 3DX6B 4HULB 3L16A 1OSZA 4MAYD 3BDYH 3DTXA 4X99B 3C8DA 5C2UB 1MLCB 1FGVH 3UTTD 3T2IE 5IVXF 2VRAA 3BIKA 5EZLB 2A7OA 2CG2A 3U7WH 3F7LA 4YXHH 3EIFA 4IHOB 4XXCA 1CDYA 2RKKA 5A3IC 3WE6B 4U1IA 3QB7C 5F1NA 4N6QA 1CT8A 4X4MA 4JM2B 3LZPA 1VGEH 5TE4L 1TQUA 3I6KA 1TJHH 4YLBA 4K5BA 2NX5E 3DV6A 2PQRA 3H3PL 4J5VA 4WNDA 4KMTL 4NQED 2XPZA 4JFEA 4WGVB 5C8JA 1W72B 3LKQB 3CVXA 2NDFA 2PYEE 3ZYJA 4PR5B 2NPLX 5IW3A 1E4XH 2XKNA 5GXBB 3TXNA 3UX4A 1IQRA 2EZ0C 5TFSH 5ABAA 2VQXA 3BISA 4BZ1L 3NZ8B 1TVHA 4TXRA 1S7TB 3MGOB 1KELL 2VDLB 3FB8A 5AIJA 4KKBC 3CJJA 3EJPA 3HE7C 5EU6B 3EIJA 2X4PB 5F7DA 1KEIA 5DF0A 4POZC 4I18A 2ZOKA 4ZUUB 3TN0D 3KDMA 5LBSH 4GIAA 2IALB 1BGXL 4NHUB 2V9TA 4R6UA 2F18A 3ASFA 1W9XA 3CVDA 4GKLA 2IANA 4N0UA 4YSSA 2VUYA 3ZHLA 3L45A 2JIXB 4OCXH 2KCVA 3SD5A 2E6PA 4DGWC 4AH2A 4I5BA 1SA4A 3OB0K 5CJ8A 1E5AA 3O4OB 2NUTA 1RH8A 1E5YA 4FG4A 4P5TD 4XO4A 3U3WA 3RA7L 5AAWA 3F7YA 4MB1A 3EJZC 3WHXA 3FUDA 1OSEA 1R5IB 1YEDB 4AVIA 4BA0A 1KT0A 2ZUVA 1IHGA 3NCBB 1ZDQA 3STBA 4KITB 3NBNB 3MYVA 3PYCA 5FA3A 5AOIA 5FAAA 2D31A 5E9DD 3F65A 4GW4A 4PRAA 3KS2A 3VGFA 2EO1A 1NDGA 1N7MH 2VW7A 5SWQB 5J11B 4OD3L 4ZTPH 2H6OA 1UA3A 3KR3L 4TSCH 3RL1A 3P7VE 1RK0A 4UMGA 4PJFB 4U3XA 4BFNA 3FSAA 3QUYB 1QFHA 2W81C 1RMFH 1U4FA 2GCYA 5AB1A 4GZ5A 5B7FA 4M7KL 3UJIL 1JSYA 4FFYA 2ZCHL 4H2CA 4YPJA 3OKOB 4JG1H 3FB7A 5AAMC 4L4TB 5EX3A 4YUEH 2P52A 1LE9A 2NQDA 5ALBL 5B4MD 3W0WB 4AMKL 2KPNA 3C5XA 3FOLB 2GRMA 2H3XC 2WNXA 5DUBB 3VJ6A 3U6RA 3KWVA 5EF1A 5E95B 1W6LA 1Q0XH 5DK2A 3MLZL 3MLYH 3Q8CA 3NEXA 5E1QA 3U4KA 3UC0H 4A1RA 4D0BA 1RK1B 4PWJA 2JKXA 2EE0A 1JNNL 2X6BA 3OR7A 3TU6A 5CMWA 3HE6C 4DX6D 2P48B 2H7WA 4F7CB 3GSWA 4XCYB 3S9DB 5ICXB 3CE1A 1QEXA 2A83B 1L7IL 1XFPA 3CNKA 1S63A 1U8QA 3GDBA 2QPFA 3RB7A 3WDHA 1QRNE 2ICES 3BP6A 4HXBH 1EEZA 2BX5A 1A1OB 1Q0HA 4DO4A 1WP6A 2DZEA 2Z92B 2C3GA 2NCEA 4PJ8D 3NQXA 2N56A 4ZS6C 1N59B 1OD7A 3CKBA 1P5UB 2J20A 2WSPA 3Q6GL 4LSUH 5TD4A 1WT5C 5AUMB 2HRLA 5IK3A 2CD0A 3BKMH 4JCMA 5CERB 1O7VA 4WI5A 4WNJA 5MEOB 2NYZA 4HS2A 1AFVH 3Q44A 2W9DL 3C09B 3D4CA 5AYTA 4DEPB 2LU3A 3C5SA 5LGJB 3VGDA 1BZ7A 3AUWB 3HVDA 4UOW1 2QYJA 1HI6A 5C86A 3OJDA 2XS1A 3O9WD 1EO5A 2WZ6A 1YYLH 3BAJA 4IBWA 3JWNC 4KQ0A 1LTXA 2A73B 4D8OA 1ONQA 2BJML 4WHTA 1ZCRA 5CO1A 3RBSA 1NJ9B 1UWFA 2H3KA 3KPPB 1AHWC 2J3SA 4Z7AA 5JA4D 4AR1A 3JT2A 1LK3H 2F9BT 4NRHB 1MAML 1PD1A 2XQYA 2JK5B 4WO4D 4JZYA 4B7LA 2VIRA 1U42A 3BFQG 1DANU 3IMWA 1ASOA 3N71A 1CF1A 2B1AL 2BNQD 2YA2A 1VFBB 5ABDE 5T8IA 2F1EA 3MNZB 4P9HC 2AK1H 3ARFB 1TEYA 3OB0H 5B8CB 3S2AA 1K4DB 1U3HD 3R4RA 3MX0A 1A2YA 3IDGB 2P5WB 3MUGA 4J23A 1G1YA 4KK6D 4MD4B 2FJGB 2JCWA 1MAJA 3RWJB 5E08L 2H3NA 1NMAL 1R3HA 2VO5A 4XPAH 5FINA 2W91A 2GRQB 3L7FA 1IGCH 2RH0A 3TWTA 4P9HL 3Q13A 3KEZA 5H2BB 4EXPX 2FSDA 3FCTA 5L8PE 1YVLA 3C6SA 3WNMA 5IP4A 3K6IA 4M7LT 4GSXA 2RD0A 2W60A 4P46B 3S7BA 4XE0A 4LAQL 2Q87A 3VWJC 4BJLA 3U1PA 5CZXD 5DD6A 3L22A 3VYPA 2XTJD 4UNTA 3MZLB 1AIFB 1NGPH 1N4RA 2F8XK 1SYVA 3MR9B 4GBXD 1HL5A 5IM7B 1F58H 3SE8L 3VXUA 43CAB 1M7XA 4W9EC 3DMMC 3DIVA 5LB1A 1XCTB 3QUKB 1JYNA 1T2XA 2XQ0A 3K5RA 1DBBL 3FZUD 1Y6NR 1C16A 2DY2A 3QJHA 3ANMA 5FM4A 2NY0C 4ME2A 1A6VH 1V3KA 4F9LC 3VXQA 1XH3A 1OGTA 2NNXA 1OGAA 2C9PA 3MBXH 3PAYA 2L0TB 2VR5A 2O6PA 2AMGA 4HKJB 4W9IC 4JN2A 5BV0A 3KJ6L 3BIBX 2DWXA 2OJZH 4BCZA 1KJMB 4I1OB 2FLBT 1WBZB 3IGFA 1P7BA 4JB9L 4UQ2B 2DMGA 2EXWD 1KFAH 3T8FA 3K71B 4P3WA 4TNWF 4ZW3A 3DOHA 3DO2A 5E8PA 1UZ8B 3SDCA 1U8CB 2HYZA 4IIZA 3UTTE 4B9JA 1EWHA 3JVFC 4R26H 3BYTA 3VXMB 3VTMA 1KIQA 2ERJC 1U93B 4ONGH 1E2ZA 3L3KA 1RUQL 4YHPA 1KXTA 1GL4B 2H2SC 3WQRA 3MGBA 1LO4L 2VERN 5ID1B 2Z31C 2AF2A 4APQB 5D4QA 4KKLC 1MCLA 3TBWA 3MQIA 3IRPX 4PQXA 3SJVD 5FKPB 1MJ8H 1GGCL 2G4EA 2VH5H 1DJGA 4EZLA 1U8KA 3TYFA 1CGVA 2HT4C 4FHJA 1M3JA 3JV6A 1KJ3H 3QJOA 5ECJE 3FU3A 3HB3B 5B3SB 4UIMA 4YDJB 4N6RB 5D71H 4DGVL 1LP9E 2ZICA 4HIIA 5DZNA 2ZXAA 3FQTA 2VSKB 4G8GD 5FWQA 1R5WB 1VF5C 2NXYD 4HKZB 5FA4A 1UCBL 1BQHG 3K6OA 5G4MA 3RWHB 1BFOA 3LPPA 1IFGA 2JKWA 4LUPA 3JYBA 4KRMB 3V0WL 4NKQB 2XVGA 4V1DD 1NAML 2X89D 4XNZB 1HAUA 2B4CC 3D1MC 1TRLA 3CFKA 5IB4A 2VZ1A 5BZZA 3T5WA 3EGSB 1H6PA 2KXPC 2X6UA 4G70B 3WJLC 3LOWA 3BDBA 3BGMB 5D7IB 4WWPA 4ZUTA 3EUDA 4HCRA 4QRQB 4UOZA 1D2PA 5TF1H 4ZW6A 2P9UG 2B4CL 2JJWA 2R0WL 4KFZC 4LIQE 1MWAH 3PPEA 4PI0A 5C0BE 3NYKA 3E34A 2BVPB 4K23H 5GRVL 2TLXA 5GHWH 3MXWL 1WHPA 5EMYA 4OUUA 4PG9B 1YMMA 3WU1A 3DVNA 1ML0A 3E3QC 2C7UA 3BFWA 1BQHA 1VENA 5FHAH 4PTTA 5DRZB 2XIIA 4EUPB 2VM3A 4Z7VB 5I1HL 2WXMA 3SE3C 3WIHH 1CDBA 3FFCE 1GXEA 3CQQA 1QSVA 4C57C 1DL7H 5J12B 3FUKA 2IPKA 3CGTA 5LKNA 2C3VB 4PRIB 1SZAA 1G6RH 4FXGB 4AIXA 4L3EA 3FUFA 4OM0L 3QCVL 3ZL2A 4QYOA 1HSAA 1S3KL 3T73A 1Z3RA 1WZ1L 3DJRA 3OTTA 4J4PA 3UM3A 1BJMA 4HPOH 4OD1L 2VERA 4K7PL 3TTYA 1AO7B 4LDCA 3N55A 3K4DA 3T3MB 3CN0A 2JQZA 4GP4B 4NGHH 4WTWA 1KPUB 4ZDHB 3LVRE 1DBJH 3MI6A 4PJ5E 1T04B 3RTLA 1TTUA 4PBXA 4JQIH 4BH7B 4KO6A 1DFBH 1DE4A 1S7SB 1VFOA 1YC8A 4N20A 4QMEA 4FHBD 4OGXH 4AJWA 1ND0A 1LEKA 1MCQA 2PPFA 3HVEA 1TDQA 3TVMD 3H2QA 1I85C 5EO9A 2CUAA 1CYGA 1HFAA 3VW3L 4JY5H 5HHVH 5HS0A 4YNYA 2CWRA 3WYRA 3N43B 1VACB 2YUXA 3B3BA 4GT7A 1UQSA 3QO1A 2W9LA 2EDRA 2F7IA 1G4MA 1X9QA 4R5TA 2PNNA 1CFTB 1LP9F 3GZ1A 2ICWI 5TQ2H 3EYOB 3VFGL 4PJGB 3MA5A 2QPDB 1BM3H 3N06B 5CECB 1X5ZA 3MRKA 4PY7A 5CP7B 3HI5L 3N5AA 4RFOL 3WEBA 2WXGA 4IOIB 3W2DH 3SKJL 4KRPB 4TNVF 1O1TA 1QO3B 1SYSA 3KPNB 4B97A 1KIPA 2AABH 4LU5L 1JCRA 3VFPA 4R4BB 4ZFHA 2DH3A 2E27H 2FJUB 2RB8A 2XWTA 5F89B 3B3IB 2XFXA 4HHAB 5FGBC 2QGDA 1FNHA 4OLZL 4NZ8A 2R15A 3H9ZA 3IMTA 3LNIA 4Z18A 4QHNA 2NY4D 4LLUB 4APXA 1WBYA 1NSNH 4OCYL 5IV2B 1MUJA 1N12A 2JTDA 3KGSA 3GSRA 4ZJ9A 4MWPE 1D2OA 5GS0L 4OCLC 5DHDA 5GGRY 3GFUA 3DURB 3MREB 4JFFB 1X9UA 5ID0B 1TF4A 1VA9A 3PV6B 5AB9A 2A99A 1MRFL 3QIWD 3BWSA 2YN5A 1TN8A 4KJPC 3UT8A 1FG2A 4Z3JA 5FO9B 3CVBA 4GKZB 2F7RA 1XVSA 3CDGA 3T2PA 2LOEA 4KHTL 3G08B 4RZCB 1AHKA 3I75B 2YS4A 4U3SA 4UTBH 4DX7D 3QQ3B 4NNXB 5HHPB 1DQLL 4JVSA 2OFQA 3P3SA 1FO0A 5F9OH 4AYID 2J49A 2GJZB 4P2OD 5L41E 1JJUA 2H2PC 1I82A 1TJXA 1N0LB 4PH8A 3ZKMC 5KSBB 1NCWL 3NJVA 4N5EC 3W9EB 4B0MB 1UADC 5F6HJ 4AT6B 4NUGH 1MW0A 2XWZA 2YD3A 2Z3FA 3DX9A 5IR1B 4YDVB 3BI9X 1HG2A 4KI1A 3JQ0A 1BZ8A 3T9WA 1TTCA 5L6YL 2EIZB 1RZ8A 1Z9NA 3EDEA 3GUFA 3DSUA 3HG4A 3JWOH 1F3JA 1NI1A 2DL2A 2LFEA 5DWUL 1H3TA 1XSJA 3B43A 3VGAB 1IC7L 4UQYA 1CE1L 4U6XA 5A1AA 3S88L 3PQYA 4JFYA 2ZCKH 1FBIH 1WD8A 2DI7A 1FH2A 3T4YB 3FLFA 1F4WH 3S5ZA 4ZMNA 1MQSA 2E7CA 5CINH 3RWEB 1AH1A 1IZKA 1VEMA 4C4BA 1I9IH 1Y7VA 4CNIB 1BQSA 3ARDC 4YHIA 1BF8A 2XTJE 3Q01A 4J7RA 2F5AL 3WN5A 4GQZA 3FTSA 1X7SA 3DJZA 4GO9A 5D1ZD 3MAWA 3NRQA 4IU3B 1NGQL 1GSMA 4UT7H 3NPSC 4D7BA 2Y2WA 1YEFH 4NRZA 4X6EA 3O6FB 4P9ML 1M7UA 3D50A 1A1NA 5D1QB 5A2CA 2VJ0A 3CFEB 2RALA 2QVFB 1U8JA 2ZP8A 4BQ9A 2LU5A 2QADB 2WLKA 1WE5A 4RESB 1SJHA 2ZKXA 1RZFL 2WZGA 2OP4L 4JBSA 5C9JB 5IHUH 2OMXB 5EOCH 4PRHB 4UUCA 1DUZB 3TPUB 5FV1L 2F58L 4HZ1A 2WGNB 4LVNB 4DP4X 2XA8L 1CR9H 1KIRB 1PS3A 3S4SB 5E76A 3WY1A 4BESA 1O7DE 3BP5B 4AQEB 2H26B 1NA3A 3K2UL 3AM8A 4D3CH 3I9IA 5JZ7C 1TZGL 3KWUA 4FULA 1B4JL 3TTSA 4QRPE 3TP4A 4K8RH 4OB5H 4G43B 3HXEA 1QLFB 1I7ZB 4GINA 4QRRB 1R0AH 1S7VB 1YEKL 4FQIH 1FN4B 4CT4A 2GRLA 2W0FB 2JKIS 2ADIB 2GK0A 3T2NH 4AI7A 2ZX9A 2JFCA 5CXPA 3WDJA 4CGTA 4KKRA 4QXVA 4EKXA 4E9XA 3KVPA 2IVFC 4CKQA 2F8OA 1R5VB 1ZD6A 1NFIE 4CC4C 4MRCA 3BWUF 4XMKL 5KS9B 2X6AA 1I9RH 2Z4TA 3AAAC 5AKVA 4NO5B 2Q10A 1F1DA 1KGUA 1KY7A 2E47A 2EDLA 4G8GE 4N2EA 3P7QE 5MENA 2C9RA 2Y7QB 4M8UA 3JT1A 4XB8A 3CVHB 4BTAA 3L5XL 4LNRB 4U1SB 2D4DA 5F3HA 3VMPA 1CLOL 2AJXL 5L8KB 2X12A 4V1DE 1CFNB 1TYEB 4E68A 4G80A 3N04A 3L4VA 4YR6B 4XHQA 4M6OL 3SGKA 3ZDYB 7FABL 5CJXC 4HOZA 4YBLC 3I74A 1Z5LB 3VI4A 2ITCA 2QKIA 1OVZA 2J8OA 2N59A 5LVEA 4C56B 1R3KB 2YQ2A 1UUNA 3RZCB 1YEJL 3GSXB 3WHE0 1IX2A 4NPYA 1A3RH 2HO1A 4MDJB 5KSVA 3ULUE 4TQ8A 1YNKL 1PLGL 1ZMYA 3OKKA 4FFTA 5EO0B 3WS6C 3RWDB 2HX9A 4G9FA 4N2KA 4YXLL 2DM7A 1X5XA 4XI0A 3BH4A 4RWYH 1W0YT 5T1LD 4KO9A 1AQDA 4R7NB 5J3HC 3FBOA 3TWVA 2FATL 3ASNB 4A63A 3T6QC 3L3JA 2DM3A 1MREH 3E6FB 1FUNA 1FYHB 2BM3A 3ARSA 2YJQA 3DWTA 4XXWC 1A1MB 1YCSA 2ZYSA 4W68A 5CCGE 2GRNB 1KPRB 1G4RA 1QWHA 4U1JB 5D1XD 1G9EA 4DP8X 2P4AB 3NUKA 5GRJL 3F3HA 3VTXA 3U66A 1WDYA 4JFVA 4G7RB 3P7TE 5DMKA 5F7FA 3E37A 1MF2H 4RMBA 1IYGA 1MH5B 2IBGA 5HTSA 3EOAB 3FYEB 4M4RB 4NENA 4TVSa 2WXNA 5F0LB 3ULVC 3AGVA 2WOBA 2ZPKL 1M71B 4U63A 1PKQE 2OR7A 1N3NA 2P9SG 5IGXL 4HS8H 1NBZA 1E4WL 3L5IA 4AXWA 1OF0A 3UYRL 4J6RH 4KY2A 4UYQA 1IXVA 1DCLA 4JAMA 4N5PE 4FOMA 1JERA 1PZ2A 3F83A 2YHGA 3ULVL 1WGOA 1G7JB 2E7HA 4TNGA 2I9CA 1A3LL 1KEML 5DZPA 1JZJA 3IN2A 3QIUD 4AOFA 3QH3A 2R7EB 5HDBB 1EEYA 3O11A 1VIWA 3AB0B 5E4EB 2BSDA 3F64A 2AJZA 4EN3A 5A3YA 1N6UA 1EUTA 3U2JA 4CCAA 2ZXCA 4HIXL 1OM3H 4FF9A 4ORZC 2AQ2A 4OJEH 3ULEG 1UJJA 4LFHG 5CBEA 1UFGA 2JSFA 1KSRA 1F6LL 2X3AA 2FIKA 5DEFA 3FB5B 4HZAA 3SDYH 3MV9A 2VMEA 1WZKA 4XP5H 4U1GB 2XENA 3DRQB 4RNRB 5FM5O 1KPVA 5D72L 1MG3C 3GSQB 3HBQA 5C0GA 4ZG1A 1PGRB 3C08L 2MKWA 3WGUB 3V31A 1TU2B 4M5YH 3RI5F 3VFOB 1H3PL 3P4MA 5A16A 4OOEA 2E74C 1AYOA 4HHWA 4MAUH 3WO4B 5EBMA 4FNSA 3MV7D 3FQ4A 4XODA 4AV7A 2JWYA 3P7SE 2DL9A 3IT8D 3NRPA 3BKYH 2CRYA 1Q1PA 5KVFE 3MKQA 5ENWB 3MRPB 1A6WH 4BSVB 3WAKA 3LPGA 1W0WB 4LLYA 2XN9E 3BH9B 2LXLA 1O1RA 3LSOA 1JGUL 1ZVSA 3PEUB 4OQTH 5JIKA 1TJFA 2Q3XA 4KH9A 5CD3A 3DWLG 1HEHC 4F1PA 2H41A 1IM9B 2GJ6E 1JZ5A 3UTZA 5AVVB 5KUKA 1JE6A 3HJ0A 4HIJA 4ZI8A 4ZOBA 2AXZA 2LU4A 2YBGA 1KCUL 4LMQE 1I1YB 4OZGB 4AQZA 2YPLD 4YHLL 2X4OB 2OA9A 3T8HA 4QY8A 2FDBP 3MZTA 3O2DA 3HG1A 1CD9B 3DJTA 4GTSA 1UD5A 4YPGB 4U7EB 2K6YA 3GJFB 4YBQC 1I7RA 4JM2C 2BEDA 4W4OA 1GH7A 3SFZA 3WLWD 4F7MA 2UY1B 4PJIA 1E6JL 2PPDA 2VMFA 4PG2C 4CBPA 1SOXA 2XN0A 4HU2A 2DLFL 4N68A 4ZN6A 1NMBH 1OT4A 1N26A 1RLBA 2AQQA 2A6KA 3ARZA 3PDDA 4KVCL 2HLFD 3RBGA 3SDXA 2WB7A 4E9VA 5JHLL 3G5ZB 3LDBB 1OSZB 3DTXB 1J1OL 3NESA 4BX9A 4ILIA 3QEHA 2ID5A 3ARWA 1W72L 5D7LA 1LWRA 3ZTNH 1BD2E 1FGNH 5EOTA 2YOCA 2EEDA 1NANI 4OM1H 4KBPA 3GZ2A 4F20A 4ZFFA 2Y25A 4UI9K 5IJKC 3KGUA 1WM5A 3ILPB 3NDZE 1GA2A 4FQCH 3DYMA 1JMZA 5JHDE 4Z7NE 2BDNL 3QH5A 3UDWA 4U1IB 5F1NB 4KUCD 2MIZA 1INZA 1CT8B 5HI4C 3QS2A 2V5RA 3ARGA 1KLFA 3P9LA 4JR9L 1PZ3A 3I6KB 5KJRL 3S8WA 4AV0A 2FB4L 1AOHA 1F2QA 1OAYH 4DIXA 1TLPE 3P0YL 3RX5A 3T2LA 4JFEB 5C8JB 1ET5A 3LZLA 4CN4A 5ARFA 3O4OC 3UAFA 1G0XA 4WI4A 2B3RA 1EZMA 3QAZB 1IAIM 2CE6A 4I3SL 4LPXA 2XKNB 1S9XA 5G5DA 4GTQA 3SY6A 1EHXA 4B27A 3ZIMA 3IJYB 1JRHH 3VM5A 1N19A 1OALA 3AS5A 1IGYA 3RTQA 4JZNA 9CGTA 4LSVL 1BPLB 1TVHB 5DTFB 3M1CA 5GRWA 1PIFA 5EH1A 3FB8B 4UBDC 3K74B 1I1FA 1CICA 3BG1B 1P0SE 5F7DB 3QKYA 3F58H 3D0LA 4I18B 5FSJA 2ZOKB 3SIKA 3VQ1C 1C12B 5J11C 1KTDA 3QEQA 1RJLA 1HZHL 2R2BA 3UADA 4DQOH 5BZXA 5MEQA 2Z0BA 3KXFE 3QUYC 3T8KA 2IANB 4N0UB 4YOKA 2IH1A 1ANUA 3O6KH 1V7ML 2WP3O 2WIMA 5HYSG 4YSAA 2P80D 3KLSA 4MZIA 4AH2B 2DBLL 2ZAIA 2NUTB 2X4SB 2Y6TE 4QTFA 4EOWL 2V2XB 3M45A 4LCIH 1EFXB 4MWFB 2R4RH 5EWIL 1WFTA 4NM8L 2GAZB 2X9XA 5D7KD 5J13B 3P7WE 1J05B 3QDME 4JRYE 3NA9H 3H0TA 2BKGA 4B0ZA 1M6OA 2BW4A 3V6OA 1N5AA 2Z7UA 3MTRA 1G7MA 4MJIA 4XP9H 3CMOL 1J8HD 5FA3B 3B5TA 5IUCA 1ZEAL 2D31B 3EH3B 1EZSA 2FIRT 4Y2DD 4GW4B 3WFBH 4PRAB 1NDGB 3RWCA 3Q75A 4I1NB 2OVBA 4HBDA 3ZO0A 1C5BL 4N8CH 3RL1B 4G2VA 4ZX3A 1N4SA 1NIAA 5I1LA 5HYSA 1P6WA 1XIWD 4XWOC 4TVPL 15C8L 2MPAL 4OF5A 2GUOA 1FNEB 1HL8A 5IESH 4P07A 5G04J 4NIYE 3H9SA 4KXCA 4Z7NF 1P5UC 4NN7B 3CMGA 3AQYA 3T3PB 1XF2A 4ZX4A 4FD0A 4XGZA 2IFUA 3E4BA 3VJ6B 1CXLA 2Y36H 3U6RB 2YZ8A 1O6SB 3D07A 3DV4A 4N66E 3ZHXA 2VTFA 3C09C 4DEPC 4A7VA 4EDXA 3OR7B 1LD9A 4V2CB 1ETJA 2Y7MA 1INQA 4KJWD 5FCUL 4TUOA 3GSWB 1JGEA 2AFNA 2NY3D 3S6CA 3V55A 3SKNA 5LBSA 4X42A 2ITDB 1U8QB 4Z3HA 5LO7A 1KBWA 3AREA 4OFKA 3BP6B 3ZHDA 1EEZB 4NKIL 1MCSA 3FCUB 4UAOB 4Z0XB 4NQCA 4R3SA 3NK3A 3LCYA 3ESMA 2CO2A 2YMXH 4D7PA 3MBEA 3CLFH 4NZRH 5C0IA 4NO2A 5HD8D 5HI5D 3TNMA 3I9AA 2A9NH 4MJJA 4XBGA 4AEFA 4AKPA 2YUWA 3ARFC 3L9EA 5MERA 4M1DL 5DJ2A 2ZXWE 4DESA 3BMVA 3KE0A 3N40P 1WA2X 3X11B 4DK3A 4YHKL 5C70A 3C5SB 1Q0LA 5F97E 4NQDD 4ADGA 3QCUH 1TEGA 3M8OH 4W93A 2EIDA 4F9PC 4LCWD 5EOCJ 1NFDE 4X80H 4L9PA 4ODUA 4LSTH 5BV7L 3GXNA 3FQXA 3NMEA 4P46C 3IE4A 3QULB 5I1GH 4DKDC 1W8OA 5J08A 1AGFA 1TIUA 1MY5A 1T1XB 4PJBB 5BZWA 3IFLH 4IRJB 2EH8L 3VRLE 3MV8A 2F37A 5IJVA 4W1TA 4ODSL 3ETBJ 3T0ED 2VIRB 5ANME 1YUHB 4CYMD 4QLWA 3AITA 1J0YA 1EJOH 3Q48A 3KAEA 3AAZB 1X5FA 4GIPD 4H7VA 2PW2B 1OTTC 3MX0B 1A2YB 3MUGB 3N40F 1R0LA 1DQVA 1N6QH 5HVHB 5ELIA 4OAVB 5JOPD 3NJHA 2K4WA 4QHPA 1GC1H 2X1PA 1R3HB 3H9YA 3MV7E 3FOMA 1S46A 1IAIH 5F1KC 1S7UA 4KRLB 5EZJA 4EDWL 2F5BH 3C6SB 1NBVL 1DFXA 4N26A 2XETA 2W60B 4P49A 1YYHA 2L7QA 5KNHD 3HG0D 3G2VA 1J1PL 1GPOL 2C8NA 5EILA 4Y5VA 4F2MA 4RG9A 4KZEL 2B61A 4CT0A 5JQIB 5DD6B 3SQBA 3RVWC 1DTUA 3T4AA 1KROA 4ZTEA 2NSXA 1PTZA 1KT1A 3EJRA 3SPVA 3ZI0A 1SYVB 1LO0L 3VXUB 2P49B 5BW8C 1YRKA 4QRBA 4CZ2D 3AU4A 2YPLE 5DEGB 4IRSA 2R0KH 3LRLA 3HRAA 4UM8A 5AW5B 4NRYB 2OULB 5CGYC 2BP5M 2Q1EA 4O51B 5PAZA 2VZ3A 5D5MA 3KPQA 1LEGA 1NCDL 2EDTA 4APQC 1C16B 5I28A 1XB8A 3TCTA 4TNVK 3KYKL 3PWVA 3I6SA 3KWWA 3L3DA 5K1NA 1XH3B 1T5WA 1OGTB 1ET8A 4S10A 1JHKL 1NM4A 1OGAB 2HWZH 1PZDA 5F3FA 1CDIA 1ETA1 1PE5A 5A6CA 3HB3C 3ZE2E 4C54A 1G7PA 5IB3A 3TF4A 1X7TA 5GGRA 3WFCH 3RWIA 4L8DA 4JN2B 3FP3A 3NFNA 4XHJD 1PD0A 4OFDA 5E6ID 3TG5A 5ES4B 2D4FA 1JCVA 3SDAA 4D9QE 5BRPA 4Q9CA 2ZKHH 2CUIA 1A3ZA 2EDHA 1MIEH 3ZYLA 3QE5A 4LRIA 2X1OA 5E8PB 3QGOA 1BBDL 2EDXA 4XNZC 5AKTA 5F7BA 1KB5H 3GSUA 4LL1A 4XNDA 1SM3L 1V3LA 2MFNA 2YXVA 1D5ZB 2M2DA 2I9LB 3VRLF 4M8QA 3HAEH 2XRAH 3L3KB 5DLHA 4YHPB 4LARH 4CMHB 5IVZA 4FTVD 3MJGX 4LPVA 2NW3A 2MCAA 5C97A 6PCYA 4XOBA 2AJ3A 1TLXA 3UC2A 4OFYD 3U7AA 3TBWB 5D7JB 1AZBA 2QL1A 3RY4A 5C09E 3TYFB 4GMSH 1U8KB 5BVPL 4Y9GA 3JV6B 2VJ8A 3TO2A 4JGNA 2Y7OA 2IQ9L 4OZHE 1FGVL 4B9ZA 4W6XB 1M1SA 3FQTB 3P69A