4IHQA

Archaellum assembly atpase flai bound to adp
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
512
structure length
512
Chain Sequence
SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILLRMRLSVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKFSRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGAIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FlaI ATPase
publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 165
structure length 512
sequence length 512
chains with identical sequence B, C
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ihqA02
3.30.450.370 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ihqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ihqA03
3HU2A 1Q3HA 4JLOA 4PC3A 4JVMA 3T35A 2GVDC 2ZPTX 2YOHA 2GK6A 4FINA 5L3RA 1G8PA 1W0KD 2BBWA 3NG1A 2CHGA 2YOFA 5CYOA 1EXMA 2H1LA 5J40A 4AIIA 4B35A 5AUPB 2WAXA 5EE1A 4OHWA 1AIPA 1EFRA 3LNCA 4RD2A 2QBYA 1US8A 2W0MA 1G8HA 2PCJA 2RH5A 5HPYB 5F2EA 1VIAA 2QNRA 2VHUA 1GDDA 4EFNA 4Q9LA 5CB6A 2FJUA 4DLVA 2JEOA 4RJLA 2MMGA 2WMOB 2JIZA 2FH5B 3V4RA 3VNVA 3PUVA 1WBBA 3I62A 1J8YF 1ZP6A 2J3EA 3OIYA 4B48A 1ZM9A 1JEEA 2XAUA 3KJEA 2RHMA 4OHZA 3H0KA 1IXZA 4Q03A 3NVAA 1MOZA 1G3QA 2ATXA 1HUQA 1W36C 2HT1A 5FOXA 1Z6GA 4QC2A 2O8FA 1T4GA 3KXIA 4MGKR 4NCNA 4NCKA 4ZIRA 2KJQA 3SHWA 3GFOA 2YHSA 1D5CA 4TSFD 1KY3A 1KY2A 1NN0A 3QKTA 1U8AA 1P9NA 3AF3A 5EUQB 3I5XA 3FKSD 5EE5B 4K46A 3VKHA 4LZZA 2XXAA 2BM0A 2VEDA 2XSZA 4CRWB 4PAOA 4XOIA 4JL5A 5KDLA 3AQ4A 2B6HA 2H7VA 4WZBE 2CL0X 5EUMA 2QP3A 2ZU0C 4B2PA 2H92A 3CZPA 4FWIB 3BFKA 4AWXA 2R8RA 2IUTA 1QG2A 5FUVA 2VF8A 1TMKA 2DBYA 2W00A 1Q20A 3WYFA 1BS1A 2P6NA 2N42A 1OHHA 3PXGA 2AN9A 3K0CC 5CLLA 4BEJA 3OAAD 1J90A 5E7JA 1U8YA 1Z0KA 3QF7A 4QM7A 4P3YA 3THYB 1O3YA 1AJEA 3PQCA 3MD0A 1E2QA 1CIPA 3CNOA 3IQWA 1X8JA 1H65A 4GT1A 5JMTA 5KNDA 2QRZA 4M1SA 3TAUA 3QKSA 5GADl 4GI7A 1Z8FA 3BC1A 4LDJA 5EXPA 5GJVC 4MKGA 3I4LA 2GTPA 3L82B 1YRAA 1NVUQ 3K70B 1I2MA 1E9RA 3G82C 2JJ1D 1QVRA 4GZMA 4BFUA 4B3FX 4M1KA 1JI0A 4B2LA 4MRSA 3ZZTA 2IYSA 1OV4A 3K0AA 2JGNA 1ZBDA 3CX6A 1B23P 1ZVQA 1W1WA 3DPUA 1XZQA 3RS0A 2OESA 3ZDQA 3PEYA 1FP7A 4M9ZA 1KI8A 2PZEA 4D81A 5SZJA 4C2TA 3F3YA 1DAEA 2EVWX 3TR0A 1W4CA 1KK0A 1ODFA 3ZD7A 2N1BA 4EPWA 2VP6A 4MYUA 3LX5A 4F93B 1XWIA 2PZGA 1ELOA 1S4QA 2ZRPA 3JZMA 1SKQA 4G1UC 3SJZA 3CM0A 4A2QA 2GVZC 3FDIA 3R8FA 2EU8A 3ZZUA 3ZZ0A 1GTVA 3A4NA 5C4GB 2BKEA 2P65A 4PX9A 2ZRIA 3LXRA 4Q1BA 5AUOB 1Z28A 2CL6X 3CRMA 1N6HA 2LWIA 4E22A 3EXAA 1E2IA 2OILA 4MYHA 5TV2A 1MR3F 5JI2E 4DZZA 5BXQC 4HDCA 1X3SA 3LWNA 3SU8A 1JJVA 1OFHA 3X2SA 4URXR 1E9SA 1G64A 1H8EA 2YVUA 3C8UA 3KX2A 4UJ3A 4BFZA 3NC1C 4QBHA 2WKQA 1PUJA 2PLFA 4O3MA 1YE8A 4NYMQ 5BN3A 1QHHB 2AFIE 2C03A 3ZQ6A 1U98A 4AI6A 1E0KA 1ZU5A 3OEHD 5JCPA 1YZGA 3B9QA 4EJSB 1I4LD 3B2EA 1NF3A 4A92A 2BEJA 1HQYE 1OF1A 4RKFA 4AKGA 4NHOA 1E2DA 3EZ6A 2XTZA 4GOJA 3NWJA 3GLIE 4RD0A 2ATVA 4IHQA 1R7RA 4TMTA 2J0UB 3TE6A 2CK3D 3KJIA 1L2TA 1GL7A 5J4YA 1T3HA 4I1SA 2GJ8A 5DYIA 2Q9BA 2ZI3A 1NI3A 1WXQA 1ZU4A 4FMDB 4AC9A 3KTAA 3CF6R 3FB4A 4D0LB 1Q44A 4QJ3A 2ZETA 1UFQA 6Q21A 4G5QA 2G83A 3IDQA 1LY1A 2LCFA 4PQFA 1OH5A 1PLKA 1NSTA 1ETUA 2VIIA 2R6FA 5KU1A 2Q3HA 1XBTA 4C9BA 4DLWA 3ADCA 1GAJA 2IA5A 4FWTA 2XNDA 3BB3A 4V03A 4BFYA 1OKKA 4UXIA 1TF7A 1CJTC 2JIZD 2W58A 2OBLA 1DG3A 3PR1A 4UXJA 5CJPA 3UIEA 3U6KA 2NTYC 1XP8A 4JJKA 4JS0A 3VU9A 3UMSA 3VKWA 1KYIA 2ZJ8A 1X1RA 4L9WA 2AWOA 2YKGA 3WNDA 4BFSA 3TUJC 5B57C 4DSUA 3DZDA 1N0WA 4ILEA 1S3SA 1RVDA 2W6JA 4XVQA 1EWQA 2JLVA 4OK5A 1IY2A 4DLZA 4BZPA 721PA 1AA9A 2ZRJA 3ZVMA 4R9UC 3K09A 2WWGA 1OXVA 5CITA 1G7RA 2G6BA 3SC3A 4DLSA 1W46A 1YZLA 3KUCA 3WMFA 3CX8A 5J4VA 4PHHA 3WHKA 4GRAA 2GCOB 2QP9X 3NHAA 2D74A 4IEIA 2QGNA 3OEEA 2FNAA 3THOA 1DBSA 4G5GA 1FFHA 3J81k 2J41A 4LX0A 3EA0A 4Q4AA 1Q1QA 4XSGA 1CR0A 1FP6A 2WICA 3QXCA 3DM9B 5EE9A 2WWIA 2PT5A 4NPHA 2JLXA 1GNPA 1Q22A 1TX4B 2EFCB 2GEUA 3AV0B 4BLQA 2J0QA 2W2TA 1DG1G 5KSPA 4IVPA 4QXAA 1Q0UA 2CMKA 3EX7C 1HV8A 2O8EB 2ZRNA 2W83A 3NC0C 1P61B 2ZS9A 4MKHA 4CT4B 4LBYA 4ZV4A 2GKSA 1E1RA 2ZREA 4EJSA 4AYWA 3GP8A 5KO2A 1TEVA 1JPJA 1UBCA 2FG5A 4PQYA 2REOA 1HE1C 1JXOA 2Z43A 1DELA 3WBJA 3I32A 3H1TA 4KVAA 2C95A 4ASUD 1JAHA 5FI0B 2CNWA 2C9OA 2H16A 3AGPA 2ZE8A 4F38A 4OI4A 1XPOA 1BIFA 621PA 4XVRA 4D82A 5EP3A 5JLJA 3UK6A 3Q7QA 1RRPA 1WMSA 1JECA 3TIFA 3TR5A 1OXUA 3PUXA 2ZRCA 4GP6A 4JVSB 4YMVA 3ZH9B 4IOLA 1S8FA 3TQFA 1XXHA 3KFXA 2IW3A 3B1WA 4HDOB 3SQWA 4LHWA 1HYQA 4KAXA 1TU4A 1KI4A 1Q1ZA 3W8RA 1NVVR 4LJ9A 3AP3A 2B8WA 4V0OA 4WXPA 3SBEA 3B8HA 3B82A 4TLDA 4NZYA 4AYXA 3KQUA 2WJJA 2IUSA 1YZNA 3K0FB 5CDFA 4O0MA 1LV7A 1SXJC 3MWJA 3LO5A 3ZVNA 2F1IA 1RZ3A 2HJGA 1JR3D 3W6PA 1YZKA 4DT1A 3LVRE 5FUXA 2V6JA 2XZLA 4MDEA 2O8DA 5JEDA 1L7VC 1HURA 2ZXUA 2IS1A 4MQBA 2VRWA 1Z0DA 3LH5A 1YQTA 2J46A 1UDWA 1KHTA 4EAQA 1E98A 3DDCA 4W5JA 2FMXA 2ZUDA 2GRJA 4V0LA 4NKRA 1TADA 4PO1A 4Q4LA 5FOVA 2JLRA 4A8JC 1W4AA 1N6NA 1OFIA 3C7KA 4HZUA 4TT3A 4C0QC 4UNPA 3C5CA 1AS0A 1CBUA 1K8RA 3GLFA 5DI3A 3MWLA 4Z1MD 1P4SA 3QOFA 3EWSA 1F6BA 1KZGB 4HLCA 4I1VA 5IRCD 1KO8A 2GCOA 1Q1EA 4RD3A 4DUGD 3AVTA 4Q21A 1DAMA 1ZAKA 2HLDA 4ARZA 1TL7C 3BB4A 2H8KA 3K9NA 3Q5DA 2D06A 3DOFA 1EK0A 2F43B 2NGRA 5D3QA 3QXHA 4LI0A 1R8QA 4URYR 1IONA 3R20A 3U5ZB 4POAA 1IN7A 3AKCA 2BCGY 3Q9LA 4JLKA 3PUYA 2RGNC 3NBZC 2XGJA 4BUJA 1T3SA 2DPXA 2J7PA 2ZRGA 2W2VA 4C7OA 2BEKA 4C30A 3ADBA 3QKRB 2F1RA 4TTPA 1XDBA 1XFAA 1FPMA 1MRNA 2VSOA 2AXNA 4PC7A 3GD7A 3BGWA 1XEXB 2V7QA 2ZIAA 1E3MA 2V1XA 1CR1A 1Z2CA 4ESHA 4TMXA 4A9AA 1PZNA 1CJKC 2HV8A 4JT2A 1G3IA 1T6NA 1CKEA 1ESMA 2PEZA 4E03A 1T0HB 1G291 4Q7KA 3Q72A 2QSZA 4FMCF 4A2PA 2ANCA 4IFBA 3BOSA 3KZ1E 4DBLC 2QUZA 1RRCA 1I4TD 3CONA 4XD7D 4TLAA 2IUUA 2KWIA 2ZYTX 2V54A 5FTKA 2H17A 2ZSAA 3VHXA 4DLXA 4NYJQ 1OJLA 2MMCA 1YHNA 1RRGA 1KI6B 4DCSA 3UKDA 3RRYA 1Z07A 2D2EA 3SR0A 1KSHA 2W6ID 2ZUCA 1ZC4A 1TU3A 4EPXA 2Q0HA 3EPLA 3QPUA 2KBFA 1T8TA 3U7FB 4NTZA 3NIBA 2IYLD 4IFEA 4BRUA 1EESA 4I81A 1RYHA 5FR2A 1WQ1R 2VHQA 4LYAA 3D7MA 4XWAA 3QBTA 2C77A 2JJ2D 1SVSA 1HTWA 2WPDA 4F92B 1FUKA 4TMKA 4M9SA 1LS1A 5JCZA 4OK3A 3OEED 3I8XA 5FPKA 1G3MA 3GFPA 5UKDA 5KYKA 3BXZA 4S35A 3N5CA 1NBMA 1R8SA 4UNQA 4JYCA 3LFUA 4DLUA 2R6DA 2FFBA 5L3SA 2OHFA 1W0KA 1XNJA 2A2ZA 2G1JA 3AKEA 4JMPA 2OSBA 1FZQA 2IWRA 1WP9A 4U02A 2F43A 1WDTA 4N0DA 1RFLA 5F98A 3KKQA 3B1YA 3KQKA 2P3SA 2REBA 4MRRA 2WAYA 1VYVA 5FUYA 1B0UA 5JZVA 2WKRA 2E1RA 1K5DA 4UXHA 2C9CA 2FPLA 3W3ZB 1UKEA 3MMPA 4QHTA 4C0BA 2A5FA 3AVVA 4UNRA 1IN8A 4K81B 1WB9A 3NTUA 4M1WA 3HP1A 3Q7PA 4B6FA 4LY6A 3T12A 2ZYUX 3IQXA 5FI1B 4LRWA 1ZMXA 3VKGA 1FUUA 5G53C 5L3QA 1E2FA 2JLZA 1NG1A 3T1TA 1U9IA 3DEFA 2DCUA 2DY1A 4ESVA 1XEXA 2KE5A 2ORVA 5H68A 3CR7A 1RC8A 4PZLA 1KMHB 2X2EA 4TSFA 5LD2C 2RKOA 4Q5IA 4AKHA 1R5NA 3IKJA 4Q7LA 3EIEA 3L2OB 2ORWA 2IX3A 3FKSA 2OUKA 4URZR 1GOTA 5L3VA 2ZRAA 3THWA 5HE9A 4DDTA 3CNNA 4NCIA 4Q02A 2GCPA 4OJKA 2FWRA 3BK7A 3RS3A 4B6EA 5LD2B 1XCPA 1F2TB 3THXB 1G16A 4AD8A 4RD6A 4B3XA 1R0XA 1KI6A 4P32A 3JZAA 1F5NA 2YZ2A 5E7MA 2HYDA 4JKIA 1ZNWA 2ZVPX 1G19A 1WF3A 3ONWA 3W6NA 1JQLB 2CJWA 2V8OA 4YLGA 3A36A 3FTQA 2VLIA 4DCVA 4NCHA 5CLQA 3OAAA 2BM1A 5AJWA 3AEZA 5EZ6B 2V4ZA 1TUIA 3CPHA 4HUQA 4LHZA 1BMFD 1E6CA 4TL6A 1YKSA 1E9DA 2DB3A 3K9GA 3HYTA 1AQYA 2ZYVX 1LS6A 1IOZA 5BYJA 3OE7D 4GP7A 5DIFA 3P26A 4G01B 4LJ4A 4TMZA 4H9GA 8OHMA 1NIJA 3LLUA 3IEVA 2QE7D 4AYTA 2WWXA 4BFXA 1A5TA 2WHXA 2PCLA 3KXLA 4TLEA 2JJ1A 2NMVA 3GQBA 1OIWA 3ND8A 2J7PD 1CTQA 3NEJA 5JWRA 5G3YA 2RGBA 2GZDA 3O8DA 4HEJA 1TQ4A 1SKYE 3PIRA 4C0LA 5ELXA 3QE0A 1C1YA 1VPLA 3QNUA 3TLXA 3I92A 5HE8A 1P2SA 4M22A 3TH5A 4CDGA 4YDHB 2B7BA 2AWNA 4Q19A 3SFVA 3CNLA 1H8HD 1IN4A 1VHLA 5FBRB 1NNEA 1NN5A 2PJZA 4YMSA 2DFTA 1UDXA 2G0NA 1Q57A 2R6CA 1A4RA 4Q4HB 3FMPB 3QSYA 3LLMA 2ZTSA 4M21A 1NN1A 3PEUA 2ZM5A 2ODBA 2XITA 2UVQA 1KMHA 1EFCA 3M1IA 4IOJA 3VR6A 1IN6A 2CHQA 2QI9C 4PTLA 3U44A 2XZOA 2ZRKA 3TW8B 2FSGA 1KO5A 4LCBA 1QZXA 2ZAMA 4Q1AA 5JBQA 1U0LA 2ZR0A 3CUEF 3C15C 1KI2A 2G3YA 4WIAA 1XMSA 4QRHA 3W90A 4OBEA 2C78A 1G7SA 3BE4A 3M0EA 5AUNB 1JBKA 1II0A 1WA5A 1E9AA 1F2TA 1E32A 4PSAA 2TMKA 1G4UR 4US0R 3OIUA 1N5LA 4TWZA 2KB0A 4LJAA 4MRPA 4YXWA 2WPDD 4OI2A 5JHGB 3PCRB 3LX8A 4PQRA 1E4YA 3SYLA 1D9XA 3CIOA 2AD1A 1AGPA 2CK3A 3EA5A 4PO9A 1DO0A 4TQUS 4OI1A 2RGEA 3EC1A 4DB4A 1FMLA 1W44A 1KNXA 4XTRA 5F3WB 2BJWA 1N5KA 1UBEA 2AFHE 2ZYWX 2HDNB 1JJ7A 1KK3A 5TDHA 1N0UA 1CF4A 4MYCA 1I2DA 4HZIA 2G1KA 5EXTA 5DO9A 4RZXA 2RGDA 4V0NA 3LRPA 1W5SA 2A5YB 2P6UA 1XJCA 4J0QA 4PHFA 5FBLB 4D4JA 2FOLA 3QPVA 3LXXA 2F6RA 1ZM2A 2GILA 2ZJYA 3FMIA 1S9DA 3HR8A 3AKYA 5LB2A 1GL6A 4OKSA 4Q01A 2GBLC 4M9QA 2V55B 4MGYR 1NIPA 2IHYA 2UKDA 1AGRA 4OQLA 5TARA 3O47A 5JJIA 1ZNZA 2GJSA 4Q7MB 2ORIA 2UZ3A 1LFDB 3EZ9A 3G0HA 3B1ZA 1P62B 4KXFB 1YR9A 1YR6A 5KHOC 3A4MA 1LTQA 3HYRA 3A1WA 4LBZA 2F1JA 2A5GA 5EXXA 3WP1B 3A6PC 1YVDA 1W36B 4QNRA 1A2BA 3BERA 1HH4A 1HA3A 2YJTD 1E2JA 3SZRA 4DLRA 4QBGB 4OHXA 3R7WA 1CRQA 4ZKDA 1JPNA 1NSFA 2NO6A 5BYKA 1FOEB 1MABB 4KSCA 4QKQA 2CBZA 3EZFA 4Z51A 3NKVA 1D2MA 2FE4A 3NXSA 3GJ4A 4MUBA 1XD2B 5FBQB 3R9XA 1IY0A 3RLFA 1FX0B 4KU4A 3KKOA 1MH1A 1YU9A 4ZDKA 2MSDB 2NZJA 5C2JB 3ADKA 1CXZA 4A1FA 2ZJZA 3KQHA 3W3AA 1GUAA 1KOFA 4LOAA 3NBYC 2BVNA 4RZ2A 1OH8A 3FHOA 3QKUA 4Q4JA 1FW6A 3UMRA 5HTKA 1PLJA 4C0SA 4F4JA 1UPTA 4BGDA 4YMWA 5GJWC 1XZPA 5EQTA 4DUGA 5DHFA 4ASUA 5C46F 1D9ZA 1GL9B 1VG0B 1Z6YA 1XTRA 3UXMA 3RABA 1MRSA 4N0EA 5FTJA 1GWNA 1VG1A 2GXUA 1LNZA 2BMEA 3EG5A 3GLGE 3CLVA 3EC2A 3LW8A 3KUDA 3UG6A 3DKVA 3A37A 5FL3A 4V0ME 3C41J 3X1XA 3WYAA 2IWHA 4FIDA 2Z0MA 3CBQA 4IDPA 1XTQA 2QA5A 3U7GA 4R2HA 4B76A 1EFTA 2BV3A 1WBDA 3I8SA 4PPGA 2OAP1 2I1QA 3X1WA 3BFXA 3EZ2A 3VR5A 2HXYA 1N25A 1SHKA 3D8BA 4B71A 3VTKA 4JVLA 3S1AB 1MO6A 1FMJA 1N6KA 3GEIA 5H1YA 2OLJA 4NMMA 1JR3A 3DO6A 3RSLA 1DAIA 1KAOA 4F91B 1EG7A 4M1TA 1N0VC 2IBMA 1II9A 4EFLA 1Q3TA 4GOXA 4JL8A 2CXXA 4WOPA 3UWOA 4JL6A 3MRSA 3PENA 4BLTA 3L0PA 2JLSA 2O0HA 3SQXA 3QG1A 5E95A 4DKXA 2ZRLA 5CK5A 4HLUC 4Q1DA 5GJBA 1YJ5A 1T3LA 3QBVA 5G40A 1KI9A 2BJVA 4QOSA 4Z1MA 4Q48A 2HUPA 3H2YA 2AHOA 1QF9A 2QG6A 2YINC 1VKJA 4FXPA 5J4HA 2PMKA 4EQ6B 3B1VA 1VHTA 4X8MA 4A4DA 2KSQA 2WJGA 4CEIB 1E2PA 3BH7A 4BLPA 1KK1A 4LYFA 1XD2A 1OE0A 2PMDA 2C2HA 4TZ6A 2BKUA 4YXWD 5KOYA 3WY9A 1HT2E 1VMAA 1TNDA 2BCJQ 4U7DA 1IJEA 5JRJA 1TPZA 4I99A 4US1R 4AURA 1S2MA 3F8TA 4IVRA 2BDTA 1G17A 2IYRA 5KDDA 3K0EA 1CU1A 4LC0A 4NU0A 3X1ZA 4CEHB 2XB4A 4TYPA 3THYA 3DM5A 4EFMA 2GCNA 3LY5A 2ZR7A 1HE8B 1UKVY 4MKIA 4O2RA 4WVFA 2RCNA 2Z83A 3E2IA 4PPFA 1KKMA 1II8B 2ZAOA 2G88A 3K0CA 4QM6A 4B3CA 1KDTA 3B78A 3AVWA 3HU1A 4M9XA 1E94E 1NJGA 1SQ5A 4PHTA 4TQ9A 5KUTA 2IYYA 4IDHA 2O8BB 4H1UA 3T5DA 5DGXA 2QY9A 2IS6A 1GZSA 1PVOA 4XD7A 3W5IA 1W0JD 3LAWA 1ZW6A 5DHAA 1G18A 2C96A 3RYTC 1W49A 3LA6A 1Z6TA 1EFUA 2LKDA 1MV5A 2QM7A 3CKLA 3SI7A 3VHLB 3EIHA 3FVQA 3LW7A 4FN5A 2H18A 2IXFA 3LQQA 5KSOA 3GLHB 2EFDB 4LYJA 4KFTA 1MO3A 2AXPA 5JECA 3WNBA 1O87A 1P75A 2F3TA 1W2GA 2WVJA 2W6IA 4IXMA 5FH9A 2Y8EA 4GOKA 4JKYA 4IKEA 4GL2A 1T9HA 3QVVA 2FFQA 5IT5A 1XX6A 4MUAA 2XNSA 5EJEA 2VH5R 1YRBA 4WA7A 2GF9A 2ZS7A 2JJ2A 1XD9A 2FEMA 5E7IA 2OCBA 2ECKA 4DEXA 2YNMA 3O8BA 4JVNA 3K8YA 3L0OA 4N3NA 3AVXA 5HZHA 5CJ2A 2BMDA 3IPYA 2D3WA 3FWYA 4LV6A 4RSGA 2PEYA 5AUQA 2FU5C 4M8NE 1IM2A 1UJ2A 3BORA 1E0SA 4GZLA 4P33A 4ZO4A 2PX3A 3RAPR 3EZ7A 4OL0A 4D25A 2R6AA 4BE7B 2JA1A 4NL4H 3RWOA 4EQ6A 2OAQ1 4OHVA 2OEPA 1IHUA 2FSHA 3WRXC 1MKYA 4P0TA 4DIEA 1QDEA 4RFSB 3RNLA 1QHHA 4GMXA 4BLSA 1XEFA 4UJ5A 2DR3A 1QHIA 2EQBA 1KDOA 3WNCA 1CULC 2DFKB 4PHGA 4URWR 2GJ9A 4QBFA 5K8UA 3QVUA 2R44A 5GVSA 1NL3A 3Q5EA 1A82A 2BBTA 5KSZA 1OIVA 4ACBA 2J0UA 3VQTA 4JBXA 1N6LA 2YV5A 1KTVA 3AVPA 3D6TB 3PEVA 4PC6A 1P9WA 3WP0A 4P4UA 3GJXC 4QHYA 1ZM4A 4JSTA 2L0XA 3KB2A 3DL0A 2Z6VA 3AKDA 4LHXA 3JVVA 3L43A 1N6OA 5K8IA 2NPIA 1Z22A 4B43A 2WSSD 3FMFA 2GZHA 2F55A 3EASA 1UAAA 2VHJA 5DISB 3RWMB 1Q21A 2I4IA 3AGQA 2IS2A 4DHEA 2B92A 1VG8A 3Q3JB 3RS5A 4DSTA 1FTSA 4IVQA 2YC2C 3TSWA 3ZGXA 4D4LA 5G3ZA 5TMPA 5F9FA 4ERNA 3MLEA 1DO2A 3P1JA 2QMOA 1WRBA 2Q9AA 1M34E 2YYZA 2RB4A 4L16A 3CWQA 1W47A 3K53A 4BFVA 1GNQA 4QG7A 1OB5A 4GDFA 3GLHA 1RJ9B 2YWGA 1U8ZA 3RS7A 3C4JA 1G4AE 1J2JA 2P0EA 2QEQA 1KI3A 3P4XA 1NRJB 3B85A 4HAZA 1SXJB 4CEJB 3IPXA 4GFDA 3TBKA 2ODNA 5JWOA 1G5TA 2QPTA 4YONB 3HJNA 4HAYA 1W36D 2WIBA 1OSNA 3LV8A 4IJMA 1DAFA 2IYXA 4LJ8A 3W6OA 1P2VA 3R9IA 1C9KA 3QJYA 1KI1A 1BMFA 1NP6A 5B2ZA 4MDFA 4B33A 4NE2A 3TQCA 4KO8A 3HU3A 5FPYA 1ZINA 4A8JB 3OIVA 1OXTA 3OE7A 4X8LA 1Y63A 3U6BA 2PZFA 1KZ7B 2OT3B 2GJKA 2OCYC 4JZKA 2QORA 4A6PA 1TQDA 2QE7A 2ZR9A 2Z4RA 4TTRA 3EPJA 3KJHA 2O8EA 4MH0R 4RFSA 4XVUA 4GNKA 3B5JA 1HQCA 1ZJ6A 3CRRA 3OZXA 4JBWA 3Q85A 2DWQA 4HB4A 4RD4A 3UWKA 4TL8A 5DYGA 5B30A 3ZS8A 4OQXA 1E0JA 2D4HA 4M1MA 2HEIA 1JALA 2A5DA 2C5LA 5BWMA 3V00A 4LBVA 4M1OA 2VO1A 4HAXA 2N46A 2G77B 1E69A 1T91A 2VYFA 3SHFA 4BECA 2J7KA 2QN6A 4ACAA 1H8HA 2VTKA 4G0NA 4F4IA 3SOPA 4G5SA 2JATA 3AF1A 2ZI9A 2OBNA 1AS2A 2ONJA 1PUIA 3W8NA 3BRWD 3I5YA 1IN5A 2B8TA 2SHKA 3VX4A 2PBRA 3T1OA 2X2FA 4Q18A 3WXMA 4HYYA 521PA 5TVKA 4LK2A 4DSOA 3AVYA 4YQFA 2ANBA 2EYQA 3KJGA 3DMDA 1A2KC 1KK2A 3NDPA 4JLDA 2OO7A 3ND9A 4KLNA 5A4JA 3RS2A 4EIWA 2H5EA 3T5GA 4XWOA 3K0FA 1LVGA 3ZD6A 3L8ZA 3HWSA 2VBCA 3U3RA 4IOKA 5SZKB 3A1TA 4LBWA 1RPZA 2V9PA 1FQKA 5H8WA 1GITA 2FZ4A 3DVLA 2K5UA 1N5IA 2HF8A 4PSKA 2ZI7A 1E2NA 3ECCA 4KYIB 2CLSA 4R7ZA 2BMJA 3B9PA 3TAHA 4JLNA 2JCSA 4D26A 5C1BA 2FF7A 1SXJA 2FZLA 1BOFA 1SHZA 1IXSB 4ABYA 5L8VA 2A7QA 1XXHE 2IF0A 4W9MC 4EUNA 1N5JA 1IXRC 2ODWA 2IYQA 4V02A 2QTVB 5FPTA 4A6XA 4B3DA 1TF2A 1E1QD 3MWYW 4X8HA 4IRUB 3VFDA 4ZDWA 4Z8XA 821PA 4HI0E 2D62A 5DN6D 3GJ3A 3ZLJA 3C5HA 2XTNA 5FPHA 3IUYA 3CWZA 4A8JA 5CDFE 4M2LA 5CIQA 5FPSA 4C4PA 3U61B 4B44A 1P7CA 4PPQA 2NO0A 3E5HA 1DARA 4WZAE 2VP5A 2VQSA 1KJZA 1BH2A 4PSVA 4QGAA 3KKMA 4CGZA 3BWDD 1S9HA 1JEDA 2ZJ2A 4MGZR 3EARA 3K1JA 2GAOA 4S2EA 1CJVC 5LBIA 3K9LA 4Q1CA 2GNOA 4DDWA 1G41A 1M2OB 4LJ7A 3QKRA 5FTLA 1XEWY 4B3GA 3ZIAD 1UEIA 4TTQA 5AJVB 1KSGA 5LDDC 3GLFE 1OLOA 1M7BA 3RDPA 2WWYA 2CEAA 2H57A 3EAQA 2VL7A 2RGNA 1R4AA 2GEVA 1DAGA 1EFHA 1ZD1A 2P6RA 2KI5A 2HYIC 1KO7A 3RVBA 2J59A 3CRQA 4RD1A 4LPKA 3QPWA 2J0VA 2J1LA 2GESA 1OW3B 4C0JA 2X8AA 4G3XA 2OFXA 3DKPA 3SFZA 4BASA 4OHYA 3H84A 2NQ2C 3GEHA 4A15A 1GM5A 2IT1A 1JAIA 4ITRC 2JDID 1NKSA 1VIYA 5D3MB 1Z83A 1ZYUA 2QAGC 3OIWA 4IXNA 4PANA 4F7WA 4A36A 2BC9A 2WM9B 4P4SB 4WXRA 4Q47A 2AX4A 2GA8A 3IHLA 1BYIA 1GRRA 1X6VA 2C9YA 3VX3A 2WZQA 3P20A 3GLGB 2WIAA 4WAUA 2IL1A 1NLFA 2O8CB 2AD5A 1IJFA 4YC7A 3VR2A 5C18A 4HB2A 5JI3E 2NO1A 1E2LA 3KXKA 2GHIA 3GMTA 3X1DA 2QAGB 5ANRB 1GG2A 1AQUA 3NHBA 4WBSA 3WRYC 4LGMA 3CO5A 1NG9A 4W5WA 1RRFA 1UKYA 4NH0A 1G5PA 4QGFA 4GMDA 2YOGA 4D80A 4C0AC 4L15A 3A58B 4BLOA 1K5GA 1R5OA 2BMFA 2WSMA 4JLMA 1OFTA 1RIFA 1W5TA 2QZ4A 1U0HC 3AVQA 1CP2A 1SGWA 3CZQA 4DWJA 4QFMA 4OYHA 1DEKA 5GVRA 1ZRHA 2C98A 5KDOA 2BWJA 4CZ2A 4ZCMA 4RKEA 3SS8A 1XF9A 3ZS9A 1GRNA 2GXQA 2F9LA 4D4MA 5K8LA 4KJZA 3X1YA 4Z8YA 3ASZA 2WJHA 3EIQA 3AF2A 4NP6A 3QY0A 3QXJA 1TQ6A 3MGCA 4DCUA 3PEWA 1ZM7A 5J47A 2XOKD 4RCYA 1US8B 2GK7A 3RHFA 5JFGA 2Q21A 3PFIA 4DEYA 1M8PA 2FV8A 2ZVQX 1R10A 2EFHB 1UF9A 1NBME 5DH9A 5P21A 3TJZA 1KSFX 4EPYA 3TSOA 4JLVA 4XSHA 4FMDF 2J45A 3AP2A 4HDQB 2OFWA 5TB5A 3CB4A 3BH6A 1G6HA 3GLIB 3B13B 3PITA 1E2GA 1TAGA 3P27A 1ZNXA 4F4CA 1OXXK 3D3QA 5DI9A 4TYYA 4Q9JA 5JS7A 3W9YA 1K6MA 1N6RA 1XMIA 3CF2A 1TTTA 1KO1A 2IEZA 2JLWA 1Z29A 4B3BA 1EX6A 1R0ZA 2CVFA 1QHNA 2WWFA 5FUWA 3ZVRA 2IYUA 4HAVA 1X8LA 3KQLA 4R2IA 5D3MA 4AG5A 2OBMA 1IY1A 2J87A 4DCNA 2QL6A 4YMTA 3THXA 2F1HA 1OH7A 2XXAB 3GEEA 1F2UB 4B75A 1X1SA 4Q9KA 1M6NA 1SVLA 1CR4A 3I61A 1XB2A 3GJ0A 1XD8A 2KBEA 1SXJD 3KKNA 4E5UA 3D31A 3F0TA 4B32A 3BS4A 3FFAA 1P72A 4XIGS 1G7TA 4PPNA 2ZJBA 5KPJA 1LF0A 2QRNA 2R62A 4LJ6A 4ZDIA 2QSYA 2BOVA 1DAKA 2FSFA 1V5WA 4PAMA 1XPUA 3BH0A 2VP0A 2GJAA 1G3UA 4DJTA 3CW2A 4BQSA 2VSXA 1XPRA 2FPMA 1JR6A 3FYHA 2WOJA 3PJRA 3IBYA 2RGCA 1XTJA 2G0TA 1G3RA 2DFLA 2XEXA 3KQNA 4JLPA 2F3RA 5H70A 4FMCB 1L8QA 3QKSB 5HCIA 1TQ2A 2CLCX 4ON9A 5KNCA 2FFAA 2P5SA 2VSFA 3SJCA 1DE0A 1W0JA 3AH8A 3LD9A 3ICQB 2A9KA 2GDJA 1AZSC 4KFSA 2QPAA 3WMEA 5FTMA 1J70A 5JEEA 3LVQE 5LPNA 3UMFA 1Z0FA 4GBMA 5BQ5A 3K0AB 4NYIR 3WHLA 4I4LA 5DE3A 1M74A 3T15A 2YWFA 4AG6A 3FOZA 4M0LA 1UEJA 4OJQA 4Q4HA 3RRNA 1BYUA 3PV0A 3NDBB 1OPXA 3AM1A 3ZQJA 2QPOA 2IF2A 1S1CA 3GLIA 4OQNA 4TN1A 2ZI4A 3QF4B 4B2IA 2IK8A 1NKTA 3MAAC 5E4FA 1G8FA 2R6GA 2J5XA 4CVNA 4HUTA 2X1VA 3U60B 1U99A 1GSIA 4PZYA 1JQJC 1E96A 5E3HA 5FFMA 3CF0A 1OT3A 2OG2A 4A0RA 3MCAA 1KIMA 2ODEA 2BBSA 2MSCB 3BJIC 3A1VA 3IBGA 2OM2A 4ZI2A 2NO9A 2AR7A 4BZQA 1COWD 1F2UA 3NH9A 3RRMA 1HT1E 3CH5A 1U81A 1E9CA 1Z0AA 1VYTA 2GXSA 4G5OA 4CW7A 1DAHA 1ZD9A 2IXEA 1AK2A 1DVRA 1NN3A 2CDNA 4CF7A 4GPTA 2VA8A 1R2QA 1QHSA 1P60A 3AF0A 3TVDA 4QHSA 1GVNB 5J4LA 4C2UA 2R2AA 1Y3AA 1G5RA 1VDZA 2BIFA 3KKPA 4I1OA 1E9FA 3RANA 2ERXA 2WSSA 2PLRA 4UNSA 4DLTA 2WJVA 3K70C 3M6AA 4BWYA 1NJFA 2ZUBA 2P67A 4HSEA 3IIKA 3KTAB 5KNBA 2ZJAA 2QU8A 4BRWA 3KDSE 4HB0A 4QNMA 2E9SA 3SJAA 3EPKA 1GKIA 4RZ3A 2VHTA 1KDRA 3GCGA 2MSEB 4QL3A 1UADA 2X19A 2ZSFA 3WYGA 4US2R 3GJ5A 1E79D 4QGHA 1CLUA 4MRVA 4KCGA 1CS4C 4D4KA 1DPFA 1SVWA 1R0WA 1NVVQ 5CK4A 2R9VA 3V4FA 3I3SR 1GP2A 1UBGA 5FOSA 2XX3A 4DIDA 3K09C 1EX7A 3TUIC 1V43A 3VU9B 1AKYA 1F48A 3HR7A 3LQRA 4CYMA 1W4BA 4FMBB 1RKBA 1ZD8A 3VR4A 3DHWC 4ZCLA 1VCIA 1QG4A 3FFBA 2VHCA 5DSZA 2GBLA 1VTKA 3T06B 1E2MA 4P4TA 1AKEA 4TYNA 5FOWA 2OXCA 1MABA 2FFHA 3QF4A 2EWVA 1R6BX 1JB1A 5AR1A 2ZEJA 3L0IB 2AL7A 4LJYA 4M53A 4TL9A 4JLAA 4XTCS 3TKLA 4KITB 5HKKD 4YMUA 1FX0A 3AF4A 2OCPA 1ZCAA 1NY6A 4Q4AB 4EJSC 1E4VA 1XJQA 2OE2A 4KLZA 3U7HB 1QVAA 3BB1A 3FHCB 3MFYA 2OZEA 2G9NA 2CVHA 4XJXA 3W5JA 4A0HA 4DXAA 1FNNA 2IYZA 4TL7A 1WCV1 3GJ6A 1XRJA 1CEEA 1KO4A 1G1MA 2WOOA 1Z6XA 5KTYA 3E1SA 5CB8A 2QMUA 4LSGA 3T1QA 4RVCA 3SNHA 4DC9A 2CHVA 3MG9A 5HZKA 3ADDA 3H4MA 5IK2D 3IIJA 1IQPA 1ONBA 4PFSA 3CRVA 1M1YE 4D0GA 5FL7D 1KGDA 4L9SA 4E09A 2PJRA 4FI3C 1TUEA 3H86A 3KB1A 4EDHA 2VF7A 5CM9C 3IO3A 4MITA 1F3OA 4U5XA 1QRAA 2WWHA 4PR0A 2D7CA 4Q1EA 2BBOA 2W0SA 1KJYA 1TF5A 1XMVA 4FCWA 3ETLA 1VYUA 1LB1B 2QT1A 1QHYA 2RGGA 2ZI6A 3AVOA 1C4OA 2ZRHA 4DDVA 5TY0A 3MSXA 2EFEB 2QM8A 3LBIA 1KSJA 1UM8A 3B1XA 3QENA 3R9WA 2CLDX 2QTHA 3LBHA 1Z0JA 2NG1A 3QEJA 3U3OA 5A5GA 1XXHB 1EFRD 3IO5A 4IEEA 3U3JA 2I1VB 1R5BA 2ZRBA 3S1AA 5CM8B 2OLKA 2AK3A 1G6OA 1Z63A 1E2HA 3HPQA 1N6IA 3ZVLA 4NDZA 2P2LA 4RZUA 1G9XA 1X86B 3NH6A 3AP1A 4E07A 4FD2A 1ZCBA 2OCAA 4C0KA 2C04A 2FDCA 4W5HA 3WMGA 3G5UA 4AY2A 4DT1B 1KAGA 1N6PA 5A0FA 1Z3IX 1U94A 4DCTA 4EPRA 2O8DB 2QQ0A 3PG5A 4KFRA 2ZJ5A 5BN4A 4KVGA 3BAFA 4DDUA 5JJKA 2JASA 1DTSA 5B64A 3N70A 3RSOA 1P2UA 1NMZA 2JLQA 1E1QA 1NMYA 1W48A 2F9MA 2HT6A 1XCMA 4HZUB 3ICEA 1NVXQ 1XJ0A 2F7SA 4D0NA 1J99A 2ZSEA 2UZIR 5DN6A 3REGA 3GLFB 4CEIA 5DI3B 3N2IA 5AWFC 1AS3A 2YC4C 4PXAA 3RC3A 3R8CA 5K8TA 2XSZD 2VP2A 1JR3E 2RGAA 3QI2A 1E99A 5EZ5A 2J9RA 4HLUA 4B74A 4UNNA 2E87A 3DZ8A 1I4DD 4LJ5A 3FMOB 1XCGB 2QAJA 4ARZB 3U3KA 4XH9B 2ZU6A 1ANKA 1NLYA 1Z47A 3ZYCA 4UQOA 421PA 2ZQ5A 5CYPA 4HLDA 4Y0VA 4JLBA 1AZTA 3NEYA 2GEDA 1BKDR 4FCVA 4PAQA 1E2KA 4CEHA 5FR1A 1W7AA 1L4UA 5GJCA 3ZIAA 2CE2X 2XB2A 1SVKA 3SE0A 5FOUA 1OHHD 1LW7A 1VCMA 4K8OA 3VAAA 3K9HA 4C7OB 2IYWA 1ZUIA 1M7GA 4GSYA 1G21E 1II8A 2AKAB 1J8MF 1NLZA 3CR8A 4UKDA 2ASEA 2FX3A 4TMWA 3REFA 1KI7A 2O8BA 2IS4A 4LPSA 2QT0A 1J7KA 2DWPA 3SBDA 1ESNA 1GNRA 1R0YA 1ZNYA 2ZROA 3LBNA 2DFNA 3M4YA 1CJUC 1JNYA 2B21A 3OFNA 4JIMA 2JDIA 3U2QA 1CRPA 1Q12A 3TGPA 1A7JA 1JXMA 1NMXA 1Z08A 3IHWA 3QXSA 2FA9A 4IOMA 4RY2A 3TMKA 4B73A 3TNFA 2RMKA 1P6XA 4II7A 2O0JA 2CCJA 4LV8B 2EYUA 1XTIA 2Q3MA 3RC8A 4A82A 5J5CA 2CE7A 4YDSA 5EXSA 1GKYA 3HDTA 4H1VA 1FQJA 1AN0A 3N2EA 3SDZA 1Z6AA 1D8TA 3MUFA 3GJ7A 3TSZA 1SKYB 2QMHA 4WZ6A 1HY3A 1UKZA 1ZIOA 2FN4A 2IYVA 2V3CC 5EE3A 2ZS8A 1RE0A 4NYMR 2PH1A 2WV9A 3ASYA 1RYFA 1TEXA 1IBRA 1QBKC 2ZRDA 1GFIA 2JAQA 1SVIA 4R98A 4URUR 3KL4A 3UANA 2V6IA 2VPPA 4QJ4A 3SEAA 2FGJA 3BFVA 4PC2A 2WMNB 4PC1A 5L3SB 1L4YA 2HCJB 1H8ED 4OK6A 2REXB 4PZZA 3SJBA 1XEWX 1T0JB 2YWHA 1SULA 2CCKA 4XWKA 2ZJOA 1P5ZB 2HF9A 2XOKA 5CIWA 1PJRA 3MJRA 2DHRA 4BEBA 1U9IC 2JJ8A 3GJ8A 4HLQB 2BHRA 2O52A 3BD9A 5FBVB 3FPAA 3A4LA 3T34A 5BN5A 2CL7X 3L0SA 4R71A 4KBFA 3FKQA 3T61A 3CRW1 1YZTA 3TRFA 2GAAA 3MWKA 221PA 2HJVA 2PT7A 2PX0A 2ZSDA 4IDNA 5L3QB 4ZCIA 4JYBA 1KMQA 3VNUA 1QHXA 1ZM3A 1ZIPA 3NBXX 1NVWQ 4JSYA 4KI0A 4KYUA 5J4KA 4Q7JB 4MGIR 3O8CA 1BO6A 1CR2A 1E9EA 3PUZA 5AK0A 2EWWA 2OFOA 2Q9CA 4ZI3A 4HAWA 4Q1FA 1IAQA 4LUCA 2J0SA 2ZE7A 3KFVA 4L4UA 1OB2A 4QJ5A 3GPLA 3K70D 2XNDD 3IEUA 1M7HA 4TYQA 1OKKD 1U2RA 1S3GA 1ZUNB 4A2WA 1U90A 3QXXA 5DNYB 3AB3A 5JSZB 2Q3FA 1YZQA 3AUXA 4A0GA 1OFUX 1RJ9A 2NOAA 1W2HA 1XU4A 2EFGA 3THWB 4KFUA 3UATA 5JJLA 2XTMA 4KSBA 2O5VA 2D7DA 3EWAA 3LDAA 2WJYA 1S96A 2IC5A 4CEJA 2ERYA 1N3BA 2VP9A 2JLYA 3A1SA 1D2EA 3I72A 2GXAA 2W6JD 2ZRMA 2NPFA 1KJWA 2IHBA 3U3MA 1MO5A 2V1UA 1E2EA 2RGXA 3AUYA 5HCNA 3OF5A 3TUZC 2XJ9A 4EKDA 3PUWA 1KNQA 1OYYA 2ONKA 3SYNA 4D2IA 3B60A 2CJWB 5C4MA 4DB2A 1Z0IA 4FW9A 3VR1A 2ZI5A 5AJYA 2D2FA 3F5FA 4LC1A 1T8UA 2IEYA 1G7CA 1OH6A 1Z2AA 4HUQB 5BW8A 4MRNA 5EE0A 1EWRA 2R65A 5LB4A 4NONA 4Q9HA 3GLHE 1CJMA 4OQMA 4U00A 3RS4A 2VP4A 2P5TB 1SVMA 4MA4A 5FTNA 2JLUA 4LYHA 5EP1A 2QENA 2AK2A 2GF0A 4I1UA 2ZE5A 2QP4A 1MO4A 3E70C 5AJZA 1E1RD 1D6JA 4M1YA 5FBWB 3BIFA 4QBIA 2A5JA 3QIAA 1T5LA 4AK9A 4LHYA 1N2CE 4HB3A 4M4SA 5EP4A 2QTFA 3A1UA 4JT4A 3EPHA 2OV2A 1VCOA 3QEOA 2C8VA 2GETA 2CNWD 3C14C 2I3BA 5JS8A 4W7SA 2IXGA 4TLCA 2A30A 1X8KA 3MJHA 3PVSA 5FOTA 4CT5A 4OQFA 4V0KA 1T5IA 4Q9IA 1ZUHA 4RFVA 2FEOA 4QGGA 1YR7A 3RRZA 2WKPA 3OFND 4A0FA 3CH4B 4B47A 4Q66C 3ZJYA 4TYWA 4P31A 4NYIQ 3TK1A 3CX7A 5IF9A 4KV9A 4Y0AA 5IHPA 1Z5ZA 3B7GA 4MKFA 4D6PA 3UG7A 4O25A 3I73A 3K0SA 2Z5FA 3A8TA 3DMNA 3U44B 1PV4A 3HPRA 5JHHB 4TZ0A 4RCZA 2O0KA 4LHVA 5JSZA 1S1MA 1DS6A 1COWA 4PO8A 2IYTA 3QQ5A 1SVOA 1YZUA 2ZSBA 3JVUA 121PA 4LWZA 4AKEA 3AVUA 1VECA 5TXGA 4BFTA 5KSYA 3U4QB 3QUSA 5B58C 3TVTA 3WBKA 4LV5B 1VG9B 4IW3B 2HXSA 2QROA 5DLQC 2WWWA 2YWEA 5HR5A 4CIDA 3L8YA 4TT3D 4BZXA 5EP2A 5SZHB 4MYTA 4DLYA 1DOAA 3OHMA 4Z54A 1FNMA 2FPKA 3W34A 1AM4D 1S0UA 5AJXA 2FGKA 1FTNA 4B34A 3V9PA 1G20E 2EW1A 1KKLA 2HLDD 3P4YA 4BPBA 2A3RA 4IDOA 1KDPA 1XTKA 1D2NA 4DRZA 1NY5A 1ZC3A 2QBYB 4IDQA 1LF5A 1E79A 2NIPA 1G8GA 4TLBA 3FGNA 4JBYA 1SXJE 1G8YA 4KODA 3FHTA 4ZPXA 4L5BA 3P32A 1YR8A 2NO7A 5M04A 4C3ZA 2PL3A 2C99A 4OI0A 2W2XA 1Q1BA 3TW4A 2WJIA 5IDVA 1HEIA 4ZDJA 1MT0A 2A78A 2Z4SA 2X77A 3VMFA 4JLJA 2ZE6A 1XTSA 3BBPA 1OIXA 4BLRA 1RW4A 3EW9A 1P3JA 4DSNA 2DWOA 1QHGA 2B7CA 2V7QD 5F9HA 2O8FB 4EPTA 2XJ4A 2ZITA 3FE2A 4NCJA 4C0HA 2NZ8A 4ZIRB 4TMVA 4EPVA 1P9RA 1SZPA 2ZANA 3CPEA 5SZIA 4NBSA 1GRQA 1Z06A 4NYJR 2QGZA 3IIMA 3NBFA 1E0AA 4Q00A 2FSIA 4N1AA 4G5RA 1U0JA 3SN6A 1UBFA 4L8GA 1GKUB 4URVR 3GFTA 1F60A 3B6EA 1WE2A 4X8OA 5JWHA 2GWHA 3IGFA 4HATA 4DVGA 4P4SA 1E9BA 2RAPA 3U7EB 3R7WB 5HKKA 1FL9A 3I1FA 3GLGA 2LKCA 4WW0A 2WTUA 1A1VA 4O2LA 2HCBA 2O8CA 2WBLC 3O8RA 4V0MA 3C16C 4KBGA 1VCNA 2XZPA 4AKIA 2CCGA 1W4RA 2QAGA 2OXRA 4KHZA 4TQAA 3UPUA 3SYKA 3T1VA 4BFWA 1GILA 3OESA 2DYKA 2Q6TA 3VR3A 5KPDA 3U4QA 4JJZA 3DOEA 2AKYA 2GZAA 3OEHA 5IK2A 2RHDA 1EGAA 1OXSC 2QQEA 4ZKEA 5FL7A 1P73A 2QMEA 4Q4JB 3IILA 5G41A 4FCTA 1P2TA 1OYWA 3CPJB 1XMJA 1GIAA 3Q8XB 4HAUA 5JRZA 3QG5A 1DADA 1PLLA 1NBMD 2ZRFA
chains in the Genus database with same CATH superfamily
3UB8A 4L8WB 5K8VA 5TPZD 3KEDA 3DZGA 4F5DA 1ABEA 3RRFA 3UTCA 3H2SA 1RACA 4MP3A 1RLOA 2BTQA 4Q03A 2ATXA 1P8AA 4P3XA 3E81A 1C2TA 1AB5A 3RFCA 1WZNA 4BLMA 3KWJA 1WD7A 4HGRA 1B3BA 2DKFA 2OQRA 3DXYA 4GKKB 5KDLA 4ZRDA 3T9CA 2LIVA 3CZPA 4I39A 2QJWA 4BBAA 1TMKA 3WLTA 2ZUVA 3SM9A 1PJTA 2PX5A 1E2QA 1R4NB 3D0KA 1CEQA 2FYTA 1EXNA 2Q3EA 4FYKA 1E9RA 2CD7A 3H9GA 2XRFA 4W63A 1ZVQA 3DPUA 3QP1A 2PUTA 3N8HA 1T9KA 5EJ8A 2AMYA 2IZZA 1UQTA 2GVZC 1W85A 4PQGA 4KWEA 1V96A 3BXPA 1E2IA 4R84A 1R15A 3KPWA 1E7SA 2P0YA 3C8UA 2E4XA 1XZ8A 1E6EA 1RPJA 5EZYA 3WGVA 1G5HA 3L7DA 2AI3A 1EVYA 4ID4A 4RPHA 5IXJA 2M7UA 2J0UB 1RBQA 1WYBA 4E5YA 4MWTA 2LB5A 2GEKA 5F78A 6Q21A 4KMMA 1ATIA 5DU2A 4L9AA 4LYDA 5DTSA 4FHCA 7AT1A 4FWTA 1GAQA 2ACEA 2PZAA 5JVDF 3WHIA 1ALQA 3VU9A 2PLWA 3SK0A 3N0XA 1RVDA 4E5VA 1QRUA 4AZTA 2VRBA 4NMHA 1G7RA 3WMFA 3TOCA 4PM8A 4UQIM 2FNAA 3OEEA 4N3GA 2AN4A 1FFHA 3J81k 2EKQA 1CR0A 4D3ZA 1DMSA 4CFSA 4BX2A 4QXAA 4I3JA 2V3VA 4OIFA 1FA9A 4Y1EA 4EJSA 1UBCA 4NR0A 1NPTO 2REOA 5LOVF 2D0PB 3T8YA 5DPEE 4RTQA 3UAVA 3IF6B 3W4QA 1IQRA 1SOAA 4ZHQF 1XVIA 1I3MA 4WLNA 2HRQA 3NIGB 3UK6A 1F12A 1WMSA 3ZHRA 4Z99A 3MT8A 4GP6A 2R11A 3KPJA 4MGHA 3AINA 4Q9DA 1S8FA 2ZOIA 4OFBA 3B1WA 4LHWA 1HYQA 4NFSA 5ERGB 3T95A 4LJ9A 4BTEA 5EUAA 3MWJA 4WZAA 1RZ3A 5TS3A 3ADOA 2WKSA 3OM1A 1FSZA 4LSZA 5K3CA 1UDWA 2WSIA 5G0WA 2FMXA 4EELA 4V0LA 1KMIY 4PO1A 5FOVA 5AQ9A 1B2LA 1FDRA 2A88A 4WGFA 2AC4A 1TL7C 6REQA 3H8SA 4LI0A 3BLMA 3AKCA 2RKWA 2W98A 5FRDA 1VEUA 4BUJA 3L0YA 3DEYX 3LQYA 5A3QA 2VPYA 4M0KA 5J23A 1FPMA 2EQ5A 3PX3A 1I3CA 4FNMA 4ESHA 1YR3A 2EFYA 3T4XA 1PZNA 4FDLA 4Q7KA 2B3TA 1UM9A 4JC8A 3V3RA 4CHGA 4A2PA 1VHJA 1VLQA 4GL4A 4UUAA 2HL6A 3DHVA 1KI6B 2QG9A 3U7FB 1A50B 3VO2A 1K2VN 4A5SA 5DGHA 3ZV7A 3PBKA 3IUJA 1YC5A 4S35A 2CMGA 2XQIA 2XHEA 4PAWA 1UXGA 1KZYC 2ZIVB 1EVQA 2E4AA 2YVKA 4MAFA 3GQBB 4Y2PA 4YAFA 2HSZA 1MPXA 3PDJA 4L07A 2XBMA 2V7BA 1FJTA 4HVCA 3VKGA 1FILA 2DCFA 4Q15A 4KX9A 2YHIA 1QF1A 2YN0A 2VZ8A 1DWQA 3K2NA 3KT8A 3B36A 3CJRA 3AO0B 2NYVA 4OQHA 3QI7A 4DE3A 5FEFA 2HYDA 3GLTA 4R54A 1WF3A 4BMSA 4AT1A 4DRXB 4P80A 1YACA 1QGZA 1BD3A 5BMVA 4HK4A 2GN2A 3LLUA 3QE4A 3V4ZA 2QE7D 1ZRSA 4E5NA 3AOEC 2WWXA 2MSKA 1CTQA 4H3KB 1QFSA 3V6LA 5FOQA 2RGBA 2NVBA 4KQKA 1RI3A 2AMLA 4Q3LA 3MS6A 3RJTA 1WUKS 2CZQA 2FR8A 5KVSA 1IN4A 2PJZA 4ZOEA 4IAOA 2R6CA 4CCWA 4S2MA 2XTJA 5ELLA 3JZIA 2DBVO 1WPRA 4BO7A 3BUSA 1UPUA 2BY4A 1NYMA 3SD7A 2HRRA 4FT4A 2G3YA 1YJQA 3LQKA 1ZQ9A 2H2HA 4EEXA 3D5TA 4OI2A 3OJXA 1Y6QA 4MV0A 3SXJA 3MDJA 1TLIA 1N7JA 1D9XA 5LNK1 2YTZA 3UK1A 1KNXA 2B98A 2AFHE 4M7PA 5DFXA 1ZG3A 1UWLA 4OU5A 1WZEA 4CMHA 2ATIA 1E2BA 4BOYA 1I2DA 3REQA 4Y30A 1NJ6A 1XV5A 2WFLB 3C1AA 5J1SB 4RTOA 4OH7A 1RPTA 3HH8A 4YRLA 1F14A 4N8SA 1U7UA 5H59A 4L5JA 4D9KA 1U60A 2IITA 3IUEA 4C7VA 4IM7A 2GJSA 3TDMA 2Y05A 2UXBB 1AF4A 2A5GA 5EXXA 4IQ4A 2YJTD 3B51X 3PKJA 4G3WA 1I2AA 2WD7B 3EZFA 3PRYA 4MUBA 4GI5A 1FNSA 3CLRC 4RBNA 5EKDA 1MH1A 3QGMA 3W5AA 1PYOA 1X7WA 1TVFA 2GN8A 2BM8A 3P2MA 4FFVA 3OJ0A 3X43A 4DUGA 1H5NA 3H99A 2O0LA 3IMGA 1UODA 2GXUA 1JBQA 5DMXA 3QU4A 1O7JA 1YCDA 3X1XA 4QYTA 1XTUA 2QA5A 4J7CA 1NX6A 1GEEA 2QRLA 4LN1A 3S1AB 2G71A 4N65A 4R05A 2B9EA 3HJTA 2EL7A 3E3NA 4KZ5A 3M7IA 2UZ4A 4N1HA 1E20A 3WWPA 2W2LA 3WMXA 2ZRLA 5T4BA 4EL5A 4Z9QA 1QF9A 2W42A 3N7AA 1KK1A 2WVGA 1X7DA 5HARA 3I9MA 1EUZA 3LO8A 1VLHA 4R6LA 1S2MA 4M1EA 1RT9A 2VQFB 1NQOA 4JA0A 5F68A 3DFMA 3EXG2 3K4PA 3U16A 3DM5A 2NSJA 2C3YA 4XB6B 2ON6A 2P9HA 1V11A 4MKIA 4KZPA 1KE1A 2B5VA 3D4BA 4QM6A 4ZGWA 1GHIA 3NC4A 3D3KA 1XP5A 1NJGA 4WE3A 4N6GA 1G18A 2LKDA 3AI1A 2PU5A 4REQA 4J49A 2N75A 1KZ1A 1RXIA 3SAJA 5JCXA 4R1NA 2ZS7A 1KDVA 5CG2A 4X3OA 3HKEA 5BNFA 3WLNA 4BU0A 3PWZA 2VH1A 2ZATA 1QDEA 4G37A 1QHHA 5K3FA 4HCJA 2DR3A 3HBLA 1N5OX 3RIGA 1A82A 1FMCA 1HNXB 1EB8A 3L46A 3JD0A 3DT6A 1ADBA 4OFZA 4K5QA 3UNXA 1FP4B 1UAAA 2Z3WA 4X95A 3Q7SA 4IVQA 3O2SB 5G3ZA 5HA5A 3K53A 5KMWA 1RJ9B 4JBLA 2EZ9A 4CEJB 2I34A 4MGEA 2AMFA 3EEBA 3H1BA 4ZQGA 2WIBA 1OSNA 1N2EA 1DWPA 4KO8A 1H2HA 3OIVA 3F1OB 5EOEA 4ND8A 1UK7A 2C5AA 4DWOA 4XVUA 1VP9A 1XRNA 1ZJ6A 4GERA 5J43A 5B30A 4KPEC 2BISA 4RF5A 1XCBA 4UCQA 3UA3A 4C20A 3ISTA 5U4XA 1OFUA 1FNBA 2J7KA 2H31A 1FVXA 2OCKA 3EG9A 1JHUA 1M8KA 3WGIA 3THRA 2QR2A 4Z7JA 4C4AA 3AVYA 4YUWA 2VHEA 2C9DA 5A4JA 3GY0A 4OA5A 4FGUA 2C9ZA 2HHJA 3WNQA 4J4BA 1JP7A 4ENTA 1YRLA 4TVOA 1ECJA 4DQUA 4XZ3A 4AJKA 2K7FA 2AZTA 2DY0A 1BGVA 4CLHA 4O1HA 1KPIA 4CM5A 4ZJ1A 2O2ZA 5CDFE 3U62A 5FPSA 4C4PA 4KRXA 4IJGA 4DWWA 1W79A 5EZYF 2NYUA 3JQAD 1KE4A 1RLUA 2B6NA 2GAOA 1SZDA 1IU9A 5GINE 3GVHA 4GLFA 1ZOLA 3AONB 2W8ZA 2WWYA 3N0TA 3N59A 2VL7A 2ZBUA 1ZMBA 4HC4A 1HT3A 5AI5A 3UMDA 2PUFA 3QW2A 3QPWA 1XNGA 2VPZA 1GM5A 4BX0A 1PJ3A 5D3MB 1Z83A 1UJ6A 5D85A 1JFTA 4X92A 4ZW7A 1BQEA 1AUXA 7MDHA 4OXQA 3UM9A 1DKOA 4Y3UA 5DWQA 5C18A 3C85A 3Q6IA 3A11A 1FFAA 5A4MS 3ANTA 3HDVA 1Y7TA 1FDOA 1BA3A 1RRFA 2B1RA 1ECFA 5K3AA 2N9UA 1R5OA 1YOVB 4XB2A 4YFVA 4UARA 5HSGA 2H00A 1XF9A 3F71A 1P29A 2IPOA 3GJTA 4RABA 3U37A 1W8QA 2TECE 4GHIB 2A1UB 2WM2A 1V1RA 4X6LA 5EOVA 1YVRA 3DXXA 5HL1A 3ZDCA 3FUHA 3QMVA 3OC6A 5A9RA 4DMKA 2GN6A 2CXHA 3OTHA 1DBWA 1QHNA 3DZKA 2WWFA 3V4LA 2IYUA 1HT0A 1CVRA 1GY8A 2ETXA 5T8KA 1NFFA 2KHZA 3VE4A 2FZEA 2XIJA 5JO0A 3VOYA 2EC5A 1EU1A 2CNLA 4DYDA 2ZJBA 1Y9JA 4ENVA 5CFOA 3TTWA 4ZN6A 1JEYB 3FYSA 1BU5A 1QVVA 5JNWA 4KGXA 6TMNE 2D1YA 4EK9A 1ML3A 3P96A 4C06A 1DKMA 4KFSA 3FPJA 3ZEAA 1RI4A 3TLGA 1Q92A 1WMBA 1Y8CA 2XADA 2AFIA 1FFYA 5DGDA 3OQOA 8ATCA 4QIHA 4FW8A 2QLTA 1JNXX 2O9JA 5HD5A 1FDVA 3DOUA 2Y66A 2P4EA 1E96A 1WHTB 3A4IA 3IBGA 2X8BA 2X9VA 1F2UA 2HGZA 3NH9A 3L0ZA 3T1QB 1ZD9A 3SMVA 2P5UA 3OTIA 3DWFA 2DNSA 1QHSA 4N82A 3H3JA 1GXSB 2BIFA 1PSWA 5E43A 3RANA 2P79A 1H22A 3GX1A 4JFAA 2IX9A 1RHRA 3WL7A 1PCXA 1G2PA 2AYXA 1LPAB 1VZ2A 3KAPA 3GRKA 2AI1A 2OV1A 4XGRA 2Q0XA 2WYUA 1ADCA 4Y2QA 1H4SA 2IPXA 3UCFA 1BLHA 4RVOA 3I2KA 2CLLB 3DULA 5AR1A 5ADWA 4XTCS 5F3RA 5I8ZA 2CD9A 2OZEA 5AVTA 3LIDA 4RLHA 3ICOA 1VMEA 5CB8A 4LSGA 3VR3D 1Z2EA 3C4QA 5T67A 4CIVA 4EO7A 2RSLA 4L9SA 4M1QA 4U5XA 2QD5A 2BBOA 3VTZA 2QT1A 1FFEA 4B3SB 1GPJA 3LBIA 4YTEA 3GN1A 2ZTHA 1U1FA 4Q7QA 1C30A 2OL4A 2ZW9A 3ZV3A 1U8CB 2P2LA 4U2EA 1GU7A 3V2HA 5H5JA 4HH4A 1KQ3A 2P7HA 3NIWA 2P1DA 5BR7A 1E8DA 1YS2X 1U2GA 5EJIA 4P7JA 4G41A 3TKYA 4D0NA 4AZSA 1DRMA 5AHWA 2XSZD 2J9RA 4HLUA 2DZDA 4IUBS 1N4AA 2W6MA 2WT8A 5U4QA 3X2FA 1Y9DA 1YKDA 4EUEA 3PFWO 5AW9A 2JH9A 2PBYA 4BWIA 4OPRA 4QOJA 3SE0A 1KWKA 1GSHA 1LW7A 4MS1B 2IYWA 3D0OA 3AXTA 5ADUS 1GPNA 3G30A 2ZTMA 4QLBA 3OM8A 1YI0A 1FYDA 3B6ZA 2VTVA 3F7NA 5HAIA 2R7AA 3MXSA 4RTRA 2CCJA 3ON5A 1Z6AA 4EMUA 3W6ZA 3EQZA 1NJ1A 2NO4A 2ZRDA 5CTNA 1XNRB 3MQOA 4GYKA 4WN3A 4WL0A 5CB4A 4C3UA 2Q29A 1N2IA 3HWWA 3SJBA 3I9FA 3CLRD 2ZJOA 2CVQA 3T4KA 2C4UA 1W5DA 5ICGA 4IH4A 3RKRA 5IYZB 3TRFA 4YA6A 2HJVA 1Z6ZA 4W1RA 1NR5A 1ZI9A 4KIWA 3O8CA 2JFYA 3GG9A 5A7GA 3JQDA 3GPLA 3A32A 5HW0A 5F1OA 1OKKD 1U8FO 2XAAA 5LZ8A 4YPOA 3CF4A 3AUXA 2CJXA 1SY7A 5CG1A 4MINA 2IC5A 1BA2A 1RCFA 4WKBA 5J3JA 1PZFA 4JUIA 1E2EA 2HDUA 3PUHA 1PFGA 4KDRA 2RKBA 2QV0A 3JTEA 2O14A 3A3JA 4Y2RA 5IVKA 1HDZA 3PFNA 3BRMA 4X1YB 3S99A 4D9FA 4U00A 1LNCE 2VP4A 4DXHA 4LYHA 4EF4A 4OKPA 4IL5A 2FG6C 4LKRA 1MO4A 5DRTA 2A1IA 4K3VA 2PVPA 2DQSA 2DXIA 3EYAA 2E4WA 1E4EA 3PVSA 3D72A 3OUUA 2NZVG 3O8NA 4Q12A 4U8GA 4FGSA 2P68A 4U0JA 1FVHA 4WESA 4Z0NA 4N48A 2M1ZA 4M0DA 1YS7A 5G4KA 4WKNA 1X7XA 5JR3A 1UMBA 2BASA 2E18A 4KB5A 2IXBA 2UVDA 2QTVA 4IV8A 3FYUA 5HR5A 2WIGA 3DTIA 4BZXA 3VTFA 4AXBA 2WQ6A 2EP5A 4HFJA 2GPJA 1G20E 3P7MA 5L6MB 1Z26A 2QBYB 3O87A 5H82A 1GQFA 4R40A 1G8GA 3IDAA 1Z36A 4L5BA 5AKEA 5DIZA 1D2HA 2PL3A 5FHQA 3HS3A 2X77A 1OIXA 4ATNA 3EW9A 2HMVA 2WP8J 4V0RA 3H4VA 1NULA 3CPEA 5ERXA 4NBSA 1Z06A 3LFHA 3HCEA 2GWHA 2HHCA 3IA2A 1E9BA 3BL8A 1YH3A 3Q9UA 1FL9A 1HE5A 3I1FA 4WEOA 1HKHA 5AQEA 4FNAA 4M88A 3FUTA 1RQNA 3WLMA 4UVHA 2V0UA 4G1VA 3OZSA 4JJZA 1H3NA 3OEHA 5A03A 3DE3X 5MGNA 5FL7A 5JLAA 4QX6A 4L8VA 2P0AA 5DSTA 1LTKA 3RT7A 3L0BA 3ZHHA 1TS6A 2PTHA 2YOHA 4G2NA 1ZO8A 2SCUB 4M0MA 5AUPB 2AX3A 4RD2A 4RH3A 3ZCQA 1ZSYA 1IXKA 2FK8A 2FJUA 3CZ9A 1NUQA 3EVTA 4FOTA 1NYQA 5B5SA 4ZX3A 5AYVA 1BNCA 3KOWA 5TT1A 3A2LA 5AHRA 1W36C 1JHPA 2M9MA 4QC2A 4LHEA 2IIBA 1EK2A 3BQ9A 5JRDS 2BHSA 2PRFA 4ES6A 2FMKA 2VEDA 3JTMA 5BUZA 2H7VA 3AKZA 5E1MA 2QSUA 2QP3A 5DHTA 1U5BA 2OAGA 3RU2A 4GW3A 1M34B 2DBYA 4IQGA 1BS1A 2N42A 3G17A 3PXGA 1QG6A 5CLLA 4TKUA 4EO4A 5AM4A 4QM7A 4P3YA 3V7YA 3MD0A 3WGNA 2DRIA 4OHFA 2FCAA 3KM0A 5GADl 3PC6A 3EMDA 4XWTA 3GPDG 3VKUA 4D5EA 4MUFA 3K0AA 2JHGA 3AHHA 3KX0X 2GX5A 2JH8A 3ZDQA 1H6DA 3HXMA 1K5PA 4M9ZA 1KI8A 3F3YA 1DAEA 3H4TA 3FFTA 4L4ZA 2YVAA 1M2JA 2ZVDA 1UZUA 5DCYA 1YVUA 3RU3A 3ZXIA 2IPMA 2YXPX 1L5LA 5LVAA 1PUJA 3GEPA 4NDNE 1WVGA 1CEGA 1R0SA 2ES4A 4IX1A 3VFFA 3L5KA 3KJIA 1T9CA 1J97A 3LI8A 2WDPA 1AZWA 4PQFA 2R97A 1OH5A 3BWEA 3OZIA 5C37A 4UREA 4C9BA 4OB8A 1JKJB 4TTAA 1WHSA 1UJ4A 2F4VB 4YRBA 1UWKA 4PS0A 4OGKA 5LUBA 1W1UA 3OPYA 4L9WA 4OHRA 4JJ7A 3SWWA 1X74A 2ZRJA 3HBMA 2WF8A 3ACCA 5EUCA 4DLSA 3V5MA 2NUTC 4B0PA 4YS6A 1GADO 1X0XA 1OQAA 5KQSA 1FP6A 4XN2A 4KQIA 3VO8A 5ES4B 1TX4B 3FUVA 2OOKA 3WDLA 4EJMA 4QPNA 3ZWKA 4LJSA 4CT4B 1U3CA 2WGVA 3S0JA 3AFIA 1JJAA 3IJEB 2JKGA 4NE9A 1MX5A 5GZ1A 4YMVA 4MVXA 1R74A 1DU4A 2H7YA 4EEZA 1SOMA 3AP3A 4AY6A 1PFYA 5MFPA 1D2CA 1XKTA 1R0CA 3GRCA 3FCAA 4R2KA 1EROA 1LV7A 4NMWA 3FMVA 5F51A 3UB9A 4MQBA 1I6MA 1URPA 3JY6A 3L49A 1QE0A 4H18A 4A8JC 3KR1A 2AVXA 1DMRA 5BVHB 2SNIE 4I1VA 3GU3A 3DE1X 3RRJA 2I8LA 1KYZA 4URYR 1KBZA 3LT5A 1IN7A 2D5LA 2CXTA 4ZODA 2BFMA 2LCIA 3WQRA 2XMCA 2H29A 4C7OA 3KVOA 3H9BA 3T12B 2D5IA 2FP3A 3A28A 3GWGA 1JDPA 4PXSA 3BGWA 1CSEE 3CAXA 2VJWA 4ZA2A 4ZRMA 4XDZA 2D5CA 4LMPA 4XPIA 3NNSA 5CMLA 5FPQA 4FMCF 1U63A 1VM1A 2KWIA 1TZ2A 2ZSAA 1LV8A 3VHXA 1WZCA 2ZUCA 4LOKA 3GF4A 2Q0HA 3QK7A 5LMUB 3Q4GA 4DRYA 2CFCA 3BFPA 1C50A 2ENWA 4JP5A 4D9GA 1SVSA 1LS1A 4J0GA 1W5AA 2B99A 2P35A 3Q88A 2GARA 2LGJA 3A7DA 4XKJA 4DG8A 3LFUA 2D6FA 3FJ1A 3AEKB 2HDWA 4OJMX 2CL5A 2OSBA 3GUZA 2IWRA 4CTMA 4C89A 3E4CA 4F6RA 2P3SA 3R4VA 4P4NA 4A91A 3NOXA 4WLEA 2BEVA 2QZSA 4UNRA 4GPEA 3NHZA 3T73A 5FI1B 3SC6A 3DEFA 1ORIA 1DLIA 1VLMA 4EARA 1CY6A 4KNWA 3EIEA 3H5WA 3M70A 4L78A 4LWQA 2ARKA 6ABPA 4PM7A 1FCMA 4ZQCB 3CNNA 1MMFB 3QEBZ 4OJKA 4RV9A 3RS3A 1TQHA 2H1HA 5LLDA 1HDEA 2C2OA 4MS4A 1NW3A 3AZPA 3D7LA 2BEWA 2CJWA 3FTQA 3T1SA 3LYHA 2Q9UA 4QJGA 3KJZA 3FSJX 1BW9B 1AQYA 3OECA 1HLFA 3BX1A 5DIFA 4E94A 4GC9A 1S2OA 3BWYA 4CLOA 1VPLA 4LRTB 4M22A 3Q7VB 1VHLA 4MQEA 2VK4A 4ALNA 1P1BA 1NN5A 2DFTA 1UDXA 2VYVD 5FQJA 2BFCB 1C2YA 2YIMA 4C2BA 4PLWA 4IOJA 4FI3F 2CHQA 2GMWA 3LR3A 4EG3A 3H6HA 1ZS9A 2VPIA 2G70A 1ZICA 1TA9A 3K2BA 4QRHA 4HDAA 5HQJA 1LI0A 3OOVA 2H9AA 1D1SA 2KB0A 4HR7A 2OGTA 4MRPA 4YXWA 3MSAA 5JHGB 5DFAA 3SYLA 1AGPA 2FPIA 5C5DA 2RGEA 3IQAA 4KRYA 1ES3A 2HZ7A 4LXXA 5CB4F 4IIDA 2JBAA 3STXA 3SYTA 1C0IA 2IWCA 4F06A 4J0QA 4PHFA 4JNKA 1T0PA 2PAVP 2QL7A 1DQNA 2I1LA 4DR4B 4TKVB 1O8BA 2BE7A 1I3OA 1OI2A 4ZPJA 1LTQA 5LIRA 1QZ3A 2NWQA 2VG8A 2Y0BA 1QMGA 1EVIA 1P0ZA 3TW8A 4WM9A 5CX4A 2FE4A 3R9XA 3EZNA 4K1XA 3PYPA 3BKWA 1EWYA 2G04A 4DIOA 3HM9A 1GUAA 5HCUA 3OFKA 1KZ4A 4HWKA 1SQSA 5HTKA 3HCWA 5B3JC 2AE1A 3A3NA 3DYVA 4OHUA 4NPAA 1V3QE 1VLZA 3RABA 2WNSA 4XQGA 3GLGE 2WE8A 4EHFA 3EXHC 1LRKA 3KTFA 3C3BA 2HPTA 5C7YA 4FC7A 5LQJA 4I2VA 1SHKA 5JXJA 3IEMA 4YLEA 4PBSA 4S2JA 4CKCA 1D09A 4HGQA 4WBNB 1G8MA 1ZHFA 3DDNA 4L08A 3GLQA 2BGUA 3LC2O 1MWUA 4S05A 3IPLA 3UT0A 2QG6A 3B1VA 3DB2A 4N39A 2KSQA 2TMYA 2Q41A 1E2PA 2E8JA 2R8XA 2A9OA 5JISA 1U3GA 4YDRA 2C0QA 1QWOA 1IJEA 2EP8A 2Q07A 3F6SA 4IVRA 4RTSA 4WMCD 3RVJA 3G68A 4J3JA 2RAVA 2AZMA 1UK9A 5GONF 2GM5A 4G8DA 4WVFA 1E1MA 4MIKA 4EY8A 1L7NA 4S2NC 2ZM8A 1ZUWA 3V1NA 1ONPA 4KH1A 1G60A 5DX1A 5CBPA 3D4OA 3OE5A 2J5QA 4U0TA 2IY7A 2VYNA 3VHLB 3R44A 3E8MA 5H81A 2IXFA 3CVWA 4KFTA 1I1HA 5JECA 1O87A 3QVMA 3TLMA 4XQEA 5CNKA 5L40A 2L18A 3B3QA 3GHHA 1EHIA 3QVJA 2ZM0A 2YYSA 3CVJA 3L0OA 4NU6A 5HZHA 2HADA 5CJ2A 4CF5A 2A92A 1O6BA 4RSGA 4A2CA 3TQQA 3RAPR 4D25A 2BR5A 4B4VA 2ZCVA 4DIEA 3VDQA 3RUEA 4HGOA 5J2TB 4GMXA 5EWJA 3G4PA 2B4YA 3WNCA 3ROZA 1QIHA 1CQAA 5JCJD 4ITUA 2QRUA 1T24A 1Z4QA 2QTTA 3D6TB 3WP0A 1UPAA 2AEFA 3GJXC 1NVBA 4IIUA 1EQUA 1E3DA 2XPCA 2Q4RA 4BQOA 2VUSA 1KE3A 3T99A 3MIZA 2AFRA 1Q21A 3WL3A 4ZT3A 3IBTA 2C5FA 2RHGB 1I7PA 5TMPA 2OBXA 4K9DA 3A4YA 2PD6A 4BFVA 3SVLA 3KDPA 1UBHS 3IEXA 1ETHA 1SXHA 3P9NA 4XX0B 4XPZA 5KZHA 5EVIA 1Z8HA 5JO9A 1W36D 1AUPA 3LV8A 3PGA1 1VJ0A 4XUGB 2JIMA 4ZTUB 3NHPA 1U02A 3SKYA 1Y63A 4OXNA 3U31A 2HCRA 4MVJH 1XZNA 4MR9B 4C7XA 1SCWA 3HJGA 3LUDA 1YD7A 3NQXA 2FRDA 3W9UA 1KFCB 1V8OA 2A5DA 3PKIA 2WM8A 2VO1A 4UAGA 1N4DA 4U3JB 4LSMA 3QPDA 5LNK6 1Z8DA 2VTKA 3QWAA 4GP9A 3RTAA 4G5SA 2YWJA 4RA9B 5IEBA 3JPWA 1P91A 2Q1XA 3DZFA 4I1RA 5EKTA 5TVKA 3KALA 1LBHA 2Q4DA 2EYQA 3ND9A 3QPBA 1K98A 3R6DA 5L51A 1Y3FE 3ZDAA 2H07A 2QTZA 4IO1A 3GW8A 1N5RA 3F3SA 4PSKA 3ECCA 4DMFA 1BOFA 2BR4A 4ABYA 4HYTA 1XXHE 1NFQA 4FZJA 2X6RA 2J3LA 1K4FA 2EGGA 4X8HA 1OWPA 3ZLJA 3T4TA 4M2LA 3K7EA 1RADA 3E5HA 4C01A 2VQSA 2H6EA 1C1XB 1FDUA 4UTVA 5K0CA 6CHYA 4XR9A 4PTZA 1TVEA 2VF2A 4ZO7A 4OAPA 4FONA 3UC9A 3A3YA 4PYMA 2GNOA 3IQFA 4CR8A 1BGWA 4X2UA 2ZB7A 3LCMA 1XEWY 1YA4A 2I9PA 3SZ3A 5CUQA 3T3MB 4GAAA 2JIQA 4FJ1A 1DAGA 1W63M 1H2EA 1I7NA 2Q45A 1OW3B 1N9LA 5HOEA 1YXMA 3PRKE 3DKPA 1CQIA 1O9BA 5BV0A 1CVIA 5D7NA 3R3HA 2YMMA 1U11A 4WXRA 4EVQA 2AI2A 1P19A 2PVCA 2WIAA 2AD5A 5DSXA 3NP7A 3L8EA 4G5FA 1E2LA 2GHIA 2I6UA 4MZXA 4P2BA 1KQPA 2BMFA 3BIXA 4JLMA 2IH5A 3NAMA 2Z8YA 4OYHA 3TLEA 4GO1A 1TS0A 1G8JA 4KXWA 1MFZA 3RKSA 4J1TC 1JQEA 5HIIA 4IZOA 4D4MA 4KJZA 4LW8A 2XOKD 3UK0A 3USZA 3AUJB 1Z12A 4YJGB 4BNUA 1R10A 1REQA 4TWRA 4TKMA 2PU2A 2AC2A 2YS6A 1KR6A 2PXAA 5EJMA 2OYSA 1V5IA 1CIVA 1N6RA 4D9NA 3EB9A 4B3TB 3RTYA 1U9JA 2OD9A 2ZIGA 2P2GA 5KU7A 1LZLA 2R00C 3G0OA 2WWTA 3THXA 2FI1A 4BO3A 1SVLA 3I61A 4CMJA 3E48A 2KLHA 3JQ7A 4EF5A 1BHQ1 3VMMA 2WTBA 2PRKA 1SB9A 4Z49A 3GWZA 5BV1A 1OWMA 2WILA 3FYHA 3GXBA 1W75A 1QIIA 4QPCA 3T8GA 1I3LA 1I3NA 4P7KA 1NNLA 4MZNE 2HDRA 1DJPA 3WMEA 3B2PA 3F1LA 4F3CA 1V48A 3EXEB 4TXMA 3IKTA 2KMLA 3OFJA 4DF3A 4QULA 4M0LA 2PH3A 3ESYA 3VDNB 3RRNA 2XNHA 2ZDGA 3HUMA 3W3AH 4EZEA 4ZU1X 3FNFA 3RT1A 4XJTA 3QF4B 1ZKJA 1T1JA 2C5GA 3UT6A 5JSSE 5IH3A 3R7SA 1W4ZA 4RHFA 1RP1A 1L5GB 2CUKA 3HXOA 5JQGB 1DKLA 1VGVA 4PYJA 3RRMA 5IFLA 3V3TA 2VEAA 3IX3A 5BT9A 3ET5A 2O1WA 1R2QA 3IVXA 3OMLA 4CMIB 4DG5A 1MG5A 3KZCA 2IKSA 3HYCA 2KOIA 4HSEA 3H2BA 5KNBA 2WU3A 3KEGA 1LVUA 1M33A 1XK6A 4MB0A 2XFTA 4QGHA 4MRVA 3D2AA 2EATA 7TLIA 1A98A 1E5DA 2O05A 4BNYA 2G1AA 2J3MA 1YB4A 4I19A 3FTNA 3VR4A 1CLEA 4EBPA 3KSMA 3FFBA 1FJUA 2AZXA 1TYEB 1EJ0A 1E62A 4LJYA 1OAKA 3FSGA 4R8VA 1KOJA 2ZT8A 2QTGA 3R6LA 5KMGB 4O2BA 5I51A 3KT6A 2QXTA 2XK1A 3A04A 1STOA 3R0XA 3WYDA 4L28A 2BFDA 3BRWA 1P97A 1X13A 3DPIA 3NGMA 3KYCA 2FFRA 3Q2IA 1OZGA 2QTHA 3TXYA 4X6YA 3RYFB 4HTAA 1R5BA 2ZRBA 4CLXA 4NAHA 4GAEA 3Q87B 4MKXA 5GIOE 4XN8A 4FD2A 4V2IA 4GXRA 2FUEA 2PS3A 4R0NA 4FFPA 1SCDA 4DDUA 2WMDA 5KCZA 3Q8WA 3AU8A 1XCMA 1W581 2PG3A 2XZDA 3GLFB 1TGYA 4PXAA 4Z1OA 1YDWA 2IHZA 4B3FX 1SZCA 5EWMA 1AUQA 2FSPA 1HO3A 4JB0A 1KYTA 1Z47A 1YO6A 1Y6ZA 5KHLB 5FP0A 1HSZA 2RJNA 4JI0B 5GJCA 2P3LA 1Q0LA 4F85A 2YX1A 4I9UA 3C4OA 3USES 1A1SA 4MWZA 2OP0A 3LCUA 4BNDB 3QSGA 3REFA 1IY9A 1P9OA 3OJOA 4ZP1A 1A9PA 4JIMA 2JDIA 2R68A 5IG2A 1NMXA 2VCYA 3IHWA 5EQDA 1NJ8A 1AV7A 5EEGA 2J9ZB 2H2FA 5KYTA 2HP5A 3WS2A 1Y81A 2PMWB 4BVHA 1G0NA 4DDMA 5J5CA 1GKYA 4OHPA 1PZPA 3L7YA 1FQJA 2IBSA 1VXOA 1OI4A 1GTJ1 3KEMA 2JKZA 1JF8A 1GW6A 3CO0S 1O97C 1IBRA 3L7HA 3RGWS 4S2KA 1UBJS 4FE3A 3TNDA 3HREA 1T0JB 2P9VB 4QNNA 1Z39A 2FHSA 1PVDA 1QO0A 3RC7A 2ADMA 1NMEA 3W7VA 1GPKA 1VKZA 2NQ8A 2D02A 4IDNA 4U2DA 4ZCIA 2B18A 1OR8A 2HDSA 1DPGA 3ZE2B 4UUPA 3R7FA 5AK0A 1F7UA 1P1IA 4LUCA 4IHJB 2ZAGA 4EUZA 2O5VA 2RONA 1EQAA 1B0PA 5KKCA 1Q0RA 3H9CA 3NAQA 4S1NA 3OUZA 3WTBA 1KNQA 1OYYA 2PAAA 4YAIA 3V6MA 2B8NA 2IEYA 1QCCA 3PNLA 5L7TA 1EWRA 4KUEA 3GJYA 4BVGA 2GPYA 1RC0A 4QXOA 5KYYB 4I50B 2JH3A 4WK2B 1DDOA 2GZ2A 3DOOA 1ES5A 2Z6AA 2OZKA 1EUQA 4I66A 3QIAA 4FUTA 3UV3A 4HT3B 1J8VA 4GYWA 1XROA 2NM0A 2Y2MA 5H3HA 1XQ6A 2H9IA 4V0KA 4QGGA 4Q66C 3ZJYA 1MKIA 4EP1A 3E22B 1S4RA 1LC3A 5KTNA 3K0SA 2Z5FA 2ABWA 2XMDA 2AFHA 2DLDA 3HPRA 4GLJA 2Y1WA 3T4UA 1SVOA 1JI3A 4WNAA 2Q3BA 3U4QB 3H5RA 2HIHA 3HJHA 1XZJA 2RGYA 4F9EA 4BYMA 4IHAA 2F4NA 3NAZA 4CUZA 1TYBE 4C05A 2W3HA 4X5OA 2HLDD 2BDUA 2GTHA 4ZGGA 1LF5A 4JJEA 4BV3A 5HJ7A 1TW2A 5DTJA 3WL8A 3WB0A 1HQKA 2W2XA 2XEDA 1GGKA 3EVGA 4AP9A 5DASA 1ZONA 2O8FB 4KXXA 4TZ6A 4KKXB 3A9UA 3GO4A 1QQAA 2XECA 4CG1A 2CYAA 2XR0A 3B6EA 4X1IA 1RJEA 2R25B 3AIOA 5HKKA 2ZWMA 3LGSA 3NHYA 1RI2A 5BSKA 5CA1A 3L6UA 4KHZA 3B3FA 3RBVA 4BFWA 1GILA 3KE8A 4X6UA 2PGAA 3BFDA 4XM1A 3P2KA 5G41A 4Q4JB 3IILA 2VOJA 4HAUA 3C3PA 4YRCA 3WRYA 1NBMD 2ZRFA 1W88A 3IXDA 2VJYA 3EXFA 4FLFA 3K8ZA 3G2HA 4KWIA 1EWKA 4OHWA 3K4QA 5I9TA 1GEGA 4J9UE 4WASA 1YKFA 4QDZA 1UXKA 4PPRA 4IMIB 3VNVA 3PUVA 3CQ9A 1GPMA 3HNRA 3LUJA 1OC2A 5B4UA 3NVAA 4Z2AA 4MLDA 1W29A 1XNHA 4ZARA 5E2GA 4F3YA 4EMTA 3TEFA 2Y2QA 3MB8A 2YN2A 2LVBA 4HTFB 1MZUA 3AQ4A 1TJ3A 1L5RA 5KQGA 4P34A 3S2YA 2V7EA 3G31A 3R3VA 3N8GA 3AF5A 3T41A 3R0JA 1PGQA 4BJ6A 1BDMA 1O1YA 1QU3A 2JGDB 3G85A 1Z0KA 3PQCA 1Z0ZA 2V0NA 5FADA 2NNWB 3G9QA 2R9XA 3R75A 4EHAA 1QVRA 4YHBA 4U9IS 5KYWA 1GV0A 2EHJA 3LCCA 3ZDRA 3E2KA 2Z5GA 4HX9A 2C4HA 4WZ9A 5DJUA 1PHPA 5F7XA 3UJNA 3EZGA 5CGZA 4B4DA 3ZZMA 3GT4A 3A4NA 2B25A 3GROA 2V7VA 1USWA 2CMFA 5TV2A 3HV2A 4KO1S 1WXXA 3C7TA 3P71T 3X2SA 1C8BA 2I03A 2PUGA 1HRKA 3DEHA 2FB9A 1KJIA 1R0BA 4IP0A 4IVIA 2BFFB 1NF3A 3LS7A 1KYWA 1T8RA 3I6QA 1FLAA 3P98A 4LQCA 4OPZA 5DX0A 4W7IA 3M6BA 1Q44A 3G1UA 5D3KA 2GUWA 4K0WA 2WYWA 1JG3A 1ESDA 2HA7A 1TF7A 4UMVA 3WFJA 3IE2A 3OICA 4JJKA 1IG0A 1XZLA 4LFUA 1ZI6A 1N0WA 4B81A 4OQIA 1EWQA 2XWPA 1RBYA 2P9GA 5BSWA 5A7FA 3O2QB 2FW1A 3FPCA 3K09A 3V5NA 5ALRA 4BD1A 2AEJA 3COWA 5ALQA 4Q4AA 2H1RA 2K2NA 2H1WA 3GHYA 4KO4S 1S4MA 4IVPA 2OHOA