4IHQA

Archaellum assembly atpase flai bound to adp
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
512
structure length
512
Chain Sequence
SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILLRMRLSVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKFSRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGAIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
molecule keywords FlaI ATPase
total genus 165
structure length 512
sequence length 512
chains with identical sequence B, C
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ihqA02
3.30.450.370 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ihqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ihqA03
2VIIA 2AWOA 1TTTA 2CL6X 1DOAA 3B60A 5SZIA 3SOPA 3IBYA 4E03A 4BFVA 3K0AA 3ZS8A 4I1OA 4GZLA 1GL7A 1OV4A 4GMXA 4LYAA 4PX9A 1GITA 1AA9A 4JSTA 3AVUA 1NY5A 3AKEA 1S96A 3LQRA 5BN3A 4LV8B 2W0SA 2JCSA 3P32A 3REFA 2GESA 1UBEA 1KSJA 3EXAA 1N6KA 5HE8A 3GFPA 4K8OA 1GZSA 1IAQA 1G3UA 2NOAA 2VTKA 2VQSA 4WIAA 3T35A 3G0HA 1YR8A 4P4SB 2B92A 2H17A 1OIWA 3B1YA 2J9RA 2QI9C 1L8QA 4KLNA 4QFMA 2ZI7A 4CDGA 4S35A 4W5HA 2RGDA 2YC4C 1ZM3A 4D4JA 1HQCA 2WVJA 3AVQA 2OESA 4AKHA 1XD8A 4RZ3A 4CYMA 1R5OA 1SVOA 1TL7C 3MD0A 4G0NA 3CM0A 2WJVA 2AD1A 2CBZA 1OXSC 1UM8A 1YZNA 3EX7C 5FBLB 2QAGB 3I5YA 1G6HA 3VHLB 4Q66C 3VFDA 4KVGA 5JRJA 4L9WA 5LBIA 2D06A 2GEDA 2ZJBA 3QPVA 4QGAA 3P1JA 2ZJAA 3WXMA 1ZM4A 5L3RA 4ZI3A 2ZM5A 4FINA 3QVVA 3BERA 1XJ0A 3KKNA 3IIKA 4WOPA 4Q21A 4UXHA 2QSYA 2RGBA 1CP2A 2IUUA 4EPXA 2F9MA 1P9NA 2QRZA 4JLAA 4AK9A 4GI7A 1LS6A 2CE2X 1XEWY 2VYFA 5G40A 2IWHA 2XGJA 2WJJA 1HH4A 2P6NA 2D2EA 4D4LA 1ZC4A 1U8ZA 4LHWA 2R6DA 3MWYW 3FKQA 4NH0A 3PFIA 4TMVA 4D0GA 2DFTA 2VP0A 1TEXA 3LWNA 1R0YA 3LAWA 1VG8A 3H0KA 3PVSA 3ZZUA 5DH9A 1HE8B 3FFBA 1YZUA 1X8JA 2HF9A 4HUQA 3AP2A 3KB2A 1HTWA 5JCPA 4M1SA 1B0UA 1R4AA 2YWHA 1XNJA 1TUIA 3PENA 3R7WA 4E07A 3BIFA 4QBGB 4DEYA 1QHSA 1E94E 3GFOA 2BMEA 5EUQB 1G5RA 1NN5A 2Q3MA 2YWEA 2WKPA 1JEDA 1W0KD 2W6ID 2R6GA 2WJGA 4KV9A 4US2R 4Q1EA 2FZLA 4BFZA 2GJSA 2A5JA 1NKSA 4U00A 2IS6A 4Q4AB 1U9IA 4TT3A 2IX3A 4JL6A 3CIOA 2GETA 1E98A 1KK0A 3GCGA 2PZFA 5FTNA 1W36D 4DCTA 3CRRA 5D3QA 4RFVA 3L0PA 4A82A 1VG1A 2QY9A 1ZUHA 3AB3A 1D5CA 3NWJA 3RVBA 3BRWD 4FCTA 4CT4B 3RRNA 2WBLC 2ZRFA 3SI7A 2FF7A 1M74A 1OJLA 1AK2A 2H1LA 1SVIA 1CU1A 1Q57A 3IKJA 1Z8FA 4PHHA 4TQUS 4PQYA 2PX0A 1E9SA 4M1TA 1G8YA 1P61B 1EK0A 2XTZA 4B47A 1OKKA 2ZE7A 3AKDA 2A5GA 2W58A 4P31A 4B73A 3PUVA 1LW7A 2NO9A 3W8RA 1U8YA 3WP0A 5BQ5A 2JIZA 3PJRA 1IN8A 4XWOA 1M7HA 4XSGA 4LZZA 1HT1E 5FTKA 1ZAKA 3ECCA 2FPLA 4TLEA 1G3QA 4BEJA 1WB9A 4JVSB 4QC2A 4PO1A 1LS1A 4FMDB 4Q1AA 1OYWA 2DWPA 1OFIA 4C3ZA 3FE2A 4AYXA 1VDZA 2OEPA 2Z0MA 4TL7A 4R2IA 2XZPA 3WP1B 2IHYA 4Q03A 2DR3A 1K5DA 2P5SA 4PSKA 3ZIAD 1YR7A 2ZTSA 1P2UA 2C2HA 4ZIRB 3KUCA 4HUQB 4ZCMA 3MCAA 2W0MA 3QEOA 1CKEA 2OBNA 4DT1B 2FEMA 3BAFA 3CONA 5FPTA 3GP8A 4OI1A 2D3WA 4M9ZA 4TMTA 4PC3A 3EIEA 1EFRA 4DLUA 1G7TA 3KFVA 2FEOA 4DDWA 1TF2A 3GLIE 3HPRA 1UPTA 2WJHA 3IIMA 2FSIA 3EZ6A 4GL2A 3CNOA 3EA0A 1G41A 4LJ4A 3TW8B 1JR6A 4W5JA 1XCGB 1Z2CA 5KU1A 3PEVA 3K0FB 2WIBA 3ICQB 3CW2A 4B3FX 4KSCA 1GRNA 2CHGA 1E1RA 1N0VC 3JVUA 3PUXA 4GT1A 2H7VA 1HQYE 1KI4A 2BEKA 2QBYB 3QKTA 2IXGA 1JXOA 2JDID 3MAAC 4MGIR 1E0JA 2CL7X 2FG5A 3ADBA 2ZEJA 2ZRJA 3B13B 1EFUA 4HYYA 1PLLA 2E9SA 2QP4A 1JJVA 4O0MA 5HKKA 3U6KA 4Q1BA 4RD4A 5TY0A 2AFHE 1Z6TA 1I2DA 2GCOA 4JJZA 2J87A 3A36A 1NVXQ 1W2GA 2HCJB 4PANA 1YZQA 1Q1ZA 2HJVA 2PBRA 3G82C 5HR5A 3AM1A 3AVWA 1R0WA 4HZIA 1MR3F 1RRCA 4D25A 4YMUA 1G291 1AZTA 5CITA 2CVHA 3X2SA 1X8KA 1CRPA 4PC6A 4PPNA 5M04A 3BBPA 3B85A 2JJ1A 3THOA 3DKVA 2WJYA 4DDTA 1E1QA 5DIFA 3WNCA 3RRZA 2QG6A 3BFVA 3VNVA 1JALA 2YOHA 4UXJA 4L5BA 3LV8A 1T3SA 3LLUA 5TB5A 1BOFA 3X1ZA 3L82B 3U6BA 2WHXA 3KQNA 4I1UA 1E2HA 3MSXA 1JJ7A 3A4NA 2P6RA 3UATA 3GEIA 4JVNA 2R65A 3M4YA 4MGKR 3A4MA 2D74A 1EX6A 3RHFA 2QQEA 5EXPA 4Z8YA 3UKDA 1S8FA 2QPTA 3I73A 2UVQA 4IVRA 4LWZA 4X8LA 1GP2A 2NIPA 2AFIE 3ASZA 4OQFA 3IEVA 3LNCA 1YVDA 3F5FA 1A1VA 2JLVA 3NG1A 1NMXA 5HZKA 1NN3A 3KKPA 3SNHA 3UG6A 1SKQA 1U0LA 3H84A 3AP1A 3IILA 3K0FA 4JKIA 2VHQA 4KODA 4URZR 2VHCA 3TNFA 2W6JD 2FOLA 2QT1A 3DZ8A 4A9AA 1P3JA 3C5CA 1E9EA 3ASYA 2QENA 4LOAA 1KSGA 2XB2A 2QP3A 4OJQA 3KKQA 1CF4A 3RS5A 1TAGA 4AURA 1NNEA 4I99A 1DG3A 4OHZA 3A1UA 2GNOA 3TH5A 1YRAA 2C99A 1BS1A 1Q1QA 2HXYA 1ELOA 1XEXA 1TQ2A 2WM9B 3O8RA 3KQUA 3SQXA 3FFAA 1H8EA 4KFUA 5E7IA 2C9OA 3WHKA 1WDTA 1DVRA 3DZDA 4ZCLA 4YLGA 2DPXA 1R8QA 2HJGA 4Q9KA 4RD1A 2QAGA 2ZETA 5EP4A 2ZJ8A 5JJIA 2ZAOA 3WNDA 3EW9A 3UIEA 4L4UA 5C1BA 1WBBA 2R6FA 4NDZA 2P0EA 5CDFA 2J3EA 3CR8A 1UKYA 4JBWA 4C7OA 2IW3A 4MYCA 4CEIB 4DIDA 5FOTA 4PC2A 2P5TB 1W36B 5KDDA 5LD2C 3GLFB 2EVWX 3LBHA 3R9IA 5FFMA 2OUKA 3AP3A 1RIFA 5J4YA 1GILA 4BFTA 1E69A 1N5JA 1ZC3A 5J40A 4QXAA 3GLHA 5DO9A 4EQ6B 5EZ6B 4NYMQ 3T1QA 1UEIA 2IT1A 4IVPA 4AD8A 1Z22A 5AUNB 2AR7A 2FFAA 3FB4A 1KHTA 1KO4A 4B3BA 3LO5A 4U5XA 2A5FA 3CRW1 2XB4A 4CZ2A 4P0TA 1U2RA 5JJKA 2WOJA 5AWFC 1JB1A 2FSFA 2O8EB 1GRQA 3PCRB 1ZUNB 3M0EA 5D3MA 3KJHA 4IDQA 1WXQA 2JIZD 4ZDIA 2AXPA 2K5UA 2GAOA 1KI2A 1UJ2A 1TQDA 1F2TB 4TLAA 1LB1B 5G41A 3EZ9A 2CHQA 2EFDB 2ZRLA 5E4FA 3OESA 1UBCA 1KYIA 3QQ5A 4NKRA 3IPXA 1ZCAA 4D6PA 2QL6A 1YJ5A 1P5ZB 2WSSD 2GXSA 3QY0A 1YZTA 1A5TA 3NEYA 1G8GA 3QBTA 4ZI2A 2FMXA 3QXJA 1R6BX 1I4DD 3QKUA 3U3OA 4OQNA 1CXZA 2D7CA 3WYFA 1DPFA 2J0UA 5CM8B 1NLZA 2DCUA 3KUDA 2CXXA 3PIRA 4QHSA 1GKUB 2EYUA 1II8A 2WSMA 4PQFA 4LYHA 1FP7A 4M21A 3U7FB 4RCYA 2BBOA 2P67A 2ODEA 3VX4A 5JJLA 3GEHA 1F48A 2WAYA 2YINC 721PA 1OIVA 1T3HA 3PUWA 1E2NA 3IBGA 1P6XA 4BZQA 4DCUA 3CBQA 2QA5A 1T0JB 2NTYC 4OHVA 3BORA 2ZIAA 3OIVA 2CK3A 2G77B 2JJ8A 1EFTA 3AGQA 3GFTA 3RAPR 3AVYA 4RFSB 3GQBA 3BXZA 2VP2A 4XD7D 5EXXA 3KKOA 1T3LA 4BLRA 4RZXA 4IDHA 2WWFA 4QGFA 4DUGA 2L0XA 4FMBB 4NYJQ 5JHGB 1KZGB 5K8IA 4QGHA 1FTNA 5BXQC 1SVLA 3KJEA 2IYQA 3D7MA 2ZRAA 1E2MA 2HT1A 5KUTA 4JKYA 4KYIB 3I72A 4URWR 5BN4A 3E5HA 3BOSA 2P3SA 3WRXC 2IS4A 4JVLA 4Q1CA 5J4LA 1TF5A 1H8HD 2OM2A 2FPKA 2ZRHA 3SJZA 1E9AA 1JPNA 3P27A 3OE7D 4Z8XA 4AWXA 1FTSA 2ZXUA 1CTQA 3OE7A 2AN9A 1UBGA 1F2UB 1LTQA 2WTUA 4S2EA 1X1RA 3UMRA 2WAXA 3TMKA 3U3MA 2OCYC 4Q18A 4ZDJA 3VNUA 1K8RA 4PHTA 2ZU6A 2GZDA 1IJFA 2PJZA 3CZPA 2JJ1D 1DS6A 3DKPA 4IW3B 2NZ8A 1GL6A 3I8SA 4YQFA 1KMQA 1F3OA 2FFHA 1KDRA 2XX3A 3T06B 5GVSA 2ZR0A 4PSVA 1IXZA 4N3NA 4BPBA 1NL3A 3TR0A 2FN4A 3TR5A 3I61A 3NC1C 2RH5A 3EC2A 2ZSEA 5JI2E 2EYQA 2WWGA 2YOGA 5JRZA 2G88A 4WBSA 1P2TA 4NCKA 4RFSA 5IHPA 4IOLA 1EWRA 1Z07A 2VP4A 1WBDA 4FWIB 1G3RA 3IUYA 4LJ8A 4NHOA 2Z83A 1DAFA 4LDJA 1QHYA 3SS8A 2C95A 4OYHA 2IYYA 4MRPA 1SXJD 4F7WA 2OE2A 2QZ4A 4RD0A 1JNYA 3C14C 2MSEB 2GXUA 2WPDA 2LKCA 1QVAA 2IF0A 4AI6A 2ORWA 2HLDA 3WBKA 4A0FA 2F3RA 2Q9BA 3NEJA 1XTKA 4P4UA 3TSWA 5HZHA 2JJ2A 2VSOA 2GCNA 2BM0A 2IBMA 4G5SA 3AGPA 2ZJYA 3QXSA 2ZRGA 5DI3A 4IVQA 5GJWC 3FVQA 1G9XA 1E4YA 5FUVA 3AF0A 3RC3A 3TKLA 5K8LA 3KQLA 1ZM2A 2QMOA 3QI2A 4QBHA 2VP9A 4Y0AA 3PUZA 2DFKB 1Z0IA 3CX6A 1D2NA 2BHRA 2R8RA 1R2QA 2O52A 1SXJE 2EWWA 2OXCA 3MJRA 3T1OA 4A2WA 2ZRCA 3GJ6A 3SHWA 1OXTA 1YU9A 1ZIPA 2C98A 2QP9X 2WSSA 2PEYA 3C4JA 4UQOA 1RYFA 4NYJR 1W4AA 2D4HA 3QPWA 1KI9A 1NRJB 3BB3A 5LDDC 2BBSA 3SBEA 2OILA 3LDAA 3BK7A 3K0SA 4RD6A 1KNXA 1DG1G 1SXJA 1GWNA 4YMVA 4II7A 2PCLA 3FHTA 3TLXA 2Q9AA 2RCNA 1P62B 1GM5A 2N46A 5J4VA 1XTRA 3FMPB 2KJQA 4V0NA 3AF2A 4LBYA 1X86B 1BYIA 2XAUA 2WPDD 1EESA 1ZU5A 2BCJQ 1W44A 3OZXA 5B58C 3CH4B 3N2EA 3X1XA 3N2IA 3QJYA 1NVVQ 5ELXA 3W5IA 1E79D 2ZSBA 3IQWA 4DEXA 2ODNA 1YQTA 3U7HB 1XPUA 2GCPA 3B82A 2H8KA 3MWLA 2PMDA 5BN5A 3C15C 2BVNA 3ND8A 1FMJA 4Q9HA 4R71A 4AY2A 1GNRA 4QOSA 1Y3AA 4NBSA 4NYIQ 2JASA 5IT5A 2O8BA 2ZI9A 3SU8A 4D4MA 4IHQA 4MKFA 2ZE6A 4LPKA 2QM8A 1Y63A 3LXXA 4TT3D 2X19A 3NH6A 1TUEA 1VYUA 3BWDD 3ADDA 2IYSA 2FDCA 1ZIOA 1VIAA 3RSOA 3FGNA 1Z28A 2IWRA 1W48A 1XEWX 2ZUDA 4A8JB 1KI6B 3LLMA 4MUBA 1F6BA 2B21A 2KI5A 4HAUA 1MO4A 5FL7D 5C2JB 1N0UA 3HU2A 5FBQB 1NKTA 3FWYA 3EG5A 4JLMA 4DLVA 3NIBA 4FN5A 1N6NA 4EFMA 5FPSA 3RLFA 1XDBA 3GLFA 1IJEA 2RGNC 4GPTA 3ZDQA 4AYTA 6Q21A 2C9YA 2ZI3A 3LA6A 4X8HA 5JSZA 4NYMR 5B2ZA 4XWAA 3THYA 4ESHA 4EJSA 3TIFA 3ADKA 3D6TB 2GK6A 4HB0A 3VQTA 4DUGD 4CEJA 3T34A 3ZJYA 4LC0A 4TMWA 4BLOA 1AQUA 1SXJB 3KL4A 1O87A 2GBLC 4RD3A 2QROA 3W3ZB 2B7BA 2PJRA 3L0OA 2LWIA 2GEVA 2WIAA 3L0SA 1E2JA 5AJYA 4B3XA 2O8CA 2CDNA 1UDWA 3DM5A 3S1AB 4F4JA 4PO9A 4A92A 5FPKA 4DSOA 4IFEA 3EWSA 3QF4B 4TQAA 5FOSA 1OIXA 3FDIA 2QORA 3FYHA 4G01B 4DCVA 1FMLA 4OKSA 3IO5A 2OBLA 2GZAA 2ZI6A 3RDPA 4V0OA 5C4MA 5CDFE 2ONJA 1Z2AA 5E3HA 4EUNA 3PR1A 2EW1A 5HKKD 3I92A 5JECA 2WKQA 1FNNA 1GOTA 1T0HB 1YZLA 2BEJA 2J0VA 2GF9A 4C2TA 5KDOA 2EQBA 5BYKA 2HEIA 5P21A 5CJPA 1XTQA 2PZGA 5FPHA 1ODFA 5H68A 4Q4JA 2ZRMA 2R62A 4CIDA 2N1BA 5EXSA 4ITRC 1CJKC 3T12A 2A7QA 4K46A 4IEEA 2QMUA 1IXSB 2P65A 4E5UA 4A6XA 1MRSA 4B3DA 3ZIAA 1DARA 3TUJC 1IN7A 2ECKA 3E70C 4N1AA 3SR0A 4N0DA 1G1MA 5DN6D 4RSGA 2F1IA 1M7BA 2ZSAA 4RZ2A 1ESMA 2O8FA 1VTKA 1WE2A 2JLQA 4QRHA 1DEKA 1VIYA 4PQRA 5EP1A 5TXGA 5KHOC 5JCZA 1G5PA 2HYIC 3JZMA 2KWIA 1E9RA 2ZSFA 4W5WA 4CEHA 1CJUC 3PITA 1COWD 4HAWA 4PAOA 4N0EA 3N5CA 2BJVA 4DLRA 3A1WA 3W5JA 3TUIC 2P2LA 3T5DA 2V54A 1U98A 2AK2A 3W9YA 3LY5A 5GJBA 4JYBA 3Q85A 1E79A 1Z6YA 2W2VA 3K09A 4O2LA 4V02A 3M1IA 4RJLA 4JLBA 2O8DA 2QRNA 5FL3A 2ZI5A 4QJ4A 4CVNA 2CE7A 2V4ZA 2JLRA 4DDVA 3RRYA 2YWFA 4YMTA 2A3RA 5DHFA 2VHJA 3EPKA 3IHWA 1XEXB 3K9GA 3NXSA 3LD9A 4DJTA 4DLSA 2IYTA 2IYVA 2CCJA 4LYFA 3QKSB 1OB5A 4HDOB 1I2MA 4YC7A 1KJYA 2ODWA 2WICA 3AKCA 2CNWD 1Z3IX 4BFYA 4QG7A 4F91B 1DAIA 4HB2A 2R2AA 3TJZA 1Q0UA 4OBEA 1KK2A 4JLPA 2WWHA 2ZJOA 2C03A 4L8GA 3U2QA 4OQMA 3AKYA 4M8NE 4B6EA 2XEXA 1OFTA 2PT5A 1E2GA 2PX3A 1OF1A 4QBIA 3QKSA 1ZBDA 2IS2A 2PZEA 5B64A 3PQCA 5LB4A 1X1SA 5FPYA 2OG2A 3QKRA 4JS0A 3KXLA 2E1RA 3DM9B 4TYQA 2DFLA 2ZRDA 2HYDA 2PH1A 1AZSC 3L0IB 4F38A 1JPJA 3AVVA 1HV8A 1R8SA 2H5EA 1Z6GA 4B34A 4RY2A 2WMOB 1NIJA 1BMFA 4PC1A 4OI0A 1XTIA 1E6CA 2ZJ2A 4B75A 4QKQA 1Q22A 2NGRA 4Q4HA 2ZYVX 3QPUA 2V55B 2W6IA 3FPAA 1YE8A 1ZMXA 3CRQA 2IYLD 5EE0A 1NVWQ 4TLBA 2FZ4A 1JR3A 5TDHA 5AJXA 4KVAA 3CWZA 2J0UB 1KY3A 3GJ5A 4AG6A 2X77A 5JHHB 3WMFA 1ANKA 2GJ8A 2CEAA 2YV5A 4TLDA 5KOYA 3TVTA 4JBYA 3C8UA 5F9FA 3WMEA 1OH8A 2QU8A 2V3CC 2G3YA 3NTUA 1VPLA 5CB8A 4LYJA 3SDZA 4PXAA 4TTQA 4XH9B 4H1VA 5JS8A 2UZIR 3QEJA 4QL3A 2JATA 2FH5B 4AIIA 5JBQA 2UKDA 2V9PA 4C9BA 5IRCD 2OT3B 4LJYA 5L3SB 2OXRA 3ZZ0A 4PZYA 3NDBB 4W7SA 5J4HA 3TQCA 3LBIA 5DLQC 3U7EB 4QM7A 4FXPA 4GMDA 1TX4B 2B6HA 3THWB 3IO3A 2Z43A 1US8B 3LXRA 4Q1FA 3LFUA 3HPQA 1NI3A 4BQSA 1U8AA 1WCV1 4TYYA 1QVRA 1P9WA 521PA 2RGXA 5L3SA 2I1VB 1W5TA 5TARA 4PR0A 4V0ME 1E2QA 2AD5A 3RWMB 2W2TA 1TADA 2DBYA 3R20A 2X1VA 1V5WA 1E2IA 2XTMA 2QTVB 5KPJA 1AQYA 3MRSA 1II0A 3CPEA 4G1UC 1QG2A 3T5GA 3P20A 3SFZA 421PA 1CR1A 3TQFA 3V4RA 1M1YE 2ZREA 4TMXA 4B3CA 3A1SA 3QVUA 3CF6R 4B2PA 5GVRA 4DB4A 4GDFA 1A4RA 2YHSA 3D8BA 1NF3A 4NZYA 4EAQA 2BWJA 2ERYA 2JAQA 3K70C 1ZNWA 2GBLA 3EZ7A 4TL9A 5L8VA 2ZE5A 2GWHA 4CT5A 3OIWA 1AM4D 1GFIA 2XOKA 3ADCA 2EFHB 3CKLA 1D2EA 2EFGA 5F98A 1D2MA 3DO6A 4H1UA 4M53A 1ONBA 4PAMA 1E9BA 4C0HA 1LFDB 1U94A 4ZDKA 3QG5A 4XVUA 4M22A 3C41J 2ORIA 5FOWA 2VHTA 3SN6A 2Y8EA 5GADl 4YONB 3UANA 3GJ8A 3RWOA 5DHAA 3W34A 1DAHA 1OH7A 221PA 4FD2A 5B57C 3LVRE 1AS3A 3WYAA 1UKVY 3HU3A 2FA9A 4A8JA 3C16C 3SYKA 1G19A 2NPIA 2ATVA 2IK8A 2PLFA 4L16A 3IPYA 4IOMA 1UKEA 2QUZA 4Q7MB 4J0QA 4B35A 2YJTD 4BEBA 1KGDA 1E2DA 2JJ2D 2IHBA 3BE4A 3GJ0A 5A5GA 3NC0C 3DMDA 4XIGS 3W90A 3BB1A 3W8NA 1ZYUA 2XSZA 1EWQA 3TK1A 2IUSA 1QDEA 3THWA 2F43A 3KXKA 4V03A 3B8HA 4URYR 5AJVB 2AHOA 1P73A 4GOKA 4NCJA 3WBJA 1G7CA 1XZQA 2QT0A 3NHAA 4OQLA 4RKEA 5FBRB 1GUAA 1WMSA 2NZJA 1L4UA 2KBFA 2C5LA 4G5GA 3THXB 4A15A 1N6OA 1Q1BA 1N6IA 1XD2B 2ZS9A 3BH0A 2F43B 4PC7A 2WKRA 3R8CA 2HDNB 2IYXA 4A2QA 4XSHA 4BLSA 1C9KA 4I1SA 2GTPA 1CR2A 3HU1A 1T91A 1KKMA 2Z5FA 3NHBA 1H65A 3HR8A 2VF7A 2N42A 3SQWA 1KOFA 1KMHB 1Z0FA 1RC8A 4BRWA 5H8WA 1HT2E 2O8BB 2REOA 1MO3A 2GCOB 5JI3E 4LUCA 4BLPA 3EASA 3WYGA 1XD2A 4HAYA 3GJXC 4HZUA 4OK3A 4MH0R 4Q02A 4R9UC 5CIWA 1UADA 1E3MA 4PPQA 2VHUA 2XNDD 3CPJB 3E1SA 4O2RA 1UEJA 1G8HA 2AXNA 4OL0A 1NJFA 1QBKC 5K8TA 4IDNA 5KYKA 5DSZA 5JZVA 4HB4A 4Q4JB 4TTPA 3VAAA 1G6OA 1AS2A 2VEDA 1IY1A 2VPPA 2ODBA 4EDHA 1QHXA 1MT0A 3ZGXA 1W1WA 1Q20A 4TWZA 5CK4A 5DYGA 3L43A 3CH5A 4U02A 1FUUA 3THXA 3AVPA 2J41A 4JT2A 2WWYA 4AKGA 4ZV4A 1RRGA 4LJ5A 5FR1A 1JBKA 3GJ7A 2JLWA 5BWMA 2FV8A 1H8ED 4BWYA 5KTYA 1L4YA 3UPUA 4BRUA 4W9MC 3LVQE 5CLLA 2X2FA 4NYIR 1KSHA 3DOEA 5LD2B 1HY3A 1SVSA 2BCGY 4PO8A 1I4TD 3B1VA 4HATA 2OCBA 3EPHA 4YXWD 1KI7A 3K8YA 2I4IA 4QM6A 1E9FA 4F93B 3TGPA 1JI0A 4EFNA 1AIPA 1XMJA 2EU8A 1G4AE 2ZJZA 3VKHA 1I4LD 2WV9A 3TRFA 4WXPA 1BIFA 4D0NA 1A2BA 5E95A 2IL1A 1G7SA 1NVVR 2JLSA 3X1WA 2FSHA 3O47A 1W5SA 4ACAA 2WWXA 1P7CA 3FKSD 4DSTA 1VCOA 3TW4A 1KK1A 4M0LA 4KBGA 1FW6A 1P2SA 1FL9A 1NBMA 1J8MF 4M2LA 2ZR7A 4IDOA 4POAA 1AGPA 4UNRA 1DO0A 4LBVA 1SZPA 4NE2A 4ASUA 1ZNZA 4MGYR 1KI6A 3ZQ6A 1ESNA 1W4CA 5FR2A 1E9DA 5BYJA 3PXGA 3BFKA 4DSNA 1QHHA 4FIDA 3SBDA 1KSFX 2JLYA 1HURA 1Q3TA 3DDCA 4JZKA 1SHZA 4EKDA 1J99A 5FBWB 3AV0B 1LF5A 2RGAA 1NJGA 3B78A 4Q4AA 1ZD9A 1PLJA 2YVUA 4GRAA 1GDDA 3RC8A 5CM9C 1N25A 2I1QA 1NBMD 1IQPA 3CRVA 1S1CA 3KTAA 3MGCA 2ZRNA 1CJMA 4MKIA 1XTSA 4M4SA 5HCNA 2HV8A 3W6PA 3WHLA 1WQ1R 3GLGB 2OFXA 3FOZA 4B74A 1HEIA 2NO1A 4EPTA 3U44A 5G53C 1OXUA 2YOFA 4JIMA 4LK2A 1MABA 2JEOA 1XXHB 3W3AA 4O25A 3TSOA 1VMAA 2QEQA 1E2FA 4HSEA 3LW8A 1PJRA 2IYZA 4A8JC 2G1KA 3T61A 1MH1A 2NG1A 3AF4A 1S3SA 3CB4A 3L8ZA 5EXTA 2O8FB 4A1FA 1U9IC 3FMOB 4BE7B 1S2MA 1VHTA 3R9XA 2JA1A 1G8FA 1QHHB 4NTZA 1AS0A 4CW7A 2DY1A 1WP9A 3U3RA 4UKDA 4B71A 1CRQA 2QQ0A 3VTKA 4CF7A 2IYUA 1LY1A 4YMSA 4JSYA 2C04A 3W6NA 2ZI4A 4LBZA 4DLXA 1YRBA 1SQ5A 4TMKA 4C4PA 1R5NA 4URUR 2GDJA 4C30A 3RRMA 3V00A 3K9HA 4FI3C 1XMIA 1EX7A 4DCNA 1E96A 2FJUA 1Z0DA 4LHVA 1MO6A 1T5IA 4EPYA 1XPOA 2IEYA 4TTRA 3QBVA 3OIYA 2NO7A 2RGEA 3MG9A 3MLEA 4LV6A 3GLGA 1Z0KA 2VA8A 1Z63A 1BMFD 2QSZA 4EPRA 3AVTA 4NU0A 2X8AA 1U90A 1JAIA 2IYRA 4M9QA 1E4VA 4Q47A 2BKUA 1SKYE 4V0MA 4D4KA 4KCGA 4LCBA 4GP7A 1S3GA 3TBKA 3JZAA 2KBEA 2ZRKA 3LX8A 4LX0A 4GZMA 1RRFA 1ZVQA 4RCZA 1NN0A 1KZ7B 3SJCA 1CS4C 2ANBA 1E0AA 2OFWA 2LCFA 3K70D 1KI3A 1ZP6A 1E2EA 2C78A 3B2EA 3EAQA 3SE0A 1IONA 3VR3A 1WA5A 2VSXA 5EE1A 4B2IA 2Q3HA 1E2KA 4NCIA 1P9RA 5TV2A 1W0JD 5FI0B 1NSTA 1R5BA 4KHZA 4Q7LA 4Z51A 2W00A 1XXHA 2R6CA 1EFCA 3B1ZA 4DSUA 4D2IA 5KSZA 1KJWA 4OI2A 4AKEA 2C9CA 1U0JA 1IN6A 1TU4A 2W6JA 1NP6A 3A4LA 821PA 3RNLA 3P4YA 1F2UA 2XSZD 1KDTA 3GD7A 1F2TA 3LX5A 3O8BA 3CUEF 5KSOA 2QMEA 1ZNYA 3SC3A 1W4RA 4WA7A 2CLSA 3KB1A 3V4FA 2BMJA 1ZCBA 5EZ5A 4M1WA 1PUIA 1Q21A 1FOEB 1U81A 3AF3A 3VR6A 3W6OA 2KSQA 3ZVMA 1R7RA 5AUQA 4C7OB 2V1XA 1UBFA 1GVNB 4C0LA 1XMSA 5E7JA 1RFLA 3TVDA 3CO5A 3CPHA 2EFCB 4CRWB 5TMPA 3OAAA 4PPFA 5IF9A 3PEUA 1CIPA 1DAGA 2OV2A 4B76A 3KJIA 2G0NA 2NO0A 3VMFA 4BZPA 4KITB 1RRPA 4XTRA 1TPZA 2C96A 2H16A 1E0KA 4KXFB 4A4DA 3GLHE 3UWOA 4ASUD 5F2EA 3SZRA 4EJSC 3EPLA 1GG2A 3DEFA 5SZHB 1G7RA 2J7PA 1S0UA 3EARA 1TNDA 2OFOA 5L3QB 2J7KA 1P72A 3O8CA 1V43A 1CJTC 2DFNA 3FHOA 4HAZA 1OT3A 2J1LA 2R6AA 1OHHA 4C0QC 3TAHA 3QOFA 1AKYA 4QJ5A 4ZKDA 4DLYA 3OEHA 2ZROA 2OBMA 3HYTA 1RE0A 2BC9A 3MJHA 3VHXA 2A30A 4DKXA 3R8FA 3CLVA 4MUAA 2Q6TA 4D26A 1UAAA 4X8MA 1TF7A 1YHNA 2H92A 2UZ3A 3Q7QA 4KU4A 2QE7A 1Z83A 5GJVC 4BGDA 2RGNA 3R7WB 1SHKA 5EQTA 3FKSA 1II9A 3HP1A 4LJ9A 4Q9JA 3J81k 5TVKA 1OLOA 2FPMA 4HI0E 4OK5A 4EIWA 1GIAA 2D2FA 2FSGA 5DYIA 2ONKA 4HB3A 2XZOA 4LHYA 2QAGC 2ZE8A 4G5RA 4LJAA 3IEUA 2RAPA 4WZBE 1NLFA 4IRUB 2V6IA 2V7QD 4Q4HB 4US1R 1XCMA 1M6NA 1FPMA 2FFBA 4I1VA 4WW0A 3H86A 1CEEA 4IOJA 4KFTA 1KDPA 4Q01A 5JWHA 5SZKB 3UMFA 3EIHA 4OHXA 4M1MA 4PHGA 4QNRA 3AQ4A 3D31A 3Q7PA 1CR4A 1QHGA 1DE0A 1VCMA 4KYUA 4Q9LA 1DELA 2YWGA 5LPNA 1Z6AA 4MA4A 2GVZC 3VR1A 3U60B 2HT6A 5IK2D 1KDOA 3M6AA 3KFXA 5EE3A 2YYZA 3CF2A 3GLIA 4FCWA 4A0RA 4MITA 1T4GA 1XU4A 4IXNA 4HDQB 2GKSA 4IEIA 2XZLA 2F1RA 5J47A 1NLYA 1SULA 4K81B 4LPSA 5JEDA 5HCIA 4B3GA 3ETLA 4V0LA 1A2KC 1W7AA 2BOVA 4GP6A 4PPGA 3Q5EA 1AGRA 1U99A 4E09A 3BB4A 1N6LA 1UFQA 3CR7A 2C77A 2F9LA 1KNQA 2CL0X 1Q12A 4URVR 3KQKA 2F3TA 1Q44A 3V9PA 2GJKA 2A5DA 5C46F 4R7ZA 3CRMA 1KAGA 4WZ6A 1UDXA 1OW3B 1M7GA 4RKFA 1W36C 3MWJA 4HZUB 4E22A 1KTVA 2PLRA 1OKKD 2KB0A 2OSBA 1GKYA 2VLIA 1KO5A 2JLXA 3A1TA 3OEED 3U3JA 4UNPA 1XX6A 4WVFA 2GXQA 1EFRD 1ZINA 1IOZA 3LBNA 1VCNA 2AX4A 4TZ6A 3CNNA 4WZAE 2G1JA 3AH8A 1JECA 4CEJB 3GEEA 5CK5A 3THYB 5JMTA 8OHMA 5IDVA 1KAOA 4M1OA 3IQXA 4G5OA 4US0R 3VKWA 3I5XA 2ZVPX 3VR4A 1N2CE 5HPYB 2GJ9A 4BLQA 2A5YB 2HXSA 2QBYA 1RZ3A 4V0KA 2IF2A 2BMFA 5CYPA 4GOXA 1J7KA 2VH5R 3QF7A 3HDTA 5KSPA 2BIFA 2B7CA 5FOUA 3Q5DA 5GJCA 5FTLA 1O3YA 5LB2A 1A82A 1OE0A 1JXMA 3B1XA 2ZITA 5DI9A 1L7VC 3LQQA 3U61B 4UXIA 2GILA 4JLNA 5UKDA 4D81A 1KY2A 2C8VA 4XOIA 3RSLA 3VU9A 4OHYA 2HUPA 1G8PA 4G3XA 4P33A 4HAXA 4B6FA 2IXEA 5AK0A 2Q21A 1XF9A 4KBFA 1YZKA 1R10A 3NBZC 3SJAA 3KQHA 4ZO4A 3F8TA 2PT7A 5SZJA 1JEEA 3X1DA 2KE5A 2QMHA 1R0ZA 3GJ4A 2CVFA 2CLCX 1Z6XA 2E87A 1X6VA 5JS7A 1H8HA 3I8XA 3GPLA 2CK3D 4Q1DA 4BFUA 4BZXA 3QUSA 4M9SA 3ONWA 1E1QD 1FP6A 2XJ4A 4B48A 2IC5A 1MRNA 1OH5A 2QN6A 4MDFA 2W83A 5FH9A 1QZXA 5EE9A 2YZ2A 2BM1A 3NBYC 2XOKD 3UK6A 2V1UA 3N70A 5JLJA 5C4GB 1LF0A 1GKIA 1XTJA 3NBFA 2H18A 1YZGA 1G3MA 1ZU4A 4G5QA 5A0FA 1W0KA 2JGNA 4JVMA 2VRWA 1OB2A 4YDHB 3FTQA 2FU5C 4URXR 3I4LA 3ZD6A 4ACBA 1N5KA 4HLQB 5EE5B 2ZUCA 3ZZTA 5JSZB 2GK7A 3IIJA 5AJWA 4F4CA 2NPFA 1BH2A 3K09C 1G21E 4NMMA 1M34E 1RVDA 3LRPA 4XTCS 4EPWA 3MFYA 4MYTA 3HWSA 3TAUA 4KO8A 3NBXX 1E2LA 2FFQA 2RB4A 3S1AA 2MMGA 1VCIA 2QE7D 3QXHA 2Q3FA 2WZQA 1SVMA 2MSCB 3KTAB 1QRAA 1GL9B 1XFAA 3G5UA 5HTKA 2IS1A 1VYTA 2FWRA 2B8WA 1RYHA 3UWKA 2P6UA 5KNDA 3A1VA 1T9HA 2QTFA 3QXCA 5AJZA 3WNBA 2ZJ5A 2G83A 5CYOA 2IYWA 4Y0VA 3U44B 1UKZA 4JT4A 1G3IA 2OAP1 4TYWA 4LRWA 5FOVA 4A0GA 2AWNA 1BYUA 1MV5A 2PMKA 4OJKA 2ZVQX 5EP3A 2SHKA 4X8OA 3PUYA 3GMTA 4MRSA 1F60A 2VSFA 4RD2A 1MO5A 3OFNA 2DWQA 4UNQA 3QKRB 1IY0A 2Z4SA 1C1YA 2ASEA 3BC1A 1FNMA 2Q9CA 1ZM9A 4OK6A 3GJ3A 2XNDA 4HUTA 4LJ6A 4LI0A 2A2ZA 1VECA 3KJGA 2QTHA 4KFSA 4QHYA 3ICEA 2AKYA 3ZYCA 1II8B 1D9XA 4XJXA 3CF0A 3BJIC 5EP2A 4BUJA 4DLTA 4DZZA 3AVXA 1R0XA 3X1YA 1JQJC 4B44A 2ZANA 3IDQA 1KO8A 3OHMA 2OLKA 4HLDA 3RS0A 3DVLA 4IJMA 3CZQA 1G17A 2CNWA 2EWVA 2RMKA 2DHRA 4AC9A 1CULC 1J2JA 1HYQA 2OLJA 1SVWA 2O8CB 1E1RD 1RW4A 5FI1B 1DADA 1J70A 3FHCB 4GNKA 4PZZA 1CR0A 3EZFA 3SJBA 2O8DB 2PCJA 4KFRA 4C0SA 4F92B 5FTJA 2CMKA 1RJ9A 3AVOA 1S1MA 2J46A 4OI4A 1NBME 1N6HA 1OXXK 4ZPXA 1BKDR 5D3MB 3EA5A 1W0JA 4LJ7A 4TN1A 3ZVLA 2OO7A 1NVUQ 1COWA 4BFWA 3KX2A 4HEJA 4JLKA 5FUXA 1US8A 4HAVA 1PV4A 3K9LA 4ARZA 1XBTA 1OPXA 2GF0A 1PLKA 4Q4LA 2ZUBA 4NPHA 1WRBA 1SKYB 1FFHA 1PVOA 3HYRA 2ZQ5A 4FW9A 1J90A 1G64A 1OFHA 1XEFA 4MYHA 1G16A 1CBUA 3LW7A 4C0AC 2GHIA 5JEEA 3SEAA 1KI1A 4FMDF 4KAXA 1M2OB 3OF5A 1E2PA 2QGNA 3RANA 4O3MA 4MRNA 4IFBA 4Q5IA 1XWIA 4MRVA 4ZDWA 3TE6A 3QXXA 1N5IA 2BKEA 2YC2C 3B1WA 4UNNA 3OFND 3LH5A 2QM7A 1XMVA 2JLZA 1LNZA 3AF1A 3AEZA 4TSFA 4BLTA 3GLIB 1Q3HA 5DISB 4L9SA 5KO2A 3GLHB 3E2IA 4Q19A 1FQKA 3H4MA 2J0QA 5J5CA 2GXAA 4ZCIA 4HLUC 2W2XA 1EXMA 1Z0JA 2ZRBA 2VL7A 4DCSA 1W4BA 2ZR9A 1JQLB 1TMKA 2XNSA 5JWRA 3OEHD 1TQ4A 3U5ZB 2ZYTX 3QG1A 3NKVA 1SXJC 3K0CC 4TQ9A 2YNMA 4GSYA 4TLCA 3K0AB 3ZQJA 1T8TA 3ZH9B 4QJ3A 1GTVA 4B2LA 3DPUA 2HF8A 3R9WA 3SHFA 4XWKA 1VYVA 2F1JA 2CCKA 3BS4A 4RVCA 4UNSA 4WAUA 4TYNA 1MKYA 2MMCA 3QE0A 3BH6A 2ZS8A 5L3VA 1ZD8A 2PL3A 2OAQ1 4DIEA 2G0TA 3PG5A 3T15A 4A2PA 4JL5A 2XXAA 1OFUX 4ZIRA 2ZS7A 4F4IA 1EG7A 4UJ3A 2EFEB 5AUPB 5FUWA 2NMVA 4LGMA 1GRRA 1NY6A 5EUMA 1CJVC 1KK3A 4P3YA 4MKHA 4D0LB 1YR9A 4DWJA 1HA3A 1G18A 4MQBA 5B30A 4PAQA 2ORVA 4GFDA 1YKSA 2VF8A 2FE4A 2V8OA 5AR1A 4C0BA 1ZM7A 2G6BA 3C5HA 4UJ5A 2ANCA 4EFLA 5J4KA 2ZU0C 3REGA 5DGXA 1Z5ZA 4WXRA 3AUXA 3K53A 1VG0B 1TU3A 4CEHB 1E32A 1XJCA 2BV3A 1A7JA 2H57A 4JLOA 1EGAA 4HLCA 4KLZA 1IN4A 2R9VA 4B43A 4TZ0A 2VBCA 3SYNA 4A6PA 3UG7A 4EQ6A 2RGCA 5HE9A 4BASA 1NMZA 2A78A 4FCVA 2BBWA 1LVGA 1WF3A 1XP8A 2RGGA 1B23P 3NDPA 4LHXA 2OCAA 1JR3E 2NQ2C 1W47A 2WJIA 1ZUIA 2WWIA 2XXAB 2RHDA 4I4LA 3FMIA 1GAJA 3Q3JB 4PTLA 1ZD1A 1NMYA 2O8EA 4BFSA 1P2VA 2IUTA 3QIAA 2DYKA 4M9XA 1E0SA 1XJQA 1ZRHA 2ZYWX 2VP6A 3TUZC 2ERXA 1NSFA 3MUFA 3ZVNA 1GSIA 4QHTA 4M1KA 3K9NA 5KSYA 3P26A 1ETUA 3B9QA 4XD7A 1NG9A 4KJZA 3RS3A 1N6RA 2X2EA 2BBTA 3BH7A 3AUYA 3WY9A 4PSAA 4DT1A 1G4UR 5JFGA 3RS7A 4Z1MA 3Q9LA 4TL8A 2IA5A 1DO2A 3L8YA 1QG4A 1D8TA 1E99A 1KIMA 4R98A 1JR3D 4XVRA 2VP5A 4D82A 3MWKA 2GEUA 3TSZA 3CNLA 3BGWA 4ESVA 1KO1A 2CHVA 1JAHA 1AKEA 4DLWA 2GA8A 2DB3A 1F5NA 4FWTA 1C4OA 1E9CA 3KDSE 1AN0A 4Q7JB 3RS4A 1S4QA 3UXMA 3K0CA 2ZYUX 4MRRA 5KNBA 3EWAA 4PZLA 2WWWA 1U0HC 3B6EA 1FZQA 1TEVA 4XVQA 1Z29A 5L3QA 2XTNA 2V7QA 621PA 1FQJA 1ZW6A 1IXRC 3Q72A 5JWOA 3QENA 4HLUA 4DBLC 1SVKA 3L2OB 2F55A 3QNUA 5DE3A 4Q9IA 5F3WB 2J0SA 4B33A 1HE1C 2ZRIA 5K8UA 2CLDX 1P75A 2HCBA 2ZSDA 5DNYB 4JBXA 2FGKA 2FX3A 2PEZA 1IM2A 4L15A 4ILEA 4DRZA 1DAKA 3T1VA 2BDTA 3B7GA 3OIUA 1T8UA 4JL8A 1Z0AA 4MDEA 3WRYC 2CJWB 3VR5A 4NCHA 4C2UA 1SGWA 1QHNA 3I3SR 1NN1A 3I32A 3NVAA 3DMNA 3EC1A 4MGZR 3ZVRA 1RPZA 1D9ZA 1X8LA 1M8PA 1J8YF 2OHFA 3ZD7A 4ABYA 4BFXA 1IN5A 1IHUA 2O0HA 3PEYA 2VO1A 3HR7A 4DC9A 2GVDC 1W46A 4AG5A 1G5TA 4JMPA 1K5GA 2F1HA 4OHWA 3KXIA 1LV7A 4GOJA 4QNMA 2XITA 1KJZA 3K0EA 1OXVA 3B9PA 4JLDA 2QNRA 4M1YA 1XXHE 3SYLA 4JYCA 2ZAMA 2V6JA 3EZ2A 2LKDA 1N0WA 4R2HA 1ZJ6A 3U3KA 4C0KA 5E7MA 4PFSA 2QPAA 5CB6A 2QPOA 5H70A 5FTMA 5ANRB 5KPDA 1KO7A 2AL7A 4EPVA 1W2HA 4Q48A 4IXMA 3A58B 4NL4H 5CIQA 1NIPA 4Q00A 4YDSA 3EPJA 4AYWA 2O0JA 5G3YA 2BMDA 2J7PD 4YMWA 3VU9B 4A0HA 1RKBA 4LV5B 4IDPA 1Z06A 4JLJA 2WOOA 3IHLA 1PUJA 4KSBA 1XZPA 1EFHA 2XJ9A 3EIQA 4NP6A 5FBVB 1GNPA 4HDCA 3VX3A 2OCPA 2WMNB 1T6NA 5AUOB 3C7KA 1AJEA 3K1JA 3K70B 3CX8A 4QGGA 4DDUA 5FUYA 2A9KA 2YKGA 2I3BA 1VHLA 2REXB 4RZUA 1NG1A 4PHFA 5KNCA 3DHWC 3F3YA 4AKIA 1XPRA 4A36A 1Q1EA 3A37A 3H1TA 2GAAA 3RS2A 4D80A 4ERNA 5DI3B 1GNQA 4QBFA 5BW8A 1DBSA 2D62A 2ATXA 1VG9B 3F0TA 1N5LA 3DL0A 5KDLA 2CJWA 3ZLJA 4FMCB 1KI8A 4DB2A 2GJAA 3DOFA 3H2YA 3FMFA 4DLZA 1FX0A 3A6PC 2AKAB 3BFXA 4IOKA 1HUQA 1QHIA 2B8TA 4P32A 5CLQA 3VKGA 5F9HA 1XB2A 4P4TA 4TL6A 1T5LA 2MSDB 5A4JA 4MYUA 3CWQA 1X3SA 2FNAA 3T1TA 2CCGA 1IBRA 2TMKA 3IGFA 4TYPA 2RHMA 3UMSA 1P60A 2IEZA 1XCPA 1OH6A 2OZEA 1DAMA 1PZNA 2BJWA 2F7SA 4TSFD 5G3ZA 4Z54A 3U4QB 1YR6A 1N3BA 1OHHD 5C18A 4I81A 1FUKA 4EJSB 4NCNA 3BD9A 1QF9A 3D3QA 1S9DA 1KMHA 1ZNXA 3I62A 1OYYA 2REBA 4LSGA 1MABB 4ON9A 4GBMA 2DWOA 4LY6A 2F6RA 3VR2A 1RJ9B 4JLVA 2Z4RA 3KZ1E 5FL7A 1VKJA 2RKOA 4LBWA 4DHEA 3QSYA 4BECA 4YXWA 3U4QA 4OQXA 3PEWA 1BO6A 3QF4A 4Z1MD 1TQ6A 2Z6VA 5EJEA 4CGZA 121PA 2GRJA 2J45A 1MOZA 2JLUA 5H1YA 2J5XA 1N6PA 3NH9A 4JJKA 2R44A 3JVVA 4DXAA 4IKEA 4ZKEA 2FGJA 4MKGA 3KKMA 3OAAD 3PV0A 1W49A 3ZS9A 1XRJA 4ARZB 2O0KA 4B32A 4Q7KA 3SFVA 1L2TA 1D6JA 4U7DA 1S9HA 1KKLA 2ZPTX 2QAJA 3GLGE 1UF9A 1XD9A 4H9GA 3B5JA 2G9NA 3OEEA 4KI0A 1DTSA 2Q0HA 3RABA 1K6MA 3O8DA 1CLUA 5DN6A 4P4SA 5FOXA 1IY2A 4NONA 2JDIA 1P4SA 3I1FA 1Z08A 3U7GA 2O5VA 3MMPA 4LC1A 1OSNA 2HLDD 3HJNA 3RYTC 2GZHA 3A8TA 4DVGA 3Q8XB 3GLFE 2AK3A 1DAEA 5IK2A 2D7DA 2QGZA 1FX0B 3ND9A 1Z47A 2ZRPA 2NO6A 4FMCF 2J59A 4LHZA 3WMGA 4CEIA 4C0JA 2IXFA 3P4XA 3CX7A 1G20E 4TMZA 5CJ2A
chains in the Genus database with same CATH superfamily
2DUUA 1HLFA 4J0IA 5CEFA 5SZIA 4NXBA 3S22A 4HNTA 1M73E 2EBWA 3RVJA 4BX8A 3IBYA 5CB4A 2HSWA 4OP3A 1M75A 1WB5A 5BYBA 2ZAYA 3K0AA 3ZS8A 3CMCO 1IULA 4I1OA 4GMXA 4PKYA 1ZC2A 4DZRA 4HNHA 2AVNA 3I6QA 1AA9A 1PK7A 4N4EE 4JSTA 3VO9A 3D6UA 4EEZA 4HPJB 4XNBA 3VPDA 5KNCD 4ARAA 5JXHA 3REOA 1JIVA 4E4YA 3OETA 2CLOB 3SXPA 2ZULA 2WKHA 3T5TA 4FOSA 1ES3A 4Z3KA 1BXKA 3FH0A 3AINA 3FUVA 3OLQA 2HMWA 1JHVA 3V8RA 5HE8A 4B35A 1ONOA 1UODA 2EERA 1CUJA 2NOAA 1H8MA 2GPBA 3RAJA 3E7DA 1YR8A 3NTOA 4P4SB 2H17A 3JU3A 2UYGA 1OIWA 1ORDA 1UK7A 2J9RA 1IYPA 3W05A 2DUNA 4U7PB 4DIBA 1D7OA 4W5HA 1LI5A 5I5EA 2RGDA 2YC4C 4NNOA 1RMQA 3WLFA 5ERYA 3C98A 3L9KA 2V0NA 1XD8A 1JYSA 3HKBA 1HE2A 1CRWG 1UWNX 1R5OA 3NX4A 4R2WA 3RPEA 3CM0A 2R1ZA 2AD1A 1QFSA 5JH7F 5HXAA 3HFGA 5A06A 2XVMA 2FPPB 2I2AA 5REQB 2XRZA 2C5GA 4G24A 4CKBB 1R3UA 3PDJA 3VHLB 4B46A 1P33A 4KVGA 1Q7CA 4V1CA 3AW8A 4M65A 4O4LA 3PA6A 3LIFA 5F52A 2GX6A 4GQAA 3BICA 2PUTA 3LWDA 4FINA 3WDKA 3BERA 4QX6A 1TGYA 4B6RA 2BLLA 4BTEA 4WOPA 4Q7QA 4Q21A 3W9BA 3DV9A 4IQ8A 2Q2NA 1O5IA 5JCOA 2VYVD 4NPCA 4EPXA 5HDDA 2O1XA 4AK9A 3AHJA 4MW0A 1LT0A 2DAPA 2P68A 4GI7A 5LP6C 2CE2X 1XEWY 4UAVA 5KQMA 3LTEA 3RSHA 1XDUA 4ZTBA 5LYJF 5BT8A 2J9OA 1MW9X 2D2EA 2AOTB 2HB6A 1KR5A 1U7XA 3N28A 4IIHA 2ZYDA 5B1HA 1U8ZA 1K5HA 3LM8A 2Q6VA 3PFGA 3RR2A 4D4IA 2YJ5A 3WICA 3FKQA 3HEMA 3PFIA 4RYLA 3W4OA 3H3XA 2VP0A 4WUTA 1TDJA 1W5FA 2PRYA 1RYNA 3VI3B 4B9OA 2NQ8A 8MHTA 2AOUA 4WELA 1D2HA 3GGCA 4N8EA 4LGCA 3AETB 3PVSA 1BDBA 3ZZUA 3KOOA 3UDFA 1IYZA 2DR0A 2GVNA 4WLNA 1XQ1A 1WLSA 4BQOA 2Z6CA 1LBTA 2B9VA 3FFBA 1GUYA 5KTNA 2WF5A 1W94A 3AP2A 2PWZA 3JV7A 3KB2A 4HH1A 2Y0EA 4NFSA 2DQMA 1R4AA 3IDAA 4Y1FA 3RFFA 5AW1A 3WI7A 5F6AA 1XNJA 4ADSG 3HCBA 3PWKA 5LDGA 4BIIA 5BMVA 2Z30A 1Y6JA 3I83A 3WGNA 3R7WA 5CH5A 3RAFC 3IP1A 4LTNA 2XH8A 2YWDA 3DWIA 3GNLA 1QHSA 4HYEA 1QO7A 3DT8A 3S2FA 2X23A 3S99A 4I50F 3IX7A 5C8VA 3G2QA 3G9QA 1K86A 4GPZA 4C4RA 3CG0A 4Y1RA 2YWEA 3V8BA 1X39A 4AU1A 4KV9A 2OZVA 4Q1EA 4C6YA 1O95D 1Z5OA 2FZLA 3G8DA 4ND5A 4BFZA 5KOJA 5TIIA 1NKSA 2RKWA 5HEKA 4EGFA 3W7BA 2IX3A 1RHJA 2DQKA 4DXCA 2GETA 3HH8A 5CFMA 1NMSA 1KXZA 1IIBA 2PZFA 5E9AA 4EEKA 1GVHA 3WA7A 5FWXB 1FC0A 3L0PA 4OOFA 4QYXA 2QY9A 1FDUA 1X9GA 1JMKC 2CWWA 4AAYA 1C7IA 2OGUA 3RVBA 2WFLA 2ZC4B 1XMOB 1ICEA 3EZYA 2D0PB 4C6TA 2WBLC 1A9TA 2YXDA 5IC6A 3AZOA 4IJ6A 5JQWA 1Q57A 3MW8A 3KYDA 3EK2A 3KJXA 3FU3A 1E9SA 2JLBA 3EHDA 4O4LB 2IPXA 3FZCA 2W58A 4KUHA 1NT2A 2C4MA 1NWHA 3PUVA 4CETA 2K7FA 3VR4D 3WWYA 4BMYA 4CF4A 3WP0A 5BQ5A 5AVEA 3AFGA 3QGMA 3OCUA 4GGPA 5FHQA 1H4QA 4AJ1A 2I7CA 1M7HA 2WIFA 2EBFX 3P2OA 4MB2A 5MGBA 4OHOA 4TLEA 3MJEA 4FB5A 1G3QA 5AW7A 2N75A 4HWSA 4JVSB 1X3LA 3K16A 4DA8A 4FMDB 2H28A 4Q1AA 2WD9A 1BG6A 1KP9A 2IH5A 1P2DA 1RM4A 3PD1A 1OFIA 2XLNA 4XFDA 3WG9A 4AYXA 3ZD8A 4LDRA 1WHTB 2J33A 1UOOA 1ND6A 3I9OA 4PGAA 4H6WA 3AY0A 3LGOA 1MH9A 2DFVA 2JAWA 3D0OA 2XZPA 4N0QA 4TL7A 3WP1B 3DOHA 4Q03A 3ZCUA 1K5DA 2O8NA 2P5SA 4AZ3A 5A9RA 1I30A 4D3YA 1ZGZA 2C2HA 2EKQA 3KJFA 4OMDA 3C1TA 2R8XA 4ZCMA 4HUQB 2YHUA 1T0UA 1G68A 1CKEA 1WW2A 2ADOA 2OBNA 3IKMB 1KMIY 4MV5A 5FPTA 4DT1B 4TLIA 1ZJYA 5CXXA 5U9CA 1SCIA 4TXHA 3T9BA 4PC3A 1J21A 4C1BA 4QPRA 2FEOA 3ORYA 2IXAA 3SEZA 3AI7A 1FSYA 1Q2UA 5DXFA 5BVGA 2FDXA 8ABPA 3OOVA 1YXMA 4ZC1A 3TGLA 3HPRA 4KB5A 1V6SA 2WJHA 1PFVA 2FSIA 2H65A 3B12A 1ZJWA 1B43A 3OPLA 1NW6A 2X0JA 2ZTUA 3EZ6A 3I04A 2VXCA 5FSRA 1X70A 3CNOA 3TDNA 4A73A 4BVBA 4RX1A 2GPSA 1LVUA 1Z2CA 4W5JA 1JIIA 4DAOA 1YJ8A 2XLBA 1XJ5A 2WPNA 1UBRS 2VGJA 4BN0A 1Y8RB 2CLEB 3N8KA 2P6PA 2XRYA 3OVMA 4O33A 4KSCA 2AEJA 2F3SA 2ZMFA 3IAAA 3PUXA 4Z4CA 2EX9A 2H7VA 3EPLA 3IUEA 1J00A 2AFRA 3SIXA 4CMEA 3DA8A 3DDSA 1H9BA 4LV1A 4EGJA 4CJNA 4NQRA 1JFLA 3MAAC 4J2OA 2CL7X 3D81A 2HKIA 3OC6A 1EFUA 1GAEO 1X14A 2E9SA 2QP4A 3E9RA 4TVKA 5J2TF 5HQ3B 3PGJA 3JAMA 3IV7A 1MJNA 4M3NA 1RC0A 1YS9A 3AHDA 1EK5A 1N2CA 4GP9A 1RI5A 4JBGA 2Y2PA 4LWOA 3SYTA 1G42A 4K3VA 4QXRA 5JDCA 1ONSA 3T0IA 5L45A 1Z4NA 5K1VA 3EISA 4CKEB 4JI3B 2Q45A 2Y8HA 1FJVA 1OPRA 5A5EA 3AVWA 3EE6A 1HT0A 1XHLA 2GYUA 1GGKA 4LLOB 2ICAA 2Y1FA 3DJYA 4G0QA 4PICA 4CL3A 5CITA 4XPIB 1X8KA 1LVHA 2NZYA 4KQJA 4PPNA 3IHKA 1QYWA 1CRPA 5HQ3A 5BRAA 2PG3A 2HWYA 4F97A 3W7AA 1E1QA 4DDTA 3A3FA 1U9CA 2QTAA 5HTOA 3RRZA 2X8JA 2QG6A 3JZFA 3Q3GE 3HNOA 4OQDA 4FFDA 2IU4A 1A8PA 4RA6B 2W5UA 1T3SA 2BY4A 2KM1A 1L1RA 3RYFA 3IVCA 3LLUA 4OYYA 3T7SA 4LZOA 4GM4A 4HXEB 4TRJA 1SBIA 2PPLA 2XROA 2SKEA 4NJMA 3FH8A 2XR0A 3AGEA 4KVZA 3G2NA 1GPMA 1GQFA 2W7TA 2G82A 4JVNA 2M1XA 1H0MA 2QN7A 3GQZA 4MRVA 1YSQA 1PR6A 2D74A 3TBHA 4A16A 2C8KA 2JK1A 2QQEA 3CJQA 1RJFA 3STYA 3FHJA 3K2BA 1Q92A 1H2FA 1NZOA 1NUHA 2XTJA 2Y1LA 3KLOA 1H2ZA 4IWYA 2EX8A 3ELBA 2UVQA 2X15A 1X2BA 4LWZA 4X8LA 3RCBA 2WF9A 3L7IA 2F8TA 1THTA 3BCSA 3KQMA 4LXIA 4WJKB 4BB0A 2ZIXB 1KOJA 3ABIA 2HA4A 4QTTB 4RJIA 5JZBA 4TRNA 1EJ2A 1WVGA 2X2PA 3G9ZA 3LNCA 4MR9B 3IEVA 4Z1WA 2X0DA 4DIUA 5IUJC 2FN7A 3Q9UA 1XALA 1E1CB 3G85A 2VGLS 4G3KA 3WWCA 3KKPA 4J1SA 3SNHA 1U0LA 3H84A 2NV6A 3AP1A 3K0FA 1XGIA 3AL3A 3T99A 3UC9A 3SZUA 1QYVA 4XPIA 4DMHA 2DEUA 2W2LD 1VB5A 1CHNA 1P0IA 4HDSA 2VHCA 3PB3A 1DGQA 3IP9A 3TNFA 2B5WA 1EVLA 2YWCA 3C5CA 2EXXA 3LL7A 2PWYA 2KW5A 7MDHA 3T1SA 3V3RA 1EBUA 4BENA 4LOAA 2GF2A 4N6OA 2CFTA 4PG4A 2PSJA 3RUEA 2W3GA 5G4ZA 4Y7CA 4YCJA 2QJOA 1NVEA 2P9BA 3T0FA 1E3WB 4D9MA 2XB2A 1CF4A 1CJCA 2QKPA 3MHPA 4DA9A 4E32A 4OHZA 3A1UA 9MHTA 3LMKA 3PYMA 4EBFA 4O4IB 1PGJA 1G8SA 1NQ5A 1YB5A 1TQ2A 2WJ4A 4J1TA 2PD8A 5TGFA 3F74A 4KFUA 5E7IA 1GA6A 3F4BA 4OX9Y 4HH3C 1V0JA 4ZCLA 4Q9KA 1I5QA 5AJUA 2X0RA 4RD1A 3HKCB 3EGXB 2QRLA 4RYEA 3DFKA 3KDPA 3U7QA 4GUAA 3O83A 4EESA 2C5HA 2J3LA 3P7WE 2JGDA 2ZAOA 4LN1A 1K92A 3ZGLA 1JFFA 5G0WA 1E2BA 1JSRA 2ZKLA 3HN6A 4L4UA 4XB2A 3TNJA 3UIEA 5K3OA 3I9V1 4AQDA 5HKAA 1DKMA 1HPLA 2C9BA 2R1TB 5HPIA 1PE5A 4N92A 3IR7A 3WIOA 3WRXA 4JBWA 3FFWA 3M5DA 3ZXIA 1Y4DE 1IUKA 2BFEB 1A77A 4MKTA 2D5CA 1USGA 2E37A 4NJMB 1ZCJA 1XIVA 2PS3A 3B3JA 2BR5A 2YRXA 3RVQA 3ZG0A 2Q6KA 2P5TB 4H6VA 1E59A 2QR5A 3K7EA 4ZX6A 3EXHB 4GLOA 4GYKA 3AJRA 3GLFB 2EVWX 1Q0PA 3GMIA 3LBHA 1AGXA 1DUIA 1T24A 4NCXA 4TS1A 4C88A 1AKWA 2VDNB 3G79A 4E3KA 2XA7M 7TLIA 1NRIA 1RIFA 4HH0A 5J4YA 3BT7A 1MWRA 4FUQA 4TLMB 1K7CA 1KR6A 1N5JA 1QRDA 2X3FA 4OB7A 3UJCA 3ZX5A 5J40A 1I3NA 1C8VB 3EOZA 2P11A 3GLHA 4EQ6B 1O6CA 1EFAA 3ANNA 3SM3A 7AT1A 3HKEA 1KJ8A 1K6RA 5LQRA 5AUNB 1QCYA 3K2EA 3BD7A 2XGSA 3TAXA 4UHUA 1JU9A 5EJ2A 2GCIA 4PRYA 5JDCC 4B3BA 1RZRD 3T7JA 1O54A 1QYCA 2HJRA 3U31A 3A0RB 2VR1A 4CZ2A 3PQDA 4LSZA 3FJYA 1GG9A 3ZZMA 2G9UA 1CDZA 5IKXA 1JRLA 2FP4A 5A3JA 2G25A 1AH2A 3W2IA 2HPBA 4GMGA 3ZXXA 2Q1WA 4IDQA 1R27A 5LLSA 1UJ2A 1TQDA 3VYWA 1JR4A 1Y8QB 2PR2A 4E3JA 4UVEA 2KPOA 1YQXA 2CHQA 2J07A 2PGOA 2ZRLA 3QELA 4FT4A 2ASVA 5E4FA 2QR3A 3RV4A 3UNXA 2JBAA 5I3ZA 5JTUA 2PUDA 5FXNA 3M3DA 1WUJS 3H8JA 4HDAA 2P2ZA 1YJ5A 2C2OA 2GXSA 1DC4A 2WSSD 3BE5A 1F4LA 3FVTA 3IJ5A 4JU9A 1K9SA 4LC9A 4ZMRA 1SDEA 5C3MA 4BRZA 9LDBA 2D6FA 3KOZA 1R6BX 1T6ZA 1KROA 4YCBA 4OQNA 1JIXA 5F4ZA 4R38A 3JWIA 3OT5A 4CMEC 2ZIWB 4Z3OA 1T18A 1TAQA 4Y2RA 3UMVA 1QE3A 1YCFA 1YJAA 4JGBA 1XSEA 4DR6B 1IBSA 4JXWA 3KUDA 1N8SA 1DRUA 4BLWA 4UAAA 1OWLA 1TQHA 3FV4A 1GKUB 2EYUA 3FYUC 1DIHA 5DGTA 3UK2A 4TYNA 1KGGA 1CWUA 3PXCX 3Q10A 1II8A 2CVQA 2WYIA 4PQFA 4LYHA 4M21A 3ZWOA 4D44A 1U2DA 4RCYA 4G85A 1E4OA 4FDLA 3WY9A 4EY7A 2P67A 3ZY3A 1F0PA 1F48A 3RUFA 3A26A 2X9QA 1OIVA 1L5QA 5TLNA 4ZVRA 2HPTA 4E2XA 3ILYA 1LTKA 1M0TA 1T4CB 2RAUA 4X1YB 3CBQA 1V1MA 4ZU1X 5CB4F 1EUCB 4LI3X 1YL6A 4FYSA 4BGIA 5ES3A 5KKNB 2B36A 3OIVA 3VPCA 2G77B 3NHPA 3EQVA 3RVPA 2DBQA 3VVMA 2E1PA 3GFTA 3P94A 1ORVA 1SA0B 3PUIA 4IFTA 1TB4A 4X7MA 3A3PA 4NS1A 3CLRD 3L6CA 2X0IA 3KKOA 3DFIA 1OMOA 1W581 3OT4A 5HIJA 4AF7A 1QSGA 5IZCC 2VP3A 4IDHA 3H6KA 4DUGA 2GZSA 1GXWA 3Q11A 2YXEA 3G2LA 3S1SA 3AHFA 2C2BA 1A76A 2E5FA 3RASA 1FA9A 4YRDA 4FDVA 2H4WA 4KLRA 1ZMRA 2IYQA 2AOTA 3UJDA 1BE6A 1E2MA 4NG5A 3PQ3A 1YQGA 1IPHA 4KXLA 3ZPXA 3WRXC 1D2GA 3MKFA 4KMOA 4XVRA 4ZCSA 1ZD3A 1W35A 3TMAA 2ZUEA 4FH2A 2FPKA 3WYDA 1LKZA 1N1MA 1ES5A 2C20A 1MX1A 3ESCA 3L5OA 5D86A 1NFFA 4JUFA 3SJZA 3P27A 5D7BA 3I39X 2EOAA 3C1UA 3OE7D 1AXBA 2P74A 1FYXA 1PQPA 1UBGA 2CMGA 1MB9A 4FE7A 3WQBA 5EM0A 3K5HA 4AJ4A 2WAXA 3K31A 1Y8QA 3LEQA 4HQNA 2W0NA 4Q18A 5FWXA 2ZU6A 2GZDA 3GROA 1RLMA 4YUXA 4KQWA 3QVKA 3CZPA 1Z35A 4O2AF 2H1VA 4IW3B 5A7GA 1GL6A 1HL3A 1KMQA 1WLYA 1KDRA 1Z12A 2X4DA 5F9FA 3FTVA 4BPBA 1BLSA 3VVBA 3DBKA 4K03A 5D5QA 3UZUA 1RQNA 3RXWA 2B98A 2VYVA 3OCXA 5IXYA 4FYRA 2EYQA 3Q8KA 3UE6A 2R7MA 4LHEA 4IOLA 1UDAA 4I1RA 4DMKA 3W06A 4F21A 2H48A 1QHYA 5IABA 5BN5B 3GEDA 1F5MA 5BN1A 4E30A 5F7XA 5BV0A 4JPMA 2GTQA 4G84A 3S5JA 4MRPA 1SXJD 2RK4A 3DAVA 2Q99A 1CY7A 1SUEA 4MDHA 2WIDA 3C48A 1DWQA 2BGLA 3AM4A 1KZ4A 2BUAA 2GEBA 1GNVA 1JNYA 3CZDA 2XOXA 2CMDA 4QUOA 2TLXA 1NW8A 4K91A 2IY8A 4AULA 2LKCA 4Q15A 4EMSA 4DDKA 3F78A 1WETA 4AI6A 4XXHA 1O4VA 1QORA 2F3RA 4F6RB 4C78A 3NEJA 2RIRA 5I4IA 5JS1A 4GYYA 2XMQA 1UP6A 1YZFA 5HZHA 2FMFA 4MW5A 1GU7A 4DG5A 1RLTA 1KH1A 3K32A 5HKLA 3D3KA 4JA2A 4EG6A 1QH1A 1G9XA 3FUNA 2GCGA 1V26A 2M7UA 1IUNA 1NC1A 1BJTA 3FI9A 3GRZA 4BEVA 4B3TB 2WE7A 1PR9A 1BU5A 3TRJA 3ZWDA 2R8RA 1R2QA 2A67A 2OXCA 4MS6A 3MJRA 5IVIA 2WYWA 4EW3A 5GOTA 2NU6B 1ZIPA 2QP9X 2OA0A 1RTKA 2PXAA 4HVLA 4N1XA 3NTLA 3O3CA 1YU6A 5F23A 1ESZA 2PLAA 3DSRA 2B83A 3LDUA 4FJ2A 1ID8A 4BVLA 1C0IA 1KI9A 4PM8A 2OC9A 3A6KA 4PYIA 1L5RA 2PA0A 3BB3A 4UVHA 5LDDC 3EBIA 4GEGA 1HLGA 1SXJA 5GINE 4YAWA 1TT7A 1QAMA 2ROQA 2RSLA 3RIMA 5FWAA 3HVJA 1UIMA 2Q9AA 1ZTUA 1DLJA 1P62B 2WVAA 3ZHUA 3O84A 4ZI7A 1E1NA 3PLRA 3RJTA 2BGNA 1FXWF 1NQUA 1XTRA 3ZTWA 1BNCA 2KJQA 1QH0A 1ZKJA 3AF2A 4V0NA 2AW3A 4LBYA 1X86B 4FYWA 2FK7A 5TS3A 1VLMA 3K6KA 1PIWA 1X1QA 4HDSB 2BCJQ 4W7IA 1W44A 3MTIA 1T5DX 3SPXA 2IUFA 2XHZA 3X1XA 1TVMA 4BNHA 1JBQA 1YVEI 2JA2A 4KAFA 3QJYA 1NVVQ 3P9ZA 5I7OA 2VPQA 2H1IA 3NWEA 5AM3A 1O07A 3BXGA 2ZSBA 5C35A 1UZAA 3BXHA 1C9NA 1RHMA 3OUZA 5G0SA 1NTRA 3SXUB 1HYTA 1TS0A 1TYZA 1YQTA 4C3OB 4LZNA 5J5AA 2H8KA 4FSXA 5BN5A 1V4NA 3CNEA 3C15C 3MCTA 5GZ6A 2BVNA 5EPEA 2FP3A 1FMJA 2W3HA 2XCLA 3K1YA 3TBFA 4R71A 3G8CA 3NYRA 3MZ0A 5LP6B 4NBSA 1TRKA 5LA6F 1FP4A 2B5VA 2ZI9A 4IICA 1PI3A 3SU8A 4KACA 4IHQA 4OOLA 2ZE6A 1IZ8A 1CQWA 5KI6A 4TT3D 5AVJA 4OH7A 3NH6A 5ALEA 1QCDA 3NR2A 4QY6A 3AONB 1FLDA 2QVXX 4EU0A 3D7LA 5AVWA 3CT4A 2G9VA 3FGNA 4K5QA 5AMXA 1BTOA 1UBNA 2IWRA 4RQ9A 1ECCA 1DC6A 1OA1A 2QYHA 3GLTA 3OPVA 4A8JB 1DX9A 4C5AA 4MWCA 4IUDS 3SE7A 1XGJA 3H7AA 5FL7D 4LNUA 1SZDA 1C9DB 5C2JB 3G5LA 3CHWP 3HU2A 3RREA 3RSZA 4BVEA 4EZIA 1SCNE 3FWYA 3K9CA 3BWEA 3KM0A 2IX9A 3CW8X 5FPSA 2ZIXA 4MLZA 5JC1A 5KTSA 3FN4A 5DCWA 3ZNNA 3KDAA 3RLFA 2KQUA 3EXHA 5IDVA 1L4BA 2RGNC 4GPTA 3TLJA 3GLFA 1U7ZA 1RRCA 3LA6A 2EP7A 5JSZA 4NYMR 5IAJA 1HR0B 1WUYA 3THYA 4ESHA 3RRJA 1XP4A 1JS1X 5GZ3A 2IDZA 3D6TB 3R5SA 5AVUA 5IUNC 3IWIA 4GKKB 1RXIA 1NXQA 4K6MA 2H2FA 3UAWA 2Q1YA 4B4WA 3FUIA 4CEJA 4IDAA 4RLQA 4D9CA 4LVNA 1O87A 3C3BA 1GZ5A 2NV0A 1SB9A 2PJRA 2NSDA 2VJMA 5EHGA 4DL9A 1ZPDA 5JY1A 3HY6A 3Q8LA 4EVIA 1O94C 1TTHA 3TKYA 2K31A 1ADFA 2GEVA 3ANXA 1C8LA 2O8CA 4ZOBA 4MICA 1UDWA 4G3WA 1XXLA 2JS7A 4PGHA 1M2NA 4A92A 4AMVA 5FPKA 3L04A 3JSAA 3JQAA 4IFEA 2QZPA 3EWSA 2DJ5A 1E3IA 5E1OA 3V7NA 1C2TA 2B99A 2FPIA 2YFYA 5FOSA 1JSXA 2QORA 3DQQA 4G01B 4FT2A 1WZEA 5AIAA 5AJHA 4H2DA 3WGTA 4DCVA 1V39A 2MSLA 4RXUA 3ENNA 1SUIA 2GZAA 1XYYA 4YP1A 3QSYA 2PZLA 4FILA 5E3HA 3WJ1A 1LTHR 2QDKA 2EW1A 4Q4DA 4YBRA 1VFPA 1YD7A 2C0CA 4G89A 4L75A 4N9QA 4U1RA 1LSVA 1TUGA 1MMFB 4LDZA 1FNNA 1O7JA 4OONA 2XFSA 1JHUA 2RJ3A 3IPRA 3WL8A 3TLCA 1YZLA 3FUCA 1L5WA 2J0VA 3L6EA 3BTOA 3CSSA 3NVDA 4NKPA 1QOZA 2AYYA 3RRFA 1FW8A 1XTQA 4DCCA 4QO8A 4RA9B 1WZNA 4WOKA 5AQEA 5H68A 3TPFA 2H1CA 2ZRMA 2R62A 3P9XA 4M7WA 5EXSA 1PJ8A 3HC7A 3T12A 4JWTA 1CIVA 5C1OA 3EXIA 2P65A 4E5UA 3CLRC 3AR5A 1W63Q 4AZTA 2EXAA 1QWOA 3AU8A 4YFMA 3SR0A 3WRZA 4N0DA 3D6AA 2EX0A 4XJVA 1TEHA 2F1IA 1TD5A 1RXUA 1EUYA 4DF6A 1JLMA 1F5SA 1WE2A 1NVAA 2E18A 1LEHA 1DXHA 1DEKA 1YNOA 3O82A 3KYQA 4PQRA 2Z2KA 1QRTA 5L8PE 5TXGA 1N8NA 5DASA 4CCAA 4IYJA 4R9VA 4Z0NA 1JG1A 3JAKA 2JNWA 1JDTA 1UINA 4W5WA 3BY9A 1F8GA 1KL6A 4A0QA 1DTWA 2CMHA 1FS6A 2Q5CA 3PITA 4U39A 3FYZA 5J58A 1KRHA 1RPNA 2CZCA 1P80A 2NO4A 4INOA 4XQGA 3QA9A 5A1TA 3DVRX 3BIJA 1YIAA 2AW5A 4QPEA 1KY4A 2P2LA 2V54A 1U98A 1IEVA 3C6MA 5JPCA 5B1EA 1PNOA 3S70A 5F4BA 2P2GA 1U7PA 3DP7A 3SY8A 4O2LA 3N8NA 2D54A 2WHPB 4L9AA 1PT6A 1T43A 4QJ4A 1M83A 2CE7A 1F0KA 1HMYA 3DZGA 1FRZA 1Z4PX 2LVBA 4DE3A 3RRYA 4AY3A 3FPGA 4YMTA 4QUDA 2VHJA 4PYRA 3IHWA 3NXSA 4DLSA 3EPKA 5BMVB 2XPZA 4E6XA 2IYTA 2CCJA 4XYLA 3OCYA 3EEQA 2IA2A 4J6EA 5A7HA 1VE3A 4JXGA 3QKSB 4M0FA 4OSEA 4YC7A 3VNRA 5CCBA 3G2IA 5C53B 3X43A 3VR0A 4G41A 4X56A 3E58A 2ZVJA 3WOHA 1JF8A 4M0UA 1N34B 2EKZA 4MVXA 1EP3B 4JLPA 2C03A 2DBRA 3NTVA 3U2QA 3GLUA 2Q3EA 1GZDA 1GR1A 2YN4A 1OFTA 4AMYA 1ECJA 4Z9FA 4OXQA 3E48A 1VZ3A 3F6SA 3QMMA 5D1HA 3L7OA 4R4SA 1ZBDA 3LGSA 3DE5X 2YS6A 3PQCA 4IFIA 5LB4A 2CD9A 4C05A 4XR4A 4HWTA 2PKXA 5BPHA 3HO1A 3E3NA 4UBIA 4QVKA 4BE9A 1SWVA 1QF0A 1TVCA 4JS0A 4X71A 4XGNA 4TYQA 3FCCA 1ORTA 1QVWA 2DFLA 3QA3E 3UMCA 3CX4A 3SSNA 1AZSC 1C3JA 2PQ6A 1G5UA 2P4HX 1HV8A 1NF2A 2JFQA 4Y9TA 1Z6GA 2RHRA 2VFAA 4JGPA 3FTUA 4CF5A 1KORA 3M83A 1TM7E 2OMKA 1POWA 2G67A 1XTIA 4OREX 4XUGB 2VJQA 4G5HA 1R74A 5EC8A 1Q22A 4B75A 4Q3DA 1T5BA 4YAIA 1NULA 3C3PA 3PL1A 3U4HA 2BP7B 2ZYVX 3KAJA 1MRZA 3R0QA 4PLZA 2W6IA 1C1XB 1ZCZA 4I3GA 3BIWA 2HSJA 1YAXA 1NVWQ 3ISJA 5E8JA 4C4YA 1JR3A 2V7XA 3PTLA 4KVAA 1PZGA 1LDEA 2J0UB 4UUAA 1ANKA 5F64A 5DGCA 1OAAA 1OH8A 3NJAA 3N8HA 1AK9A 3NTUA 3G7NA 3QU9A 4HJRA 5CB8A 4LMRA 3L4BA 5GLAA 4XH9B 4OUDA 1KPIA 2WHEA 4H1VA 5JS8A 2JVKA 1E1LA 4QL3A 2JATA 4QD4A 3QX3A 1I0IA 1OUMA 4C0WA 4YP5A 2FFJA 1KA9H 1WDKA 1XQXA 5DKKA 4UM9B 1C3VA 2OXRA 3ELUA 1QZZA 1TMNE 2FEWB 4W7SA 3TQCA 5J4HA 3LBIA 2JFFA 4JELA 3RVDA 4F6LA 1PZOA 1HKHA 3EFBA 2ODTX 4J0JA 3IO3A 3NQXA 3C7VA 1N3YA 3LXRA 4BQMA 1WTCA 4KQGA 4Q1FA 5DRTA 3SMQA 3ULKA 3SS3A 3COVA 1NI3A 3I42A 2G9QA 3OZDA 4DRYA 1QKIA 4ENPA 1NX6A 2ZQ9A 3X44A 4B4VA 3PSHA 4CMCA 4UAUA 1ISGA 3RS9A 4UM7A 3GPBA 2H5IA 4CV0A 4X3CA 2IPOA 1KZYC 1W5TA 2I1VB 1QMEA 4ZEOA 5L7WA 1E2QA 4QQKA 2PS1A 3RWMB 2W2TA 4I5FA 3RVSA 3TNLA 3ZW9A 5CM2Z 2BGIA 2BN4A 3RO7A 3Q07A 1E2IA 2BJHA 3L4EA 3H1BA 1N3LA 4REQA 3ODPA 5JI2E 1JFSA 2WYHA 1RPTA 4ME4A 2IWCA 3DL7A 2P7HA 4GN2A 5JS2A 2WFLB 2WVHA 3T5GA 2ODPA 2CDCA 4EBNA 3SFZA 3SE6A 1TVEA 1CT9A 4C76A 4B3CA 3T54A 4H08A 4E94A 4Z53A 3RTYA 3QVUA 4CMBA 4B2PA 3IF6B 5K3AA 2PBLA 3WTCA 5HHTA 1F2KA 4Q16A 4QASA 5JATA 1G5QA 4CU2A 4EAQA 3P7UE 2BWJA 1IPFA 2ZBGA 1ZNWA 4PIMA 5LQJA 3HUFA 5D2CA 5L8VA 2VKSA 4CT5A 4H60A 3ENQA 3GGPA 3R4CA 1P5HA 3CKLA 2W2LA 3O7MA 5F98A 1CPYA 4M53A 4OF4A 4QYIB 5CAEB 2DUWA 4OP5A 4BP3A 4V1CI 2I9KA 2XQZA 5FNVF 5AI4A 1TKBA 3F1PA 1H2BA 3E9CA 2VEAA 4G4JA 1BYWA 4HWGA 3SN6A 2Y8EA 1H8ZA 2PD7A 3IOCA 2FQWA 3N86A 3KZCA 4S0XA 5G2OA 3UAGA 5IJWA 5JDIC 2CLHB 3HBJA 1KRXA 1DKLA 4O4HB 2IZ5A 5DHAA 5F7ZA 2QJ7A 3QBDA 4FBLA 221PA 4I9UA 2X0FA 3DAFA 1UKVY 4HGOA 4CDNA 2FA9A 2HRCA 1DC3A 1G19A 1T1JA 2IDJA 4L8FA 2VPIA 2ATVA 5CUQA 4D91A 4NNPA 3B7RL 3PC2A 1YA6A 3TINA 3DZBA 1JHQA 2O2EA 3PGA1 4FS8A 3TOSA 1HGXA 1IE3A 2FZWA 2YFKA 1E2DA 1KGDA 1PNEA 3B3GA 3ZWQA 3FCEA 3WWDA 4ZCTA 2XSSA 4KQ1A 3AB7A 2IYEA 3DMDA 4M86A 4R54A 3W8NA 4BBVA 2GBFA 5AW0A 3IEPA 2GFIA 1XV5A 1ZD2P 2APJA 3N07A 4KIFA 3Q40A 3TK1A 1EWQA 4X1IA 4E5MA 5AJVB 4URYR 2JJYA 3GBVA 1N78A 5G18A 4ZWNA 3E9MA 4GOKA 4ZRNA 3WVNA 1W4ZA 5HJ7A 2WM3A 2QT0A 3NOPC 4K9LA 5J2TA 3HK2A 1XDZA 3WMXA 1GUAA 1SELA 1Z37A 4DIMA 3G02A 2C5LA 1ILWA 4G5GA 1SJ9A 1O2DA 1YBAA 2D3TA 5HF9A 4C3UA 3BH0A 4KKXB 4R1PA 2WKRA 2QX4A 3DTVA 1O6FA 1YCDA 4WMCA 2EBUA 4L7VA 3SAJA 3V3KA 2GTPA 1CR2A 5IU6A 4KPEC 1NXYA 2O4UX 3ER6A 1KKMA 4TWBA 1H65A 1TRLA 2BDUA 3HR8A 3FKVA 5DNUA 1Z0FA 5I01A 3OOHA 3HLWA 4UZFA 5EFOA 5H8WA 3TEMA 2QD3A 4DR3B 4ZJYA 5A4MS 3BLSA 4F6RA 2ZK7A 2I6TA 3A2KA 2GEFA 4BLPA 4C6RA 3WYGA 4F1KA 5ILGA 2Q2QA 3GJXC 1PE8A 3PNBA 4Q02A 1DIGA 2DQZA 5CIWA 4ZO8A 5K0FA 1XLTC 4H4EA 1BDHA 3U39A 3R3YA 4DLNA 3FHEA 3OQPA 1AN9A 2BKXA 1FTYA 3GT4A 5EKUA 4AT1A 5J2UF 3SIRA 2I67A 2OB1A 4H16A 2JFXA 1G8HA 3WGMA 3WHPA 3G2JA 1U0FA 1U3GA 3GV9A 4GX1A 4RS3A 5K8TA 4XSVA 4CLRB 1Q83A 4R0MA 1GUDA 2FYTA 4Q4JB 1XDDA 1U4GA 2H3EA 3D3WB 4FUTA 1CEGA 5FLEX 1G6OA 2PN1A 2VEDA 2HP9A 4RK0A 3P5SA 1SVUA 3K6RA 5KOJB 2YY7A 4TWZA 2P1DA 1KC3A 2HQBA 4GD8A 5CK4A 4LY0A 1S66L 5L40A 5TC4A 1PJ3A 4B2YA 3THXA 3AVPA 3TIXB 3RYCA 4NEQA 4W9RA 3UB3A 3QX8A 1AKQA 3NHLA 3RH0A 5ENDA 1WX1A 3AR8A 3DTNA 4OO3A 1CSEE 1QIFA 2JH8A 5T4HA 3ZBUA 4OQ4A 4OX9B 4UMVA 2FEAA 2F8SA 2ZPAA 1NVFA 4W9MC 1LQTA 5CLLA 5HM8A 3UPUA 2X2FA 5AW6A 1ZR4A 2YHIB 4NYIR 5C7IO 3HDYA 5ADVA 4C2AA 5IYZA 3B1VA 3M9WA 2Q4OA 3BPSA 3E9DA 3A3DA 1AE1A 4PGGA 3K8YA 3QGOA 1YDFA 2I4IA 2ZJ3A 2XB9A 1ZGHA 2V9AA 1S89A 1JI0A 2PXXA 4EFNA 1XMJA 5EZSA 5TS2A 1V35A 1Y42X 3OTWA 2HA0A 3GZ4A 2WV9A 2UZ4A 4PW4A 1E6MA 1BIFA 1GEEA 3Q3HA 2AX3A 1RGZA 2YDXA 4YRJA 3KD3A 2IL1A 4J1NA 4QEDA 4FDMA 4CLCC 2JLSA 4LXHA 5DXAA 2HCRA 3DF9A 4ZT4A 1M40A 1UFRA 3U62A 2VJKA 2BDEA 2DSTA 3RF7A 1Y9DA 4DSTA 1KETA 2WHZA 1L5HB 1VCOA 4MJ7A 4Y3IA 1EJBA 3CXUA 4Q3AA 4CLRA 5KOHB 3LPCA 5FWDA 3P71T 1J8MF 2GRUA 3V1UA 3RLIA 4R7GA 1I0LA 4R69A 3ZKWA 3DO8A 1FFGA 1PX0A 3MOIA 1DO0A 3JPUA 1HSOA 1D4ZA 4KIJA 1SZPA 2DMRA 4LBVA 3DVSX 4N01A 5CB0A 4D9EA 3DXFA 1FFXA 2FN3A 2G71A 3ZQ6A 1E66A 4GOOD 3NBLA 1VCHA 4PBRA 3RJ5A 5FR2A 1Y5NA 5EVIB 4R0QA 5T57A 4DSNA 5JBNA 2RI6A 3IULA 4OLAA 4IKPA 3BM5A 4MUIA 3SBDA 1MAVA 1F9IA 4DC0A 4YIHA 5CURA 3INNA 3ROFA 1EHCA 5H9VA 1JEYA 1SKBA 3FZNA 1J99A 1GCEA 1HTZA 3E4OA 3QJ5A 4U2DA 4B6GA 1HRKA 2RGAA 4QDXA 4YRQA 4COOA 2VTVA 1JYEA 3QX9A 1ZD9A 2VAWA 3BFFA 4GRAA 1X0OA 1GHMA 3G34A 2RCXA 2WUGA 2AMFA 3ZLUA 3IEMA 4PPYA 3N8LA 1N25A 3RIEA 3Q6IA 4JOQA 2V7GA 3MXQA 4FCFA 3BL5A 1UC8A 2GR9A 1PWDA 4ZRRA 1IK6A 1IQPA 3CRVA 4NZNA 1QIKA 5F1PA 5I7WA 1QF1A 3QLVA 1KDWA 1IIRA 4XM0A 3KO6A 1RHKA 4S2OA 4X6TA 4MPDA 5C7YA