4IHQA

Archaellum assembly atpase flai bound to adp
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
512
structure length
512
Chain Sequence
SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILLRMRLSVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKFSRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGAIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FlaI ATPase
publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
total genus 165
structure length 512
sequence length 512
chains with identical sequence B, C
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ihqA02
3.30.450.370 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ihqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ihqA03
2IYSA 2W0SA 4Q1BA 1GVNB 1D2EA 1G5PA 1Q1ZA 5EZ5A 3ZIAA 4LDJA 3NVAA 4V0LA 5DYIA 3D7MA 4Q9KA 4KYUA 2V6IA 1T5LA 2IYVA 3DZ8A 2WICA 1SKQA 4ESHA 1W7AA 2ZJ2A 1R8QA 3RRMA 4HSEA 3LQRA 3AVPA 2ZS7A 2Q3MA 1CKEA 3OESA 2VHCA 4LPKA 2JLVA 1WCV1 5IHPA 5AUQA 3SHFA 2QMUA 2OHFA 3PUVA 1E69A 3WYAA 2ZRDA 2IHBA 4H1UA 4TMZA 2YWHA 5D3MA 5FTMA 2G1JA 1JJVA 4TT3A 2GJ9A 4Q47A 3SE0A 1E32A 2P67A 2RB4A 1KY2A 2D2EA 1KHTA 3H4MA 1Z28A 4FIDA 4G5OA 1M8PA 4LX0A 5EXSA 3AUYA 2R8RA 1AK2A 2ZJBA 3V9PA 1G4UR 4OK3A 3VMFA 2JLSA 2FGJA 4ZI3A 2DWPA 3GLGB 3F5FA 4IOKA 4U02A 3UANA 3PEVA 3O8CA 2OE2A 3TE6A 3FFBA 2B21A 3KTAB 2GHIA 3I92A 1NMXA 1N0VC 5FPTA 2VO1A 1NBME 4PC7A 1NN3A 1OYWA 3QVVA 4URUR 3FDIA 4QGHA 2IYLD 4F91B 2NOAA 3GPLA 3Q3JB 3B1ZA 2C8VA 4JBWA 1JPJA 4P31A 4DSOA 3LW7A 3ECCA 1G20E 4EQ6A 2F3RA 3GMTA 3KUDA 5FBLB 5DGXA 2RGNC 3MLEA 1G4AE 4M8NE 2W6JD 3B78A 3EZ2A 4QNMA 3CKLA 1ZD1A 4JVLA 1F3OA 1G7SA 4CEIA 1E0JA 2MSEB 4FINA 1DAFA 4L9WA 4NZYA 5FL7D 2V9PA 3QBTA 1RRCA 2ZRFA 2XXAA 4PSAA 3HWSA 2C9YA 3WMFA 3U7FB 5EE1A 1GAJA 2OUKA 3UG7A 4LGMA 1ZD9A 4IXNA 1W4RA 1CTQA 2IS1A 3F0TA 1ZNZA 5JS8A 2P0EA 2VP4A 2WM9B 3WNBA 3ZH9B 3R8FA 2YVUA 3WBKA 2YWEA 4S2EA 1ZM4A 4ERNA 1ZC4A 1Y3AA 3LLMA 4KBFA 4Q4AA 3B5JA 3CNNA 4DDTA 4NL4H 3TKLA 4PQFA 5CYOA 4QGFA 1E9DA 4URWR 4MYHA 1M2OB 2WHXA 4TWZA 1BMFD 3GEIA 4ARZA 2N42A 2HCBA 3KJIA 4X8OA 4OBEA 1DAMA 4QOSA 4RZ2A 4R2HA 2KWIA 4BFTA 3HDTA 3R9XA 3T5DA 1FTSA 4V02A 1G8GA 4V0ME 4B33A 4DC9A 3AV0B 4LBYA 3ZS8A 4DEXA 3SDZA 1PLLA 3QBVA 1E9FA 4F4IA 3TVDA 4Q4JA 1KSGA 5BN5A 3W3AA 3K70D 1S0UA 5C2JB 2RHMA 3BB3A 3A4NA 1PUJA 3CONA 4DLUA 2JLWA 3MJHA 5KSZA 1CLUA 3QKSA 2P5SA 4M53A 1AN0A 1XPRA 3OIWA 1R8SA 2CJWA 3T34A 1SXJA 4DVGA 2GCOA 4B3GA 4BWYA 1AZSC 2IUTA 4MYTA 1W5TA 4JJZA 1NKSA 2VP9A 4JVSB 2J59A 4HZUB 4RFSA 3PENA 5KHOC 2IS6A 2X2EA 1WA5A 3RC8A 5DLQC 1W44A 3TJZA 1PLJA 2G1KA 2WWIA 2ZJOA 3IKJA 3LVQE 4K81B 4DLSA 3QF4A 1CRPA 3B6EA 4CDGA 1GRRA 2KE5A 4JLJA 4I1OA 3U7GA 4KLZA 1GRQA 3K9NA 1G8HA 2XJ9A 5ELXA 4DDWA 1DARA 2CHGA 2V1XA 2XTZA 2GBLA 1KNQA 4ZIRA 3DHWC 2J0UA 4PSVA 3SZRA 1LF0A 2BWJA 3CO5A 4YLGA 5K8LA 2C99A 2QNRA 5LD2C 4A2QA 4G3XA 1SXJD 3MMPA 4NPHA 4B75A 1KI4A 1R7RA 1NSTA 3CRRA 3H86A 2IYYA 2O8EB 1RJ9A 1NF3A 3OAAD 4B2LA 4H9GA 1R4AA 2OO7A 3IQWA 1XBTA 1ZM9A 3H1TA 5FR2A 1KGDA 2QTFA 4GPTA 4KJZA 3TSZA 2REOA 2FSHA 4RZUA 4U5XA 1HA3A 4DDUA 3THWB 1CXZA 1LS6A 4OJQA 3ZJYA 3HYRA 4AD8A 4BZPA 2ATVA 3NC0C 1ZINA 3A1UA 5J47A 2O8BB 3I5XA 3FWYA 3KKPA 3KQNA 4QBHA 5EP3A 3L8YA 3GLIE 2IW3A 4FWIB 3NDPA 4G5QA 4DCUA 3UMRA 4GFDA 5FTKA 4A8JA 1UADA 4Q9JA 1N6IA 4LPSA 1N6LA 2PH1A 1XFAA 2TMKA 1KI6A 4OKSA 2D4HA 4D25A 4A92A 2WIAA 4ON9A 4DSUA 2FNAA 1UKYA 1X8JA 4G5RA 1SVKA 3HU1A 2OBMA 3C15C 1Z06A 3GJ8A 2NZ8A 4FCWA 2FSIA 2G3YA 1MV5A 3CLVA 4BZQA 1FQKA 3U4QA 1E2QA 1SHZA 2XSZD 1XRJA 4MDEA 5FPYA 2ERYA 1SQ5A 1EFRA 4XWKA 1IONA 4QJ4A 1QVRA 1RYFA 3ASZA 4M1SA 4RJLA 2ZSEA 2IA5A 3I73A 5SZHB 1VYUA 4JLMA 3PEUA 5TDHA 2V55B 1TTTA 4QBFA 2QP4A 5GJCA 2GAAA 3LVRE 1P75A 2ZYWX 4RD0A 5FPHA 4OL0A 3I72A 4V0NA 4ASUD 2VP6A 5TB5A 2QRNA 2VHUA 2CLDX 2CK3A 1TUEA 4Q7LA 1XJQA 2ZR0A 3I8SA 4HUQB 5FUVA 1KK2A 2WSMA 4LJAA 2W00A 3S1AB 3IIKA 1OIWA 3GLIB 2QI9C 1N5KA 2V6JA 4PPFA 621PA 1OH5A 1AJEA 5CLQA 2ECKA 3EIQA 1FTNA 2XTNA 4YONB 2W2XA 4QG7A 1S9DA 2GNOA 3A1WA 2Z4SA 4IVRA 4Y0VA 3GLHE 4MH0R 2JJ2D 5FBQB 2VHJA 4YXWA 4GNKA 2EW1A 5B58C 3RS3A 4DDVA 5LDDC 4NYJR 1SVMA 5FTJA 4WZAE 1F5NA 1S9HA 3BD9A 4OYHA 1T91A 2E1RA 3NEYA 2VBCA 2CVHA 4M22A 5HPYB 1OFUX 1NLFA 1E2LA 2JDID 1JECA 1SZPA 1VHLA 1H8ED 3D8BA 3K0AA 2AX4A 4OHWA 1N0WA 4Z8YA 1E79D 2PX3A 5IF9A 1Z6TA 1D2MA 3GLGA 2ZU6A 5K8TA 2ASEA 2EFEB 3LAWA 4JLVA 4NH0A 5DIFA 1UKVY 5EE0A 2JLRA 4E07A 3KTAA 4M9QA 1LS1A 3IHLA 3K0SA 5C4GB 5TXGA 3HYTA 4LC1A 4TLEA 4URZR 3X1WA 3EWAA 1OT3A 3SBDA 2OEPA 1VYTA 1T0HB 5C4MA 2OBLA 2V4ZA 5KYKA 1W4AA 3VQTA 4RKFA 3GLHB 1J8YF 1T3LA 1E2PA 2WJHA 4HYYA 3C41J 4AWXA 2B7CA 2QEQA 1JBKA 2CMKA 4DCNA 5JECA 1Q3TA 3RRZA 1OXVA 1ZUHA 5UKDA 3AP3A 2BKEA 1KO1A 2P6NA 1QHNA 2WKPA 3U3KA 1TQ2A 2XTMA 1R5NA 1ZW6A 4JLNA 2FFBA 3TSOA 2ZROA 1XWIA 3ZS9A 1D8TA 4B3XA 2VYFA 1XCGB 1LFDB 4A9AA 3I61A 2VA8A 4MGYR 1AKEA 1T3HA 4BECA 2RGXA 3AH8A 4O2RA 4HLCA 2C9CA 1U81A 1FMJA 5JBQA 5KSYA 1ODFA 1W4CA 1X8LA 2J0SA 5JCPA 4JYCA 4UNNA 1Z6AA 3O8BA 3VKGA 3EZ9A 3O8DA 4ZKEA 2WSSA 3TH5A 4MDFA 4H1VA 2HDNB 4TTRA 1BYUA 1YZTA 3FHTA 1VCIA 1IJEA 3DKVA 2J87A 1Q21A 4LOAA 3JVUA 2O8FB 2EVWX 4AYTA 5JRZA 1E1RA 3LDAA 1CR2A 2JJ8A 4WOPA 3U3MA 4DZZA 1JR3D 3PEWA 1J7KA 3RHFA 1VG0B 2CNWA 3VHXA 3A8TA 3BFKA 2FEMA 3AUXA 2RGGA 3E1SA 4I1UA 2GZDA 2DHRA 4P3YA 3WRYC 4UXIA 1A1VA 2AKAB 3K9GA 2WIBA 4GMDA 5K8UA 2NO9A 2IL1A 3CH4B 2J7PD 1COWA 4TSFA 2FG5A 5LBIA 3WNCA 4FWTA 2DWQA 2V54A 3ADKA 4L5BA 1E1QD 3RYTC 2OCYC 1W0KD 1OIVA 1NLZA 3TAHA 1VG9B 1JAIA 1T3SA 4OI2A 1Z0AA 1TNDA 1RC8A 1OPXA 5ANRB 2GJSA 2H8KA 4KAXA 3ZYCA 2G6BA 5L3QB 1IJFA 5K8IA 3QEJA 3DKPA 4OI4A 4PFSA 2G83A 1HEIA 1I4LD 3UATA 2FZ4A 4PAOA 2ZJ5A 3WY9A 2R6AA 4TQAA 3MRSA 4W5WA 2OAP1 1CS4C 2HV8A 4BFZA 4HZUA 1NVUQ 2AK3A 8OHMA 4JBYA 1IN6A 1EGAA 4MA4A 1YJ5A 1GUAA 2WV9A 1T4GA 1Z6XA 4JLKA 1FMLA 2GXUA 3W5JA 5TMPA 4HEJA 1P60A 1YZKA 4YMTA 1KJWA 2CXXA 3GJ0A 1HUQA 2J9RA 5JWOA 3QXSA 1Z6YA 4M1OA 4EJSB 1YR6A 1EK0A 3IBGA 4MKFA 2Q3FA 5JHGB 5JJLA 1U8AA 4C4PA 3N2IA 5HKKD 2OCAA 2V8OA 4A36A 4II7A 1QHYA 4Q01A 3SJCA 4V0MA 1MO5A 1NN1A 2ZPTX 1ZRHA 3B7GA 1DS6A 2ZUBA 3BJIC 1EFHA 1IQPA 1G64A 3P26A 4M9SA 4RCZA 3R9WA 4A0RA 1P4SA 4KFTA 4B44A 1KDPA 2HCJB 3B1YA 3C7KA 3CBQA 5AK0A 2FPMA 3A36A 2IYRA 2OFXA 3P1JA 4C0AC 1P6XA 1H8HA 5G3ZA 4W9MC 2JIZA 2QT0A 2Z43A 3UG6A 4XVQA 3C14C 3THWA 5DN6A 4JLOA 2PJRA 3SQWA 4DBLC 2O8BA 3LH5A 1GILA 2JJ1A 1CR1A 4FMCF 3BFXA 2JASA 2GEDA 4P33A 1T8UA 4G5SA 2IYUA 3ND9A 4NYJQ 4EDHA 2XEXA 1XEFA 4CEHB 1KK1A 2Z83A 3ETLA 1E2GA 3U7EB 3MWLA 4PO9A 1Z47A 1Z8FA 2BIFA 4W7SA 1D6JA 1KJYA 1OXTA 4AG6A 1T5IA 3NBZC 3W90A 2GZAA 3B9PA 1P73A 1II8B 5SZKB 2O0JA 2BDTA 1ZNXA 3NKVA 3BFVA 1TQ4A 3BS4A 4BFWA 4ILEA 5BYKA 2ZI7A 1OHHD 3FMIA 3EPLA 2QT1A 1VTKA 3BERA 3UWKA 1VECA 2F1JA 5FOXA 1NKTA 2CE7A 4BEBA 2ZRHA 1DPFA 5EUMA 2ZS9A 3T61A 4Q4LA 1YRBA 2VH5R 2GEVA 1RVDA 2EFHB 4A4DA 1QBKC 2FFAA 1XJCA 4LYAA 2XZLA 1M34E 1KDTA 2I3BA 5JJIA 2UZ3A 1IN5A 1F2UB 1DBSA 4HUQA 4NCIA 1CBUA 3QPWA 3S1AA 3SYNA 3GLIA 5TV2A 1DAGA 2PJZA 1G18A 1R2QA 2QAGB 3H0KA 4IOJA 3DPUA 4LBVA 4PQYA 5HCIA 1ELOA 4XTRA 3FVQA 2GBLC 4DLZA 3AVQA 2D2FA 1FPMA 2KBEA 4LHVA 3K53A 3W8NA 4GZLA 4ZCMA 5DNYB 1UM8A 2W6IA 4LHWA 2AR7A 3EG5A 2ERXA 4D82A 2JAQA 1OH6A 1FZQA 4BEJA 4M0LA 3AVWA 2NO1A 3GP8A 1UKZA 2QMHA 1FP6A 1OLOA 2UZIR 2OFWA 2VEDA 1HQYE 2QZ4A 2J46A 2R2AA 2ZE8A 3L2OB 4TQUS 3X1XA 4YQFA 2RAPA 3SI7A 5BXQC 4WXRA 1WBDA 2ZRMA 3M0EA 2D06A 4NCJA 4A6XA 1CEEA 4AURA 4DHEA 2QQ0A 4W5HA 3B1XA 4Q02A 2IUSA 2H7VA 4JL5A 2GF0A 4QFMA 3ZVRA 4BLRA 1OJLA 1KSHA 1XB2A 3B85A 4PXAA 3IUYA 5C46F 1OW3B 4PC6A 3GJ6A 5DSZA 4BFVA 4A8JC 2WOOA 2IYZA 3X1DA 2CBZA 1NVXQ 2HF9A 5BWMA 2JA1A 1VDZA 3JZAA 2I1VB 1T8TA 4LYJA 4RKEA 4YMVA 5FI1B 1GKIA 2FOLA 4PHHA 4AYXA 2QRZA 2CHVA 2VHTA 3U2QA 1GZSA 5CYPA 3NIBA 4JT4A 4EFLA 2IEZA 4L4UA 1JEEA 3RNLA 3P4XA 4UNRA 2IUUA 3PEYA 1SULA 2CCKA 3TUJC 4LJ8A 4A2WA 1XEWY 2CLCX 3LXRA 3QQ5A 2XGJA 4JZKA 1Z0IA 3KX2A 1P72A 2HEIA 1CJUC 3KQUA 3KB2A 4EPTA 4C2TA 4C0JA 1Z08A 4V03A 4LYFA 4Z54A 3FYHA 4B3BA 1E9AA 4FCTA 4LV8B 4HI0E 5GVRA 2QMOA 1RW4A 2QBYB 1YZLA 1KMQA 4BFXA 1G3MA 3LX5A 4EIWA 1D2NA 1G6OA 1ZUIA 4R98A 4Q03A 2D7CA 4M1KA 4JSYA 2QUZA 3M1IA 5J4KA 5KPDA 1TMKA 1MH1A 5E7MA 5EQTA 2O8FA 3MUFA 1QG4A 3AKYA 1XEXB 4DLWA 1E3MA 4GL2A 5SZJA 1TPZA 3N2EA 3TW4A 3EPKA 5KO2A 2NG1A 3UMSA 1NLYA 1Z5ZA 1YVDA 4KSBA 5HR5A 1KZ7B 4DWJA 3KQLA 2VSXA 3DVLA 3G5UA 3P32A 2A5JA 3ASYA 3RSLA 3RS0A 5HTKA 2ZE6A 4PSKA 2OXRA 1NY6A 1PUIA 2RGAA 2C78A 4N1AA 5P21A 4DIEA 2GKSA 2O0KA 5J5CA 1R5BA 3RABA 2GZHA 3SEAA 3PXGA 3SHWA 1AS0A 1VG8A 3ZIAD 5LB2A 1LVGA 4UJ5A 5L3QA 4QRHA 1BO6A 2J0QA 1WDTA 2C96A 4M2LA 4Z1MA 1KKLA 2O8DB 4PZYA 1G8FA 3G82C 4Q48A 5EE9A 3VR2A 1GTVA 3W6NA 1X1SA 2B6HA 2V7QA 4U7DA 1C4OA 4E03A 2RGCA 4B47A 5D3QA 4WAUA 3CWZA 2RGDA 4XVUA 4KFSA 2IEYA 4C30A 4BFYA 2H16A 2CHQA 1NJGA 1JALA 1OH8A 4J0QA 4TT3D 2XJ4A 3R8CA 3ZLJA 2JCSA 5JEEA 3FKSA 1UEJA 3NBFA 5CB6A 3HP1A 1XTSA 4PC1A 4EJSA 1KI1A 4DLVA 2BHRA 5JI3E 3CF0A 1P2TA 3A4LA 3LY5A 1WMSA 1XTKA 3T12A 1G291 3H84A 4HLQB 4IDPA 1L8QA 4ACAA 4A0FA 4B3DA 3A6PC 1GRNA 1F6BA 3T5GA 4B74A 4D81A 2VF8A 3QKRB 3RS5A 1GIAA 2QAJA 4HZIA 3PFIA 1SVIA 4D80A 3CF6R 2YKGA 2FE4A 3SR0A 5AUPB 1JJ7A 2R6CA 1E2NA 1F48A 1TU3A 2FWRA 3QXJA 2YV5A 1Z0KA 4GI7A 4B32A 4Q4HB 4BQSA 1NMYA 4DCVA 1FL9A 3T35A 3IPYA 4JL6A 3MJRA 1JB1A 3DEFA 3C16C 3QXHA 3W3ZB 2ZE5A 2ZJAA 2GXQA 3BH0A 4O0MA 4PO8A 1D9ZA 1CJMA 3GD7A 2G77B 3ZD7A 1QRAA 1S2MA 3KJGA 1GITA 1SVWA 4PPGA 4NHOA 3I8XA 4CEHA 3W34A 2ZJ8A 5BW8A 3MWJA 4C0QC 1VCNA 1F2TB 4LJYA 5KDLA 5B2ZA 4F38A 2OBNA 2Q21A 1YE8A 1WF3A 2GVZC 2YJTD 3QE0A 1Z83A 1II8A 2A9KA 2KBFA 3UIEA 4FI3C 4NBSA 1UDWA 2GJAA 1AZTA 5H70A 4R71A 1DOAA 1GL6A 2DBYA 1E96A 1JPNA 3GFPA 3I32A 4HLUA 1ZIOA 2ORIA 3VR6A 4LYHA 2AKYA 4BFUA 1TADA 3PG5A 5G53C 2BEKA 1CF4A 1G19A 4TL8A 1EFCA 5JSZB 1I2MA 3CR7A 4EPYA 1P7CA 1ZIPA 2DR3A 2UKDA 4NP6A 5J4LA 1UAAA 5GJVC 3CH5A 3NHBA 2NIPA 1TUIA 4KO8A 4MRNA 2AXNA 1P2UA 5CIQA 4YDHB 1KNXA 2VL7A 3DOEA 2BMEA 1WQ1R 2R6GA 4O25A 5GJWC 1F2UA 1R6BX 2ZS8A 1XPOA 2RMKA 1IHUA 1ZM2A 2Q0HA 5G41A 4JL8A 3BOSA 3BGWA 4HAWA 2FZLA 2QAGA 3KKOA 2J7KA 2WPDA 4Q1AA 1Z2CA 3IIJA 4XD7A 4OJKA 3ZZTA 1GNRA 2G0NA 2VQSA 1CJTC 3PITA 4A0HA 2HLDA 3WHKA 1FX0B 3MWKA 3OEHA 4LJ9A 1XNJA 2BMDA 4PZZA 3PIRA 4PC2A 1TEXA 4A82A 1DG3A 2MSCB 2A5YB 1I4TD 1W0JA 3B9QA 5E4FA 4B76A 2IS4A 2CL6X 2WBLC 2PZGA 1NG9A 5AJYA 4JKIA 5AUNB 1US8B 1VKJA 2FGKA 2CCGA 5JWRA 1TL7C 1QG2A 1VG1A 4QL3A 1R0ZA 2J1LA 1RE0A 4TL6A 4GZMA 4LBZA 2E87A 4IRUB 3PR1A 1SVSA 2PX0A 1W2GA 2AN9A 1PLKA 4GRAA 4D4KA 4TN1A 4P0TA 2NTYC 3AGPA 1YZQA 5BYJA 4FMDF 1A2BA 1E2IA 1SKYE 2CL7X 2QTVB 4JMPA 4IDQA 4URVR 1Q57A 2BKUA 4F92B 5FUWA 1TEVA 3TR0A 1FQJA 4G01B 4I4LA 2ODBA 3AB3A 5DE3A 2W58A 2D7DA 1UF9A 3CRMA 1R0YA 3WP0A 1RFLA 3AF3A 1E94E 1JXOA 1DE0A 1XMSA 1W36B 3QENA 5IDVA 1N3BA 1Q1BA 5KU1A 3NBYC 1UBCA 4UXJA 5AJXA 3AKEA 4JYBA 4Q7JB 4ZCIA 4R7ZA 2XZPA 4KXFB 4ACBA 4Q18A 1O87A 1XD9A 1XZQA 1TU4A 1U90A 1QHXA 3MG9A 4DUGA 5BN3A 1W47A 2P65A 2BJWA 5HZKA 3UKDA 2RH5A 4BE7B 4DEYA 4HAZA 2GVDC 4IJMA 3PVSA 3ONWA 3FMFA 1A82A 2X8AA 3VKWA 4BZXA 4DRZA 2YOFA 1KDOA 4UNQA 4BPBA 1XJ0A 1N25A 1W49A 3CX7A 1W1WA 1U0JA 4KCGA 3SFZA 3TQFA 1J70A 1Y63A 3EIEA 4BUJA 1DAEA 2XOKA 2OFOA 3FGNA 1UDXA 1PZNA 3K0EA 2G88A 1SKYB 4BRUA 1XTIA 3OFNA 4TYQA 4TMKA 4WVFA 2QBYA 5AJZA 4L8GA 1P9WA 5FBRB 1MKYA 2Q9CA 4HDOB 2FX3A 3V4RA 3RVBA 3GLFE 2C95A 2FA9A 4I1SA 5CDFA 3C4JA 2ZI4A 2NZJA 1I4DD 3LO5A 3X1ZA 2RCNA 4MYUA 1XEXA 2GF9A 5TVKA 4EPVA 3QXCA 5EXPA 2LKDA 1HYQA 1RRFA 3BWDD 5B30A 1E2HA 4UXHA 1X1RA 4BGDA 1N6NA 5H8WA 1EFRD 5J4HA 4MGZR 3TQCA 4URXR 2JLQA 2SHKA 2VP2A 4RD3A 2JEOA 3WNDA 2GCPA 1TX4B 3WMGA 3AF1A 4NONA 1G3IA 2C2HA 1E6CA 2Q9AA 3SYLA 1G7RA 1GM5A 3EA5A 3K9HA 4DIDA 1S96A 2WMOB 3OIYA 3D6TB 2X77A 4KLNA 5AJWA 3UXMA 2CK3D 1JQJC 4D0GA 1S8FA 3VHLB 3ZVNA 4C9BA 3LFUA 4CEJB 3DZDA 1VYVA 1Z0FA 1OF1A 1U8ZA 4V0OA 5FR1A 4AKEA 3BIFA 3L82B 4C0SA 1KO7A 3BRWD 4N0EA 4YMUA 2O8DA 1QHGA 1QVAA 1YR9A 3I62A 3UWOA 1ZVQA 1BH2A 1HV8A 1FOEB 4Q9HA 4ZDJA 3GLFB 1VHTA 5FTLA 3B1VA 4IFEA 4YXWD 4LV5B 2H17A 3RS2A 2BOVA 3VNUA 2W0MA 1CRQA 3EC1A 2GTPA 3MD0A 3OHMA 2F1IA 4RD2A 1L2TA 1U8YA 1KAGA 1G17A 1I2DA 2WWGA 2XITA 2H1LA 4NE2A 3Q5DA 1FNMA 4US0R 2WJJA 4MKGA 2QGZA 3EWSA 3QUSA 4Q1DA 1CR4A 2GA8A 4KVAA 4F4JA 1Z07A 2BMFA 1NIJA 2Q9BA 3KDSE 5JMTA 2XNDA 1S4QA 2F9MA 5TY0A 3E5HA 1JI0A 4HAYA 3MFYA 5FTNA 1LNZA 2DWOA 2GK7A 4GOXA 3GFOA 3F8TA 5H68A 2EWVA 4N3NA 1E2FA 2FSFA 3QKRA 4DLXA 2BJVA 2GWHA 4IEIA 3UK6A 4CYMA 1Z29A 1XDBA 3TGPA 4DB2A 3DL0A 4HAXA 4Q4HA 1K6MA 2GDJA 3ND8A 5BQ5A 2VSFA 2QORA 3LD9A 1OKKA 3SS8A 3KFVA 4OQMA 2ZREA 3BC1A 4LK2A 4JS0A 1NBMA 4TMTA 4I81A 4C0KA 4GP7A 2A3RA 4I1VA 3QPVA 5CM8B 4WBSA 4JJKA 1ETUA 4AC9A 1ZYUA 1KI9A 3GJ4A 1XTJA 2VHQA 3LNCA 4LRWA 2AD1A 4CIDA 1EG7A 1U0HC 1E4YA 3QSYA 4CT4B 2X1VA 5H1YA 5KOYA 2FN4A 2ZI6A 1OIXA 2A5FA 2QY9A 4R2IA 3ZDQA 2ZRPA 2CLSA 1CULC 1BOFA 1A7JA 3ZVMA 2WTUA 1ZAKA 1MO4A 4TZ0A 1RZ3A 2R65A 2WSSD 4XSHA 3KJHA 5EE3A 3I4LA 4MKHA 4EUNA 2ZSAA 4DSNA 3REGA 3ZQJA 3L8ZA 3QKTA 2WWWA 5FOWA 3BE4A 5JSZA 4IW3B 4WXPA 1NBMD 2DFNA 2WJYA 3K0FB 5KNCA 1RRGA 3ZGXA 1IOZA 1E1RD 2ZAOA 5FI0B 2WWFA 3M4YA 2F55A 2CNWD 1MABB 2C9OA 2ZANA 4OHXA 4UKDA 5FOSA 4PPNA 3VR5A 3QI2A 3HU2A 3EXAA 2PMDA 2WKRA 1CJKC 3CRQA 2QPAA 1K8RA 1N6OA 2FJUA 1NSFA 4B6FA 2Z0MA 4TSFD 1COWD 3OIUA 1G16A 2IYWA 3TLXA 3WBJA 4EJSC 4IHQA 2DCUA 1GOTA 2ODEA 2WJVA 4TYPA 4NCNA 1FX0A 3IGFA 1M74A 3FFAA 3PQCA 3VU9B 1TAGA 1NN0A 3BAFA 4CGZA 2ZIAA 2QP9X 1P9RA 1KY3A 3PCRB 2AD5A 1K5GA 1ANKA 2ZSFA 4UNPA 1US8A 1Z2AA 1J90A 1E9EA 4YC7A 3AVYA 1N6PA 4RY2A 4QBIA 5JEDA 5DI9A 1PV4A 2O8EA 3VKHA 4QNRA 5B57C 4PAMA 2OT3B 5JCZA 3RRNA 4IVPA 4PQRA 4D26A 2GCNA 1G1MA 4LCBA 1OV4A 2EFCB 2XX3A 1M7BA 1E2EA 1KO5A 4P4SB 3EARA 3AVUA 2J0VA 1XF9A 1VPLA 1V43A 3GQBA 2ZUDA 4JSTA 1G8YA 2ZRNA 1OFHA 5KNBA 2YOGA 3QY0A 1U99A 4OQNA 3KKNA 1A2KC 4PC3A 1P3JA 1T0JB 2GJKA 1OB5A 4NYMR 1MT0A 4Q7KA 2F1HA 4JBXA 4DT1B 4XH9B 2AK2A 2DY1A 1SXJE 3THYB 4RSGA 3FE2A 3EA0A 1KMHB 3EASA 1OXSC 1NVVQ 3SN6A 2QG6A 2JLYA 2PL3A 4LHXA 3K70B 4HLUC 2Z4RA 3NDBB 4I99A 1KI3A 3A1SA 3B60A 2PMKA 4Q7MB 4Q9LA 3B82A 4JLDA 4DXAA 4B34A 1H8HD 2YINC 2IK8A 3U61B 2JIZD 5EUQB 5C18A 1LB1B 2QE7A 3GJ3A 4EPRA 1MO3A 2WAXA 2ZRKA 3SOPA 5DN6D 5JS7A 2ATXA 3SNHA 1QHSA 2FMXA 2ZSDA 1BKDR 2OLJA 5M04A 2JJ1D 3LQQA 3BH6A 4HATA 1JNYA 1XEWX 1WP9A 2WOJA 3C8UA 3DMDA 2VP0A 2AFIE 1ZCBA 3LXXA 3V00A 5KPJA 2IX3A 3CZPA 5E95A 4PANA 1UKEA 1DADA 1U98A 3LBHA 1GSIA 2QAGC 2FH5B 2N1BA 4GOJA 3AVTA 1YZGA 3AP1A 3IQXA 2FF7A 4JLAA 4NYIQ 2VPPA 3K1JA 4Q4JB 5JHHB 4A1FA 1KJZA 4L15A 2GEUA 3K9LA 3U5ZB 5F3WB 2IYXA 4PAQA 1S3GA 4B73A 3R7WB 5F98A 4IKEA 1BIFA 2WJIA 2Y8EA 1KOFA 1SXJB 1XCMA 1NVWQ 2C77A 2HJGA 2BMJA 1KIMA 1Q12A 3CRW1 1U94A 4TLDA 3TAUA 3CPEA 1XTRA 4HLDA 2CCJA 1OE0A 4LJ5A 1NN5A 5TARA 4KITB 1WB9A 5KUTA 2O8CB 4QHYA 1KK0A 2O52A 2OZEA 1OYYA 3SC3A 3SU8A 2ORWA 2OG2A 2QM7A 3BH7A 4N0DA 1IN8A 4RD1A 1OXUA 1D5CA 4CEJA 3UPUA 1ZC3A 5EXXA 2XB2A 2XZOA 4BASA 4QM7A 1AQUA 2WWHA 3KKMA 1O3YA 4GMXA 4FMBB 4A15A 2YC4C 3IEVA 2VTKA 1XCPA 4WZ6A 2KSQA 3PJRA 1ZNWA 2P6RA 2P3SA 3GLFA 3WRXC 3QOFA 4IFBA 4EKDA 2W6ID 1LF5A 3BB1A 2P5TB 4OQLA 3T15A 4DKXA 3AKDA 5L3SB 1FFHA 1UFQA 4FMDB 3OIVA 1L7VC 1W4BA 3Q7QA 3E70C 1KYIA 2RGEA 1MRNA 2WJGA 1S3SA 2EYUA 2QL6A 3OE7A 4B3FX 1KSJA 3VAAA 3A37A 3IHWA 3GLHA 3ZZUA 3GJXC 2C5LA 1J8MF 2ZR7A 2IWHA 1XD2B 1LY1A 1NMZA 1XTQA 5GJBA 1Q20A 5FPSA 1D9XA 1UEIA 3NXSA 4MITA 4LZZA 4MRSA 3THXB 1Q1EA 4Q1CA 1P2SA 4YMWA 1EFTA 1YRAA 1HE8B 2I4IA 3ADBA 4OHVA 4QKQA 3KZ1E 3RSOA 5BN4A 4AIIA 5EP4A 1P5ZB 4KVGA 4F4CA 1M6NA 1U0LA 1FP7A 1Q44A 1N5LA 2AWNA 3KKQA 3SYKA 4AKIA 1T6NA 1AS2A 5JWHA 1B0UA 4S35A 3VR1A 4ABYA 1N6HA 1H65A 3GJ7A 3F3YA 2HXYA 1YHNA 5JJKA 3M6AA 4CW7A 2CEAA 1IY1A 4ZDIA 4TQ9A 2D62A 2J41A 1E9CA 3QF7A 1N2CE 2J5XA 4JVMA 4LJ7A 2I1QA 5FOVA 3T1TA 3Q7PA 4E09A 2ODNA 2VRWA 3L0PA 4OI1A 2HF8A 2IF2A 3QXXA 3DM9B 1VMAA 2HT6A 5HCNA 1PVOA 3WXMA 2GILA 2IC5A 1EFUA 4TLBA 1YR7A 2JATA 1C9KA 3D31A 4LUCA 5SZIA 4ITRC 4C0LA 1AS3A 4CVNA 1KK3A 4Z8XA 4DSTA 1R10A 1NG1A 3FOZA 2LCFA 1KI7A 2ZYVX 5EE5B 3TUIC 3KQHA 1G8PA 1GKUB 3IILA 3DDCA 5DI3B 2H92A 1E9SA 4NTZA 1TF7A 3ZD6A 4ZV4A 1KKMA 2PT5A 4ZKDA 4OHYA 3R20A 4M1YA 4TMVA 5JFGA 1DG1G 1QHHB 4OQFA 2J45A 5FPKA 2JLXA 2ZRAA 2Z6VA 3K0FA 3MCAA 3Q72A 1Z3IX 4UNSA 5AR1A 2PCJA 1E9RA 721PA 4NYMQ 1JR3E 4GOKA 4NMMA 3CUEF 4K8OA 4Q19A 1TQDA 4PX9A 1MABA 4Q66C 3SJZA 4KYIB 4DJTA 1E2KA 3HU3A 4MGIR 3VNVA 1P62B 4RD4A 1YU9A 1NJFA 1B23P 2G9NA 1NP6A 1ZJ6A 1P2VA 2AFHE 1ZM3A 3K0AB 1SVLA 2W6JA 2HXSA 4U00A 4AYWA 5CM9C 2P6UA 1NL3A 4IDHA 4PR0A 1Z6GA 3KB1A 1YZUA 2PEYA 5HE9A 2XNSA 3VU9A 4BLTA 2IBMA 5FL7A 2YWFA 1U9IA 4K46A 2J3EA 1WXQA 4AY2A 4C3ZA 3CB4A 4HB2A 3CWQA 2W2VA 2PEZA 2DB3A 2A78A 1N5JA 3MAAC 3EZ7A 2A2ZA 1NNEA 2EFDB 2QMEA 4AKHA 1NIPA 4FN5A 4LWZA 3VR4A 4Z1MD 5AWFC 2IWRA 2ONJA 2ZSBA 2V7QD 1YZNA 2QA5A 4KSCA 1L4UA 1LV7A 1XXHE 4Q5IA 2V1UA 5AJVB 1X3SA 3MGCA 2ORVA 4WA7A 4BLQA 4B6EA 2F6RA 5DHFA 2LWIA 4P4SA 3K09A 2QU8A 4KFUA 4DLYA 5E7JA 1FNNA 1WRBA 3FKSD 3DOFA 5FBVB 4NCHA 1BMFA 3D3QA 3HR8A 4XWOA 1IY0A 2PLFA 5JI2E 2HYDA 1T9HA 3U7HB 1E2MA 2BBSA 4JLPA 3GEEA 4TYWA 4DT1A 2IS2A 1RIFA 3TSWA 2IT1A 3REFA 1BYIA 3THYA 4C7OB 1KMHA 2NO6A 2JLUA 2CE2X 4KFRA 1IY2A 2O5VA 5CK4A 1CR0A 4OK5A 1LTQA 2G0TA 2N46A 2JGNA 2YC2C 4URYR 3CX8A 1C1YA 1OFIA 4L16A 1ZNYA 1DVRA 3FMPB 4GDFA 2ONKA 1Q0UA 3C5HA 1KSFX 3IO5A 3TBKA 5KDDA 1ESNA 2OCBA 1GDDA 4DCSA 3R9IA 2NPIA 2GETA 4LHYA 2F7SA 2Q3HA 4D0NA 1XXHB 2PBRA 2A7QA 4D6PA 1XX6A 2BEJA 1S1CA 4JVNA 3K0CA 1E0SA 1ZCAA 1GL7A 4MQBA 5J40A 4EFNA 2NGRA 1G41A 3K8YA 4DLRA 3B1WA 4X8HA 1IN4A 1IM2A 1VIYA 1AGPA 2FV8A 1EESA 4RZXA 3R7WA 3TMKA 4CRWB 4GT1A 1EX7A 1UBFA 1M1YE 3LBIA 3AVVA 2R44A 4HDQB 4MRRA 2NQ2C 3AF4A 4TTPA 2BM0A 3V4FA 3OAAA 1P61B 1XD8A 2L0XA 1BS1A 1MRSA 1QDEA 4B3CA 2GAOA 5GVSA 2BM1A 3LV8A 5JRJA 4BFSA 4D0LB 2ZI5A 3T1QA 2OAQ1 1RKBA 4BLPA 2O8CA 4BLSA 3I3SR 3VTKA 4IDNA 3T06B 2R62A 1GKYA 4DB4A 3NC1C 2BCGY 2BCJQ 5C1BA 4QJ3A 2IXGA 4M1MA 3HJNA 4HB4A 1CIPA 3KQKA 1R0WA 1N6RA 3EPJA 2IXFA 2AL7A 3PUXA 4EPWA 1HT2E 2WPDD 4XD7D 1W5SA 4PO1A 1KI8A 4Q1FA 3VX3A 2HLDD 1W36C 1GL9B 3L0IB 3OEHD 4TZ6A 1KO4A 1M7HA 2HUPA 5IRCD 3P27A 3LWNA 2OLKA 2KI5A 2ZI3A 2IF0A 2H57A 1W0JD 5L3SA 1QF9A 5LD2B 3U44B 1L4YA 3U6BA 2EQBA 2IHYA 4M9XA 5CLLA 1X86B 5G40A 2ZAMA 2CL0X 1KTVA 2XB4A 3CM0A 2XSZA 5E7IA 2YOHA 2XAUA 4QHTA 1G21E 1Z0DA 2V3CC 1XD2A 5CJPA 2F9LA 2ZTSA 4FMCB 421PA 1E0KA 3THXA 3RRYA 4QJ5A 1AIPA 2YHSA 4KHZA 3CW2A 5F2EA 4MRVA 3MSXA 5EJEA 1DO0A 2QPTA 1Z63A 2CVFA 4ASUA 3BK7A 3L0SA 4IEEA 4KU4A 4PHFA 1YR8A 1ZBDA 2ZM5A 2B7BA 3WYGA 2R6DA 4A2PA 4L9SA 5FL3A 5F9FA 1E4VA 2IYTA 4PHGA 1RYHA 3DM5A 5JLJA 4C0BA 4P4TA 4XTCS 1J2JA 3CZQA 2JJ2A 4CT5A 3EAQA 1KO8A 2ODWA 3ADCA 3TVTA 4DUGD 3O8RA 1Q22A 1GP2A 3AGQA 4HB3A 2P2LA 4M9ZA 3ZZ0A 1ESMA 2GESA 2WKQA 1N6KA 1ZD8A 1GNPA 2ZVPX 3QG1A 4HDCA 2YWGA 3KFXA 5EP1A 1Q3HA 2FPLA 1EWQA 2LKCA 3U3RA 1GWNA 3ADDA 1M7GA 5J4VA 2XOKD 2JDIA 2CDNA 1R5OA 3AP2A 4FW9A 1H8EA 1DAIA 3ICEA 2R9VA 1QZXA 5DI3A 3OFND 1E79A 4ZDKA 4RD6A 4G1UC 1NVVR 2VLIA 3GEHA 1XMVA 3H2YA 3RWMB 1W48A 2F43B 4KODA 2YZ2A 2VP5A 4JT2A 1FUUA 1QHHA 4B2IA 221PA 3PV0A 3ICQB 1A5TA 1V5WA 521PA 3SJBA 4IVQA 1DO2A 4AI6A 3IBYA 1DAKA 1Z22A 3QEOA 2QSZA 3KXKA 1N0UA 3KXLA 4US1R 1WBBA 3JZMA 4MYCA 1JR6A 1EX6A 4QGAA 1ZU4A 2R6FA 2QENA 2F3TA 4TLAA 2VF7A 1K5DA 2WVJA 3RS7A 3Q85A 4XSGA 5CJ2A 4M21A 5FBWB 3W9YA 2MSDB 1J99A 3HR7A 4B43A 3AKCA 1TF5A 3KL4A 4TL7A 5IT5A 3U60B 3FTQA 4Q21A 3HPQA 1N5IA 4R9UC 4NYIR 3W6PA 1EXMA 1DEKA 1XZPA 2FFQA 4CF7A 1TF2A 1IXRC 1X8KA 2X19A 3PUZA 5DH9A 2OXCA 4GBMA 1XMJA 4M1WA 5EZ6B 2BC9A 3P4YA 4P4UA 2IXEA 5HE8A 1SHKA 1AM4D 2PZEA 3FKQA 3EZFA 2QROA 2WZQA 2QP3A 1A4RA 4XIGS 4A6PA 2E9SA 4PPQA 1HQCA 4MGKR 5G3YA 1HE1C 3AF0A 3O47A 1W46A 3OEEA 3Q5EA 1E99A 4XWAA 3LX8A 3LLUA 2ZITA 3I1FA 3IO3A 4GSYA 3RLFA 4LC0A 1UJ2A 2OCPA 3U3OA 2RGBA 2OV2A 1AKYA 2ZRCA 4AK9A 3AF2A 1JR3A 2YYZA 1DTSA 5GADl 4TLCA 4JKYA 1W2HA 2NO0A 2RGNA 3L43A 3PUYA 4IXMA 2ZRJA 5LPNA 2VSOA 2C98A 3IDQA 3KUCA 1IXZA 5KTYA 5DHAA 2XNDD 2J7PA 4EAQA 4QC2A 3CF2A 2OM2A 4EPXA 4LSGA 1E1QA 2AHOA 5A0FA 3BORA 1W0KA 2C03A 1QHIA 2QQEA 4LI0A 5CITA 1OB2A 1F2TA 1CU1A 4C7OA 1E0AA 1S1MA 1ONBA 5L3VA 1JEDA 3SBEA 1UBEA 2EWWA 2MMGA 3OEED 3QJYA 3FHCB 4KV9A 4QXAA 2JLZA 4D4JA 2FSGA 2PCLA 1G3QA 1OFTA 5B64A 3VR3A 3OZXA 2Z5FA 5CK5A 2REXB 3EZ6A 5DYGA 2ZEJA 2ZQ5A 1OKKD 4TMWA 5A4JA 5L8VA 1GG2A 4O2LA 2ZRBA 3QIAA 1XXHA 1KZGB 3EPHA 1KDRA 2EU8A 3LW8A 4MKIA 3PUWA 5D3MB 5DO9A 2FFHA 4WW0A 2A30A 1II0A 2WWYA 2QN6A 3EC2A 1CJVC 2BBWA 4B48A 5KDOA 4US2R 4V0KA 1LW7A 1XMIA 3U3JA 2NMVA 4POAA 4ZI2A 2YNMA 4TTQA 3RAPR 2ZXUA 3Q8XB 2FPKA 1U9IC 3GCGA 3CRVA 1DAHA 2ZRIA 5HKKA 2B8WA 4FXPA 1RPZA 4NDZA 1G5TA 5E3HA 2BBOA 3WYFA 1ZMXA 4TL9A 4PHTA 1OH7A 1MR3F 2ZVQX 2AWOA 3HPRA 1CP2A 4PTLA 5KSOA 1EWRA 2QSYA 2ZJYA 1G3RA 3A1VA 2A5GA 2VIIA 5DISB 4TMXA 3RC3A 3RDPA 4JLBA 3AVXA 4B35A 2ZUCA 3Q9LA 1AA9A 3EW9A 3WP1B 5L3RA 1UBGA 2ZETA 4FD2A 5EXTA 5CB8A 5CIWA 4EQ6B 4TYNA 3K09C 2WAYA 3B8HA 3DMNA 4Z51A 3W6OA 2UVQA 2ZYUX 2ZI9A 5FUYA 4W5JA 2DFTA 1WE2A 2ANCA 3IIMA 2X2FA 2ZJZA 1R0XA 1II9A 3TK1A 3RS4A 4O3MA 4CEIB 2BVNA 4DCTA 2DYKA 4Q9IA 3SQXA 4UJ3A 5FFMA 3JVVA 3TUZC 2ZYTX 2GXAA 2XXAB 2QTHA 4QM6A 3U44A 3K70C 3A4MA 2GK6A 3N70A 2QPOA 3IEUA 2RHDA 3BBPA 1XP8A 4LJ4A 5J4YA 2ZRLA 2QGNA 1AGRA 1OHHA 4RCYA 4ZO4A 4CZ2A 2BV3A 1FUKA 4LHZA 3TNFA 3J81k 1GFIA 3NTUA 1NRJB 4OQXA 3CPJB 4EFMA 1IBRA 3B2EA 3KXIA 3VFDA 3DO6A 4Q4AB 3FB4A 3MWYW 3AM1A 4IDOA 2REBA 3N5CA 3ZVLA 2WWXA 4LBWA 4XOIA 3G0HA 3L0OA 4MUBA 1G7TA 3CX6A 2O0HA 1KAOA 5F9HA 1MO6A 2FEOA 4ARZB 4AKGA 4E22A 2GRJA 2HT1A 4B71A 4MRPA 4C2UA 2HYIC 1X6VA 1PJRA 3K0CC 3UMFA 1W36D 2D3WA 4KBGA 2QM8A 4D2IA 4HAUA 3A1TA 4OK6A 2PLRA 3TRFA 4ZPXA 5A5GA 2EFGA 1RRPA 4ZCLA 3ZQ6A 2ANBA 4G0NA 2ZU0C 1DELA 4GP6A 1G3UA 4Q00A 1SXJC 4MUAA 4M1TA 4IOMA 4YDSA 3T1VA 121PA 2FU5C 3QKSB 2AXPA 2B8TA 4FCVA 4RVCA 1G9XA 4AG5A 4D4LA 2ZE7A 2CJWB 1E98A 2GCOB 4P32A 2QE7D 1F60A 1NI3A 2H5EA 3NBXX 1YQTA 2EYQA 3RANA 2KJQA 4D4MA 2OESA 4PZLA 4RFSB 2OILA 3W5IA 2GXSA 4NKRA 4DLTA 2DFLA 1YKSA 1OSNA 2RKOA 2BBTA 1ZP6A 3CNOA 3E2IA 3NEJA 1SGWA 1Z0JA 1NY5A 4IOLA 4E5UA 3CIOA 2KB0A 3I5YA 3QVUA 4KI0A 3VX4A 3A58B 4QHSA 3CNLA 3QF4B 4TYYA 2PZFA 2D74A 1HURA 1ZUNB 2F43A 3NH9A 5FOUA 5FUXA 5IK2A 3NHAA 1E2JA 1VIAA 4UQOA 3SFVA 4WZBE 4G5GA 4M4SA 4ZIRB 2J0UB 1MOZA 4OHZA 1HY3A 2WMNB 3LBNA 4YMSA 3AVOA 4BRWA 3EIHA 1VCOA 3NG1A 3QG5A 1VCMA 2C04A 3NH6A 2GJ8A 3QNUA 6Q21A 3FMOB 2K5UA 3LRPA 4Y0AA 1RJ9B 3AEZA 3NWJA 3TIFA 1XPUA 5FOTA 1ZU5A 1TQ6A 3W8RA 3CPHA 3X1YA 3AQ4A 4RZ3A 3TW8B 3EX7C 3GJ5A 2NPFA 2NO7A 3FPAA 3WHLA 4ESVA 2FDCA 5KSPA 3OF5A 5IK2D 1U2RA 2B92A 1FW6A 4OI0A 4HUTA 2OSBA 3QKUA 2A5DA 1E2DA 3X2SA 5CDFE 1E9BA 1G7CA 1P9NA 1XU4A 1AQYA 4A8JB 2DPXA 4XJXA 1HH4A 1KI2A 4XVRA 4BLOA 1KI6B 3KJEA 4LJ6A 1OXXK 4LV6A 4C0HA 821PA 3FHOA 3CR8A 2IYQA 1IXSB 4LY6A 1JQLB 1JAHA 2HJVA 3TR5A 5FH9A 1HT1E 3IPXA 1G5RA 1IN7A 2ZRGA 5HZHA 1IAQA 3C5CA 4JIMA 2H18A 4X8MA 4ZDWA 1SVOA 4NCKA 5EP2A 2Q6TA 1UPTA 2DFKB 3U4QB 3OE7D 3WMEA 3BB4A 3RWOA 4RFVA 2F1RA 3B13B 4B2PA 5KNDA 3GFTA 3P20A 3QPUA 4F7WA 3BXZA 4NU0A 4F93B 1G6HA 1Q1QA 1ZM7A 1HTWA 2W83A 2MMCA 2ZR9A 4Q1EA 3LA6A 4X8LA 2W2TA 3U6KA 4A0GA 3GLGE 1GNQA 4HB0A 4HAVA 2PT7A 4QBGB 5LB4A 4WIAA 3SJAA 5AUOB 4QGGA 3THOA 5JZVA 3T1OA 1JXMA
chains in the Genus database with same CATH superfamily
4E6PA 2ZS7A 3L3BA 5CMLA 4DMMA 5JZ9A 3LCEA 3UNWA 1NNI1 3H97A 3MTGA 3P9XA 1UT5A 1E69A 3FLBA 2G1JA 4LXQA 2D54A 3ZUPA 4QAQA 4QUHA 1Z25A 4N0PA 3H4MA 2Z9BA 1Z28A 3LGXA 3WLIA 1UXGA 4BWGA 4PLPA 4ZI3A 4TSKA 4U02A 3UHFA 3VO8A 3WKEA 2ZC6B 3TE6A 4YRTA 1VLJA 3DXYA 3I1YA 2Q3JA 2O19A 1CVLA 1T35A 5A9RA 3LP5A 5GZ3A 1QGOA 3O21A 4YRLA 4DSOA 3CB2A 3IX7A 1ODIA 3K1YA 4QU8A 4KQRA 1QIIA 1KIAA 2GI4A 3QTLA 1SMKA 3P0RA 3KJNA 2WC1A 1OT6A 4RKWA 1H3EA 1T2FA 4GOGA 2QXTA 2X3FA 4EG6A 3NJ8A 3T8GA 1G9SA 4DDTA 4NL4H 1B15A 4QOSA 2QRVB 1KYXA 4DE3A 2EGHA 2VDQB 3PNYA 2I2AA 2VQEB 1EZ4A 1I6KA 5BN5A 2P2DA 4IF4A 4RA6B 4XUCA 1Z7EA 3RTGA 2P5SA 1AN0A 2HKIA 3EZNA 4RZIA 3OJXA 1KJJA 3DBLB 3D64A 2QRJA 4IIYA 1BZYA 3TJZA 4EVIA 2W7TA 4UTXA 1N1DA 3PXAA 2ASVA 4EY5A 1PVDA 1DIOB 5LMCA 4TS4A 3CO5A 2BKVA 1C0LA 1WD5A 2GAIA 4QPJC 1WE4A 1RXYA 2WD8A 4TLIA 5BORA 4WFJA 1K7XB 1QS0B 3L8YA 3NDPA 3HY6A 3G5AA 1N6LA 1M0SA 4D25A 2B1JA 2VH2A 3VDNB 3ORYA 5K99A 3GQVA 3CE6A 5THKA 2OBMA 4KYVA 3WAKA 1X80B 5F82A 3ASZA 1XEAA 3RSCA 1OJ5A 3ZHZA 5TDHA 2Z2ZA 4P2GA 1BD4A 1MNAA 3HNPA 1XWWA 3EQ9A 1XJQA 1U2PA 4IICA 3TZCA 2W2XA 2GNOA 1KETA 1H1TA 3PFCA 2D4AA 4LXYA 4RDXA 4CLOB 2GN9A 2BGNA 3EJWA 5DM2A 1E2LA 3HFJA 1X7ZB 3D8BA 4OHWA 4B3SB 1YLPA 2ZU6A 5DIFA 3LAWA 1A9PA 1KZ9A 1B7GO 3O4VA 3HYTA 2ZT6A 4JP8A 1LQUA 1DFHA 1BVUA 2Y2HA 1Q3TA 3RRZA 5DSXA 5UKDA 1KMMA 2QJFA 1J0AA 3GCZA 1OZAA 5JXHA 1GXSA 3B9RA 5DCLA 3RT1A 3L46A 4KRGA 5DX0A 4MDFA 5EN4A 4TTRA 1BYUA 2MYUA 3JVUA 2EVWX 2GBCA 3HFSA 3T4PA 1CI8A 3TF5A 1VG0B 3N8HA 1U5BB 4ZQIA 3AUXA 4UXIA 4LRUA 1RXSA 5EHGA 3H9QA 5DZSA 3BRSA 1COWA 4AIRA 3CUKA 3TPFA 4POOA 3LGSA 3V6MA 1E1QD 1FDIA 3TLGB 1ULHA 4IJQA 2ADMA 2H8KA 3ZYCA 2H2DA 1LSVA 3DKPA 5JYPA 3TLZA 5BSHA 1HS6A 2V45A 1JWZA 3DBAA 3WY9A 5J58A 4RF4A 2M7VA 3GMIA 4HEJA 1NZJA 1YZKA 3GJ0A 2PDRA 3C5AA 3LCJA 1JHUA 2Y2OA 4EJSB 4AZTA 4EAAA 3CU5A 4II7A 1MW9X 2WJZB 3DD1A 4UTOA 1BD3A 4KFTA 4D9IA 4EW2A 2Z43A 3UG6A 3F98A 5EJIA 1QIJA 4JLOA 1K55A 4D3XA 1I3OA 3IXHA 4M88A 3JALA 1VKHA 4RIFA 2GBFA 2VAWA 4CEHB 3GP3A 2K31A 4HPXB 1G55A 2QX4A 4JT9A 4NBWA 3NKVA 1B26A 2OK8A 1U2TA 1PR6A 1P7VA 5FOXA 2WI8A 2NSLA 1M8JA 3B89A 3TJZC 3ETGA 4P85A 3JQ6A 3PDJA 5C1IA 2XMGA 4W63A 2HU5A 2YFKA 5H82A 2VG8A 1SFRA 3T41A 1LFAA 1JI3A 1FFEA 1P39A 2NO1A 2OFWA 4KFCA 2DMRA 4H7JA 1PQUA 3AFMA 2XUFA 3MN1A 4Q3NA 2XD1A 4IQFA 2ILTA 4RX1A 3JARB 4BFVA 2GSWA 2B95A 3PBSA 2RJ3A 1MD9A 2H8GA 3AJEA 3ABQB 4JQZA 4AXXA 3KIPA 2ISSD 1FNDA 3AESB 3B3QA 4ALJA 2H2HA 2NZ2A 3PWTA 3KEGA 1ISMA 3K1TA 2IEZA 1JEEA 1FF9A 2BT4A 4UBOA 2IUUA 4Q3AA 1SULA 3KHSA 1D8AA 1O5IA 5F6AA 1ZAYA 1CJUC 2QYBA 5FORA 2LB9A 4N82A 1L5OA 3FPJA 2GLTA 3ODPA 3L4SO 4BJ3A 1UCFA 4N6OA 1LEHA 3HHEA 4RORA 2D7CA 3AHFA 3FTPA 1YLZA 1OXBB 2EKZA 2ZC3B 2VSYA 2ZE6A 1DFIA 3A70A 3NRJA 1U4OA 2Z1NA 4LVCA 4PSUA 5HRUA 2O7QA 2C96A 4Y2UA 1O58A 4HI4A 2V7QA 5KTPA 2OUIA 2I4NA 1HSOA 4X3PA 4WAUA 5IJAA 4COKA 1CY1A 3LCCA 3NOUC 3R8CA 1O0BA 1RP7A 3FKSA 3U4MA 3RUDA 1P0ZA 4JUBA 2OHVA 4YAUA 3U7RA 4IDPA 4ACAA 5GTDA 2GASA 3U39A 4YRKA 5AUPB 5AVQA 1TU3A 3S4YA 1FJ3A 1NMYA 3TL2A 4RVNA 2VJKA 3RV4A 4XGRA 1ZH0A 3UJ7A 1JAYA 3JYHA 4C01A 1W93A 1QRAA 4F8YA 3KYIB 3KYDB 2WJPA 1MB2A 4LJYA 4QUAA 2C7RA 4G25A 3HLCA 1ZGZA 3R7DA 2A9KA 3DTTA 2ZUVA 1TCBA 2HU7A 2BP7A 3HLTA 1YS1X 3UAVA 2A1TR 5A0TA 3DWKA 4KO8A 5GLCA 4FFNA 3W2TA 1P2UA 4KZ3A 4RDIA 1ZM2A 3A0RA 3IIJA 4TN5A 3U0VA 3BQ9A 5EL0A 4KRYA 4IQ0A 1GFZA 2J9XB 1WM1A 1OAKA 4PGGA 1VG1A 4WXMA 4LBZA 3A3EA 1W2GA 4GRAA 1K55C 5LQKA 3P9YA 2BKUA 2OCGA 3O82A 3P5BA 4A8HA 5FWYA 2WT9A 3CLSD 4JJAA 2F4VB 4ZCIA 3IKVA 2JGFA 3NDGA 4R7ZA 3Q7SA 2OSUA 1NKVA 5AKJA 1RZUA 5GIOE 4G8CA 4ZZ0A 2Q5JA 2BJWA 2CEKA 4D5EA 2VOJA 1X7YA 4CFZA 4BZXA 3SFZA 4NATA 4Q16A 1XAJA 3ZCQA 5B4UA 4YGXB 5D5QA 1IOLA 5EIAA 4HK4A 4IR7A 2FW8A 2Z1MA 4YMGA 1OX4B 2WZXA 2VHWA 1N32B 3A1NA 4PRKA 1UBRS 1HI9A 4L9RA 2ZL1A 4MGZR 2YRWA 3H17A 3PS9A 2V7UA 4HXYA 3VSEA 3L06A 2G9QA 3WQQA 1GM5A 4DVJA 3QUAA 5CB4A 2JIBA 3D6TB 2A9RA 3B70A 2PH5A 3SM9A 4XMZA 1UQTA 1BH2A 5CTNA 4ARAA 4AO6A 2EX2A 4WX2B 3VC3A 4Q3CA 3O9MA 4BVEA 3MD0A 2VKTA 1NT2A 3VU0A 3BSSA 3BWYA 4US0R 4MKGA 4D3DA 1GA1A 2QYTA 1TYDE 13PKA 5JMTA 3Q6NA 4XGIA 2JI8A 4LIPD 5BN4B 2DWOA 1PK8A 2D13A 4NFYA 1H6DA 1QFSA 4GOXA 1SUFA 3DV2A 3ZY5A 4CYMA 1BX1A 1Z29A 4F9TA 1UBNA 3LL7A 1AO3A 3LD9A 3BM5A 1C2TA 4H2DA 2PV7A 2Q4EA 4JJKA 4KAAA 3LNCA 5B37A 2AD1A 4JOQA 4F6RB 3R3WA 3U9LA 1C2YA 4XYGA 1RADA 3SY8A 1GFSA 1SBTA 1JAZA 4R3AA 1RZ3A 5EE3A 1LL9A 2RKBA 3UAOA 5JSZA 4HQKA 1ZKJA 3FKWA 2O1SA 1W2WB 1OLSB 1JHZA 1HSZA 4LMRA 1ODVA 2NWQA 2FJUA 4Y9UA 1PZOA 4B6FA 1YBMA 2Z0MA 3X2EA 4MHTA 2C1XA 5CA1F 1FMTA 2PMEA 5JYOA 4I2NA 1PQPA 2FHSA 2QP9X 5AKKA 4E3MA 2J67A 3OJFA 3MFDA 2ZSFA 3LDGA 2XT6A 1EJBA 3C45A 5JEDA 5H80A 2R7MA 3RRNA 1HZZA 4D26A 1JILA 2DWCA 3LXUX 4DR5B 2B78A 2J0VA 2ZRNA 5HQDA 2BGRA 4I8DA 1TFRA 2HK9A 1NW5A 4R0MA 4KX9A 4DWOA 5EGSA 3WLTA 1J06A 3KBBA 3TXAA 3O1IC 4B7XA 2I55A 4YR9A 2PMKA 3I6ZA 3B82A 2O5RA 1EUCA 3S8YA 4EPRA 4OXXA 4E3JA 4IL5A 1JDJA 5K1VA 2JGRA 1THGA 1MXHA 2WV7A 2AFIE 2W2MA 5EVID 1O6BA 5E3IA 2VPPA 2W3EA 2GEUA 3ZHYA 2IYXA 4ENRA 4IKEA 1ESPA 1CEXA 4OJYA 3EY9A 5JS6A 5L3UE 2YJ4A 5TARA 2EF0A 4OREX 2VA9A 1PT9A 4I7EA 3TTUA 2X41A 5AHRA 2VN8A 2XB2A 4IAOA 2C7BA 2Q3BA 1GYPA 4MTCA 1P2GA 3OO0A 4YNBA 1WW8A 4G0XA 2GM3A 1G8AA 1KYIA 2GOYA 3R7FA 2G0AA 1P2SA 4TRJA 4MQLA 4XJSA 4MGEA 5KOIA 5EP4A 5JE8A 3NDIA 1TLPE 4RE6A 4I9GA 1DOZA 3PGXA 3FPLA 4CCYA 2VRWA 1T36B 4H6JB 5EKUA 4FGMA 4L85A 2JATA 1IOVA 1EGHA 3PP8A 2XHEA 1SZJG 5LZ8A 3KR9A 2Z2YA 1DKLA 1P1HA 2A1UA 1FTQA 1L5WA 3GEDA 4OHYA 5D3ZA 2YJZA 5EI5A 4Y1RA 3QPCA 2J45A 3BVPA 2ZRAA 1AU9A 4RXMA 3ZYTA 3D6AA 4D9KA 4H7EA 1ZJ6A 1P2VA 5G0UA 3ACCA 2EIHA 5DHRA 1EQAA 3FPFA 3STUA 5YASA 2CFSA 1IELA 4QICA 2OXEA 2X6RA 3CB4A 2DC1A 5DHPA 2A78A 1N5JA 3OPVA 4M8LA 4Z1MD 3I9OA 2HC9A 2J3TD 4MLPA 4QOGA 3VVLA 4Y15A 1ZCZA 4KSCA 2MYTA 3OX3A 5JBIA 3HB0A 1QV9A 4AZ3A 4BLQA 1SZVA 1NULA 4KFUA 1FCJA 4GVLA 5EEGA 1W63Q 1XQYA 4CF4A 3D3QA 1N2IA 3T7AA 4BNFA 2CSUA 2OOKA 1YAXA 4MCWA 3NHQA 3PNOA 1CR0A 1UINA 4JZYA 3CX8A 2PSSA 1H3NA 4GDFA 4E11A 3EOZA 4DCSA 2Y05A 2GETA 2EG9A 1T9AA 2WWRA 2YV1A 2FW6A 1KJ8A 1VZ3A 4ZX6A 2ZIXA 1GQQA 4Q3OA 3V33A 5AO9A 4DCPA 2R44A 3ASVA 1I7QB 1JWLA 4TXJA 1BS1A 1SCUB 4F4DA 5THXA 1HZZC 3K73O 4D41A 3PD7A 2OV5A 4E6WA 3ZLVA 5CA1B 2YZNA 3EEFA 4DKIA 2FZ5A 2AFIA 4B5KA 4XCXA 2J9ZB 1OOEA 4HV4A 4D96A 4FFVA 5A6VA 4GZBA 3WL4A 4JYPA 2XB4A 2NQ8A 3NCTA 5CJPA 4PWZA 1NT4A 2HHJA 3M83A 4FDTA 3HJGA 3I83A 3D3JA 1Z63A 1UXOA 3GUUA 3D3WB 1VKOA 1VHDA 4NNOA 2BSQA 1VJ5A 2GMWA 4IWXA 4RHYA 4YQYA 4XR9A 1UK7A 1M66A 1V8BA 2VTDA 1VPEA 3U7IA 5FSPA 1IPHA 5JT9E 5AQAA 2XOKD 3OFND 3N86A 1PEAA 5TR7A 3GEHA 3C3BA 4B2IA 3SJBA 5KTNA 1WEHA 1O4WA 5A02A 2H2WA 1E6LA 4YJFB 5K0LA 1VJTA 5LWHA 4YROA 2H0QA 3CHSA 5FBWB 4B43A 1ZUWA 2GM4A 2WP0A 3ZDYB 4NYIR 4K9OA 3KM0A 2BC9A 3GUZA 5KC9A 3KQQA 4QDUA 3FKQA 2QVGA 3PB3A 2QP3A 2PE5A 4HWOA 1OQAA 1N0HA 1CQAA 2PUAA 2O7NA 1ZLYA 1U6KA 4RSHA 5E7QA 1K7EB 1SELA 2XFTA 4CLXA 2GO1A 1Q3KA 5KTYA 1YFKA 5DHAA 5F3RA 4X7MA 2R7KA 1IUNA 3TNLA 2G28A 1ZOSA 4QAJA 1CU1A 4U2GA 4AULA 4L78A 3G3EA 3EPRA 4V0QA 5EFOA 2IHKA 3OCVA 5HCUA 3ZWCA 3NJAA 4OPZA 4IFTA 2UXDB 1VETA 2QMZA 2EG5A 2IX9A 1MO2A 4DW8A 2FFHA 3K32A 1CQIA 1LW7A 1XVVA 2ODAA 1DAHA 1Z82A 2W3FA 4UZFA 4YRIA 2BBOA 1OH7A 5AJHA 3HPRA 5E6UA 1VKRA 3BF8A 5DU2A 3C85A 4AQYB 4A7PA 1FNBA 4Y3UA 1LLUA 1SR8A 4FNMA 1CFZA 1JHXA 3Q88A 1A72A 1Z0UA 5A05A 3RS4A 1G8JA 4MPRA 1G2IA 1IB0A 3ZW8A 3TUZC 4QM6A 3U44A 1K6RA 4UDXX 1PJAA 1WA9A 2H9AA 1RZRA 2FK7A 1KAMA 4BIIA 5LP6F 3BMXA 4RH1A 3V50A 5BV2P 5CHJA 3VDMA 3VRHA 1SHUX 3TTYA 1QQTA 3GA0A 1QIEA 1QKIA 4TV8F 5BN5B 4GP6A 5C5IA 1G3UA 1Y1KE 4HEA1 2G36A 4XMVA 4D4LA 1RWMA 2GNXA 3HJHA 2AE2A 3UWPA 1T8PA 4U7HA 1F60A 2HR1A 1NI3A 3PX7A 1TYAE 3B3JA 1UQUA 4NV1A 3VP0A 3FSJX 2CVZA 4BNVA 4R83A 4EGFA 4ARVA 4RHUA 4TRRA 5A7HA 4BP9A 1GTJ1 1YS7A 1ZD2P 1PUXA 1ETHA 3QH5A 5K01A 3F73A 2R3SA 3KYJB 2E0IA 3I39X 1ZOOA 3RFVA 5U4QA 4KEAA 1F20A 1ZJYA 3NHPA 1K92A 4BLWA 2QX6A 3RVLA 1BQEA 3FPAA 3PJGA 4HUTA 4ND8A 4RK0A 3Q1KA 2ID4A 5CVJA 5ALIA 4ZEWA 3IPXA 2UUBB 5TEVA 4TKLA 4FGUA 3JATA 3VGPA 5DXAA 1UL1X 1ZK3A 3JYQA 2FUNB 4F7WA 4NU0A 5AI8A 1V95A 4HB0A 1J25A 1XMXA 3HNOA 3FC7A 5LLTA 4YQEA 4PZEA 4IDFA 1Q1ZA 4TS9A 3PHBE 2HA0A 1AWIA 2EV9A 3G7UA 5IHPA 5DB4A 2EJWA 1GGMA 1AXGA 2DWUA 4YS6A 4LG1A 4H1UA 4TMZA 1JLHA 2V7EA 4X44A 3SE0A 1VBKA 2D2EA 4WK0B 5A2QA 3STWA 4G5OA 4X6LA 2QQFA 3WGOA 3SAJA 4G2NA 4XYMA 4C7MA 3T73A 1PWXA 1P77A 4IUBS 1CE8A 1NMXA 4CIVA 3A32A 1L3LA 3CT4A 4CFSA 3IHBA 2IHVA 4PF1A 2R5NA 2Q9NA 4RMJA 2UXBB 5JD6A 1P0MA 4NULA 2PX4A 4PZ9A 1GXWA 1O9BA 3CKLA 2C2BA 5FL7D 1VSVA 1GXSB 1ZD5A 2ES4A 1IMOA 3H8VA 3WMFA 4LGMA 2Y2IA 3USCS 2XA7S 3V4OA 4IH1A 2OMKA 4EZIA 2ZM8A 3R5JA 4I3IA 4ERNA 4Q4AA 5FBHA 1LQTA 3LQ2A 5I7SA 5ILOA 2WD7A 4R2HA 3R9XA 3A0SA 2Y0EA 4LBYA 3ZS8A 4DEXA 1GZUA 1J9GA 2LDBA 4WL0A 3GVXA 2IUTA 1YQ9A 4MYTA 4KE8A 2G72A 2VP9A 3G8BA 2QY6A 3C5VA 1A69A 1Q2UA 2EW8A 5EKXA 3IKJA 1GVHA 3G8YA 2CHGA 1KNQA 2JN7A 5IWAB 1Q74A 5K8LA 2J5BA 2PNFA 3CRRA 3TZKA 3JR3A 2A59A 1T1AA 1DRUA 3HNRA 2ET6A 2EKQA 1NVAA 1GNSA 4L02A 1OYVA 2QW0X 3V7WA 2H1IA 2YMLA 4X7RA 3I9V6 3JALB 4Z99A 4OOMA 2I2FA 2LB5A 2WIAA 3TVYA 4HZGA 5FV4A 1FQKA 1DJMA 1OTYA 4N5IX 2CHEA 2ZSEA 2WVGA 4HRAA 3HJBA 1TTTA 5CNJA 4C6TA 2WKWA 4GKUA 1JW9B 4NK5A 3NI9A 4MBHA 2ZR0A 1QK4A 4K5QA 1XDSA 3KRTA 4M0EA 3N2KA 1VL8A 1YULA 2D1SA 4X1LA 3R7AA 5CB4F 1YAHA 1HDIA 3BKXA 3SEQA 2XKJE 1E6UA 1SHJA 3F1LA 4HGYA 1NW3A 4IVKA 5FTJA 3WTCA 1FVHA 1GNTA 1P0CA 4Q39A 3Q82A 2FEWB 3N0RA 2QJTA 3AUUA 4PRYA 1D2MA 4BQEA 3NHRA 1HX7A 2FR0A 1VBNA 3D4FA 1LBHA 1QIMA 4R0QA 1W4AA 1M2NA 4I9UA 1W52X 3G49A 2XGSA 4HADA 2CMKA 4DCNA 4FDVA 3KVNA 4CG1A 2BF7A 4XXRA 2I34A 2VYFA 1LFDB 3OMXA 2VA8A 1AKEA 1XQWA 1FMJA 2QDXA 1LBIA 3EZ9A 4ZKEA 4J91A 3T99A 2YWRA 3LDAA 3SX2A 4IX9A 1ZGAA 1CLEA 3GJTA 4ZAFA 4YCNA 2AJTA 2EERA 2J7PD 3MB8A 1PJCA 4FGJA 1H2HA 2FVYA 3S2IA 2LV8A 2Q99A 4UQIM 3ONNA 4FOFA 4BE4A 3HB1A 1HEIA 2PRFA 4KZAA 3A0UA 1J0EA 2G08A 2G5CA 4WOCA 5HMMA 4CQJA 4ND1A 1STOA 4IV5A 3MRSA 2FQYA 1IN6A 2IEDA 1GUAA 1YJ5A 2JGJA 1Z6XA 3JCZA 4UM8B 2O2GA 1U7PA 5TMBA 4JI2B 1K0KA 3IBGA 2ZC5B 1MN6A 4YRQA 2QM3A 3N2IA 3DWEX 3LZCA 4U2KA 1G64A 1IQPA 3ZU3A 4A0RA 4R9RA 5J63A 2DH6A 3C7KA 5G0WA 3T4QA 2FPMA 3VV4A 1GZVA 3L7LA 1MJFA 1JMVA 3C14C 1U4GA 2O8BA 4TVOA 3V3KA 3C6XA 2QN1A 2Z5VA 4NG5A 4BLUA 1JHRA 3K3CA 3EWNA 3ZZMA 1OMOA 4G4SP 4BNHA 2JFBA 3GA5A 1BQBA 3T74A 3LSYA 2QT1A 4K6MA 4QT4A 2BP7B 5F7XA 3I0MA 2PIDA 4QU0A 4A4DA 4N5NA 1QBKC 3FIJA 1FRFS 4TZTA 3WWXA 1T5BA 5AT1A 5D51S 1Y9AA 3ORFA 1R2QA 3A0RB 4LBVA 1U4NA 1LLDA 1EX9A 1ZK4A 3K53A 1WEKA 4GGMX 4AQDA 3AM5A 3C3KA 3AVWA 1PS8A 2VEDA 2ZE8A 4AKEA 4YQFA 2OOSA 4P22A 2UYCA 2XRMA 3HO6A 4A6XA 4NCJA 1V71A 4RVFA 2C3YA 4AUNA 4BLRA 4IJ5A 4CM4A 3AR6A 5C46F 3ZTTA 1TM4E 3EAFA 2O7VA 1CHDA 5JUWA 5BWMA 5FWYB 1VDZA 2Q0SA 4C7XA 1JGTA 1XZNA 4BL5A 4CQLA 5H59A 1YV9A 5CYGA 1X7YB 1Z0SA 4WZZA 2BFNA 1XL1A 2RG1A 3HCDA 2VYCA 3N6XA 4PM9A 1C3EA 1BGVA 1RW4A 3JV7A 3TXYA 1ES2A 2C29D 4ZHQA 3CZ5A 1E3JA 2CY0A 4IZOA 1TMKA 1UMBA 4QY5A 2A0YA 2O8FA 4INPA 4E6EA 2VQ6A 1JQBA 2ZL1B 5JNWA 3JYPA 5KNDD 2FPUA 5HTKA 2AFRA 3RAEC 1VQQA 1W30A 2K2NA 5CB4B 5F1YA 3FGDA 3PXGA 4Y98A 3WLAA 2J0QA 1I6MA 1P1JA 4Q48A 5INTA 4AY6A 2XMZA 2OLEA 5CXSA 1TAUA 2I22A 1A5SB 1IULA 3BW6A 3HVHA 1IFXA 4MUFA 4PZ0A 1Q92A 3H0CA 5M2QA 3T12A 1A9TA 2XQFA 5HIMA 4RTMA 3HV2A 1Z4MA 5HVNA 4B74A 1DINA 4L8YA 3I52A 4FK8A 4TMYA 2KM1A 1Y34E 4MR9A 4BC1A 1ZY2A 3IPYA 2WT8A 4ZYVA 3HV0A 3TSGA 2ZE5A 5TE9A 1S2MA 1GO2A 3VR0A 1F2TB 2E89A 4L28A 5KDLA 3ROGA 2O0LA 1WF3A 2GVZC 2YJTD 3UJPA 1VFNA 2KBFA 2VV6A 3FSRA 2NSHA 4UEJA 2ORIA 1GPH1 5BSTA 2Q3EA 3RK1A 1B93A 5JSZB 5HWWA 1BN7A 3MWFA 4ALLA 4EPYA 1EFLA 3LIIA 4BEWA 2UKDA 3PBQA 5JAUA 1XDGA 1AK1A 3NHBA 5C53B 3HBLA 1MX9A 3FH0A 5BSRA 3EBLA 4O25A 1IHUA 5J3JA 1QAQA 4XD7A 3PITA 3ZDFA 1C4XA 4LJ9A 1G28A 4EECA 3TD2A 4PINA 3V1LA 1AT1A 2CCGA 4XFKA 2BFBA 4NPCA 4MROA 3VR5H 3EDYA 2B98A 4F8EA 4URVR 1L0DA 1TEVA 4QVIA 4GX2A 4DIUA 2H1RA 4BQOA 4CIYA 3EULA 1RFLA 3AF3A 1D0VA 5TT1A 1Q1BA 4MO9A 3MGBA 1M72A 2VK2A 4NABA 3RIXA 2IU4A 1ULTA 3MG9A 3WKDA 1L5VA 4DUGA 3N53A 3PVSA 1EUCB 4MSUA 3ONWA 3UEOA 2HMSA 3OZAA 1NAHA 3UAWA 1W1WA 3TQFA 3DWFA 4ZU3A 3HUFA 2WNIA 3FGNA 1M40A 1T4BA 4ENUA 1LJUA 4P92A 1WHTA 1Z18A 4QO8A 3NKLA 3V4RA 3NGMA 2C95A 5CTMA 3LIDA 2QPLA 1XA7A 3R0IA 2P4SA 3Q3GE 3BHJA 2X7HA 3ZLBA 1E2HA 5J23A 3IBCA 1PJTA 1JDBC 2GCPA 1WG8A 1I3CA 1E3QA 3NBAA 1V2GA 1E6CA 1U8UA 2D1YA 2WMOB 4GYYA 4MEJA 4ZODA 1L7RA 4U7TB 1Y9JA 1I1QB 5DPMA 1POXA 4Y2TA 4YMUA 1QHGA 3I62A 2PIAA 4CLCE 2JKZA 2H17A 3RS2A 4KUKA 4EEKA 1NXTA 2XITA 1GGFA 3GJSA 2VJLA 2XNHA 2X5NA 3L8GA 3PD0A 1E1MA 3P2MA 4HTAA 2BJVA 1X1BA 2O1EA 4N1XA 3ESQA 1ZICA 1CQZA 2CC1A 3GBVA 1JJAA 4JT8A 4I81A 1FSYA 3C24A 2WIJA 5CM8B 3HL0A 3H3JA 1EFKA 4KGZA 4U0KA 4MINA 1R6AA 1XLWA 3QSYA 1R1DA 3E1KA 3PEFA 4CT4B 2J31A 2X1VA 5HPFA 5K3OA 1OZFA 5ED0A 4R2IA 2A1UB 5K0SA 1Q1NA 2WSSD 2ZP1A 3REGA 2NQTA 3ZQJA 1G2QA 4EG8A 1QCZA 4WXPA 4UVHA 4NNPA 2ACWA 3CJTA 4PPNA 3VR5A 4QDKA 4CV3A 5JO9A 2BTEA 2XNJA 2XQIA 2PU5A 1G16A 1K3TA 3FXPA 4IHQA 3GCXA 2ZIAA 1P9OA 2FJPA 3DTMA 1MEJA 2BRUA 1K5GA 1T8YA 3SZLA 5JTUA 4YC7A 2WQ6A 3T52A 3KHUA 1KEEA 1PX0A 4AZ3B 2NACA 3EARA 4WLFA 1CK4A 1Z9GE 3BKWA 2GJKA 2E4YA 2AK2A 4AZ0A 4LFCB 2JLYA 1REQA 1HM5A 1Z35A 1H8HD 4JX9A 3T7DA 3HO8A 5DN6D 4U0TA 3PXCX 5DF1A 4HL6A 4C4YA 2WOJA 2J9GA 3C8UA 3HN2A 4TROA 3LXXA 3OSUA 3OZDA 2PFGA 1VJ0A 1SC6A 4R1TA 4IIBA 4JLAA 3UH0A 3V2GA 4R2XA 1TI7A 3R44A 2B0JA 1M8KA 2UYOA 2ZIXB 3S68A 2CXRA 1N9BA 4X85A 1DCKA 3T4OA 1TIPA 1Q12A 3GCDA 5DW3A 3UPTA 3ZI6A 2IQIA 3KNZA 2AFIB 5ICEA 4S1WA 2JCGA 4PKYA 4F11A 2Q2QA 3ER6A 3T15A 1TZMA 1FP4A 5G0VA 1MJGM 1ONSA 1NMZA 4LHEA 4LZZA 5AI6A 3DTKA 1SIOA 2O2IA 4O8GA 3NASA 3RJ5A 3V2UA 4B6RA 1P8AA 1O94D 4WK6A 2GFQA 2VPZA 4HVCA 4OW3A 3PWZA 4CLCA 3LUHA 1IOWA 4F60A 3DAYA 4QZVA 4ZW8A 1XJ5A 1T9GS 2VHYA 5AK6A 4G56A 1M33A 1XXLA 4KLAA 4DE1A 4ZCRA 2AXQA 5GAJA 1GKUB 3IILA 4GSKA 3H75A 3WE7A 1K3FA 1EHIA 1CUIA 4I3HA 2O3RA 3SMQA 4XNDA 1P1KA 2Z6VA 5AR1A 3L6UA 4XDGA 4CL0A 4K8OA 4Q66C 4XCQA 2VRCD 3V2HA 3T3GA 4G5HA 1CEFA 4GYKA 1SQ0A 3QM1A 4U00A 4X68A 1S7GA 3RTDA 3JRNA 2C97A 3D4PA 4MW1A 4K46A 4DNFA 1OJGA 3OMLA 4Y0TA 3TQHA 3NNNA 3Q43A 3V2IA 3HJAA 2OHGA 1PT5A 1CDOA 2JG3A 5IKPA 1OLXA 1YZNA 2QA5A 4LZOA 1C8KA 3CZRA 2C5SA 4R1OA 2O9AA 5DHFA 4NBNA 4YP9A 1IKGA 1YSQA 3FSEA 1RS0A 2HGVA 3HLFA 3U7HB 1XMQB 4ND2A 4KV7A 1IXYA 4FHCA 2JLUA 3RFUA 2JI6A 2DP4E 3E4CA 1NNLA 2Q62A 2YC2C 3F7TA 5ICGA 3IUBA 3VP4A 3RIEA 4NBUA 1VETB 3OZRA 1KH1A 1TGVA 2F7SA 4ODIA 2ZJ1A 1T2AA 4AMBA 1NPCA 3ZX5A 4HNQA 4DQ0A 1U3WA 3HCAA 1CQIB 3QBJA 4MQBA 2B35A 2O6LA 2Y6VA 4KH1A 2AG6A 1S2DA 6ABPA 5E6UB 2LIVA 3R3HA 4ZVNA 4LFBB 4UAAA 4NEGA 2X0DA 3ESCA 4NK3A 3BCSA 4HB4A 1U2SA 1N6RA 4MHSA 1HT2E 1I3MA 3GT3A 4BP8A 2QD3A 3SS5A 2X1HA 3KZCA 3R4VA 5CVVA 1WHSA 3AO0B 3U44B 1SBZA 3D3NA 3M4XA 4MI6A 1YMVA 3CUTA 2IWDA 2CL0X 1KU6A 2YOHA 1D06A 1AH2A 1U3CA 4ZA2A 3IVXA 6ADHA 2N3ZA 3VE4A 2YV3A 3CW2A 3K0BA 3QW4B 1KYTA 1GTL1 2QPTA 5KX5A 1BS2A 4G41A 1QKKA 5KQLA 1K4FA 5JLJA 3F96A 2JI7A 1EK6A 3E98A 2P2LA 2Y91A 2HZ5A 3INTA 2FPLA 3T4JA 1BE6A 4C4OA 3W78A 3AP2A 1H0KA 5FXMA 3LQYA 2DCFA 2AH5A 3IP1A 4DM7A 1FUUA 5HS4A 3FPWA 4IHAA 2J7VA 4XSVA 4ZAXA 5CU5A 5BVGA 3A28A 2DQKA 3IUQA 5K03A 3PTEA 3PUZA 5A5EA 1X8KA 4HTFA 1GV0A 4ND8B 2P4QA 1KERA 2XCUA 2WEKA 2IXEA 4OI5E 2D6FA 4R6LA 1ZJWA 4BJPA 4MGKR 1HE1C 2O4CA 2D1QA 2ZITA 2DQ4A 1GTRA 4CLCC 1XTBA 3T3HA 3SHVA 1MQ8B 3JATB 1OBOA 3QSGA 4TLCA 4C03A 4JKYA 3PUYA 2O8NA 1PSDA 3V1MA 3IDQA 4P6VF 4M83A 2NM0A 4LI0A 3OOJA 1SXGA 2DT8A 4UM9D 1AXBA 4QXAA 1UPAA 2FSGA 5FI5A 1A9YA 1FFBA 4F3KA 3HRHA 2I4LA 3IWQA 3LDFA 3UUWA 1NXWA 5A4JA 3ORHA 4XNBA 1JDNA 3ISTA 1H94A 4M38A 1W7FA 3IUNA 1XROA 5KDOA 4US2R 1CUHA 1O6ZA 1BLPA 3FOFC 2W6PA 1CE8B 1EWRA 3B8EA 1D1JA 5KNCD 1AQIA 5E0OA 2CF6A 3A3DA 5CIYA 2FFYA 4QPPA 2MU1A 4QOHA 2GPTA 3AF5A 3U81A 1EWKA 2E49A 3TZ6A 2P6PA 2Z57A 4C78A 5JJ5A 2JAWA 5LN1A 3V8PA 5K0CA 1QYXA 3O7WA 3K70C 1NNSA 2C6WB 3N70A 4PLHA 2PGAA 2ZRLA 1QCYA 2QGNA 3D02A 2XKBA 2N9UA 1MQAA 3WYNA 4L57A 2Y59A 1LSWA 4Q4AB 2REBA 4L3VA 4DLPA 3HSKA 4XOIA 1SC4A 1NY0A 2C2XA 3IRUA 3JQPA 2WD7B 2GRJA 2OHOA 1NJ1A 2WDZA 2O9CA 4PO3X 2EFGA 1RRPA 1RXVA 3ZQ6A 3AR5A 4BQQA 1JE0A 3JSXA 4W6ZA 4QBTA 1G9XA 3SS3A 3EIOA 5KWSA 5ETJA 4W8HA 1YM1A 1IM5A 1EAYA 4PZLA 4P0MA 1ZP6A 4E5UA 1SGWA 1MENA 3CIOA 3A58B 1DP9A 2WF6A 4OHFA 4FGZA 1RYNA 4YRPA 3UBMA 4I55A 5HKBA 4WZBE 4G5GA 4TM7A 4C4AA 1U0GA 3ND5A 3UHPA 4BHTA 2H1OA 4RSYA 4U2EA 2B4QA 5JSUA 2C04A 2LE0A 3EEYA 2YXDA 1Y42X 5FOTA 1YI8A 1DHTA 1CZNA 3CPHA 2IH4A 5JZOA 1UBJS 1L3CA 5IK2D 4G0PA 4FQ5A 1T2VA 1N2EA 1NF2A 2EZUA 3UOGA 4YFMA 1KI2A 4BLOA 3KJEA 2GT1A 1H5NA 5JY1A 2F48A 3OUUA 3UA3A 3KKZA 1N8NA 3R3XA 4EJMA 3KPVA 3TZQA 4RZHA 1D4AA 4J43A 3RWOA 4RFVA 1KR2A 4DY4A 2AOUA 2F1RA 4ZU6X 4F93B 1ZM7A 4C6TB 4ZYYA 3JAWA 3GR6A 3R23A 4BN5A 4DIOA 3SJAA 3T1OA 3UWMA 3E1GA 1OI2A 3NVDA 3N2KB 3NAZA 5ALKA 4R3UC 1ZSVA 4R38A 2D59A 3N2LA 4LSWA 5D3MA 3F4BA 1YJAA 3GA7A 2GJ9A 3G13A 1QO0D 2DT5A 5DW0A 4JVOA 2QRUA 1ID8A 4CI9A 3T0GA 3PEVA 3K4QA 3ESZA 3EFBA 1N0VC 3A9SA 3A25A 4UW9A 3GPLA 5C8VA 1DV2A 4EQ6A 1FUIA 2DULA 4PONA 1YRLA 2W6JD 1GL3A 5F68A 4R3NA 1ZD1A 2C31A 1OWOA 3CSSA 4Q37A 1RKUA 4PSAA 4PYLA 3PPIA 2FOXA 2IH2A 1ZD9A 2RHTA 1U9JA 1ZNZA 1AOXA 1XZEA 3LL4A 3LLMA 3HFRA 3TKLA 3FR7A 1R9MA 2WHXA 4TWZA 3GEIA 2J9PA 2PWAA 1OC4A 3QYFA 1JFSA 3SYMA 4JB0A 1BDMA 4UUMA 3PHYA 3HG7A 2OC4A 3P9NA 4E33A 1PDOA 1S0UA 4O3FA 5TMEA 1DEHA 1EB9A 3FJOA 3IFSA 2AKEA 3DDSA 1VPDA 1UBOS 3AJDA 3V48A 4GPD1 1CDDA 2CKMA 2CLFB 3GJRA 4YJ3A 3E5NA 3OKFA 3OM1A 5E8RA 4ZOAA 1W79A 1G8HA 1I3NA 2X0JA 1BUEA 2BWJA 4YLGA 1ADGA 1CUWA 2XR0A 5ADHA 3FV7A 4RXTA 2IYYA 1VDMA 3I6MA 3OAAD 4B2LA 1CD5A 1SD5A 3IAEA 4H4DA 1UWNX 4KIGA 1IEWA 2Z6CA 1R9JA 3LUBA 1QX4A 3A1UA 2O8BB 3GLIE 1FR1A 4DCUA 3G2NA 4YWZA 4Q9JA 1N6IA 5BV0A 2TMKA 1QDLB 1XVTA 1TRKA 4WZBA 3MK31 2NADA