4IHQA

Archaellum assembly atpase flai bound to adp
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
512
structure length
512
Chain Sequence
SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILLRMRLSVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKFSRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGAIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FlaI ATPase
publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
total genus 165
structure length 512
sequence length 512
chains with identical sequence B, C
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ihqA02
3.30.450.370 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ihqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ihqA03
2XNDA 2V7QD 1IHUA 1SXJE 2AN9A 2R6FA 4PO9A 3WRYC 1P2SA 2PEYA 3VX4A 3AVVA 4Z1MD 4C2TA 4BFYA 4ESVA 4AKHA 1TNDA 2UZIR 4NU0A 3EZ9A 2RGEA 4DT1B 1DAFA 4AC9A 2VTKA 3TK1A 1AS3A 1M7HA 4BUJA 2JJ8A 2XNDD 2FJUA 3DL0A 1G8YA 3QUSA 2QQEA 3PUXA 5EQTA 1VIYA 4EUNA 4K46A 5IHPA 2GCOB 1SKQA 3CZPA 4L15A 1S96A 4Z8YA 2GHIA 1KIMA 1W2GA 2QE7D 3P1JA 4Q02A 4ZKEA 1SVIA 2Q9AA 1HUQA 2ZAMA 2AX4A 2ZJBA 5C46F 3TSZA 2D74A 2D2FA 5J5CA 3THWA 4YLGA 3H4MA 1EGAA 2E87A 2H8KA 4PPFA 3H86A 4G0NA 3QI2A 4Q7LA 4TL9A 4PPGA 1AQUA 3T35A 4B34A 3VKGA 1N6OA 5DSZA 2J0UA 3SFVA 1KI3A 2G0NA 5CB6A 4LHWA 2ONKA 2VL7A 4R7ZA 5DH9A 4P3YA 2PX0A 2HT1A 2XNSA 2X19A 1N2CE 1BYUA 4PO1A 1G20E 5JRJA 4M1SA 4ZV4A 3B13B 4LV5B 5FTJA 4AD8A 4BLSA 5GVRA 1IONA 4B3GA 4D25A 1YZTA 4FN5A 2NGRA 4NPHA 5DI3B 2RGNA 4ITRC 3SBDA 3AGQA 3KJEA 2ZSDA 1KOFA 3A36A 3K9GA 3QEOA 1Z0AA 3V4RA 3CM0A 1AZSC 2BBSA 3UIEA 1YRBA 3OIWA 4P31A 2Z4RA 3W3ZB 3PVSA 1CEEA 1ELOA 3FYHA 3UK6A 3THXB 2XAUA 4D6PA 2IYYA 3KJIA 4NHOA 3AKDA 3BERA 2WJVA 1XDBA 2D4HA 3OESA 3D3QA 4TLEA 3TVTA 5CK4A 3CIOA 4GFDA 2FDCA 4A6PA 2VP0A 3RS7A 3CBQA 3IKJA 1NVWQ 2OESA 4EJSA 2ZSFA 4BFUA 1Q1BA 2QGNA 1E4VA 2Q6TA 5LDDC 1GWNA 1VIAA 3QJYA 4JLBA 4LYHA 5E7MA 4C7OB 4V0ME 4FW9A 2PCJA 2ZRGA 3TAUA 1D2MA 3B7GA 2OZEA 1L8QA 1AS0A 2RGNC 3IQWA 4ACBA 3EPHA 1OT3A 621PA 4ILEA 4FI3C 4Q4JA 5JBQA 2NQ2C 4Q00A 3HU2A 3KJHA 4P4SA 4D4LA 2RGAA 3IGFA 4XVUA 3B85A 4D4MA 1E0AA 4D0LB 1UEIA 2KBEA 4C4PA 3C8UA 4HUQB 4HI0E 4NE2A 1IN4A 4B33A 1Z6XA 1HTWA 4N3NA 1PUJA 3VX3A 3NBZC 4G3XA 4EJSC 3THYA 1HE8B 3FB4A 4Q48A 1OH6A 1X8JA 3WHKA 4HLUA 3W34A 3W5JA 2B7BA 5HZKA 2HCJB 3M1IA 1WA5A 1QHHB 2IYWA 5L3VA 4FXPA 1X86B 1AGRA 3EZ7A 4TYPA 4PPNA 3TAHA 4AKEA 1U90A 3KQNA 2X77A 1S2MA 1NBME 1ZP6A 5FUVA 4V0LA 1SULA 4XD7A 4CEJB 1CULC 4HATA 5FI1B 1Q1ZA 3WYFA 4LRWA 2GDJA 2J87A 1Z08A 3TIFA 1U81A 2WPDA 1GIAA 2UVQA 4EDHA 5BYKA 2HDNB 1FMJA 1B0UA 2B8TA 3S1AB 1W4BA 4JBXA 5EJEA 4U5XA 3OHMA 2OUKA 4HLUC 1UBEA 4I1VA 5E7IA 4C0AC 2BWJA 3RS3A 5TVKA 4XD7D 3BB4A 4RZXA 3AQ4A 3ETLA 2EFCB 3RRYA 721PA 1DAEA 1E2PA 4ON9A 1P6XA 1EFRD 2WPDD 1ZC3A 5HE9A 2B6HA 1ONBA 4W5HA 1A7JA 4LYFA 2GNOA 1N6RA 3LAWA 3TJZA 2ZRJA 2ZYUX 4UNNA 1KDOA 4BFWA 3UANA 1Z63A 3FGNA 2G83A 1XZQA 2B8WA 4F4IA 2GESA 4OHYA 2HF9A 1NL3A 1N25A 2B92A 5DO9A 1IY2A 3A1VA 4DLUA 1GKUB 4GNKA 4CZ2A 3OF5A 3GLIB 3P27A 2H57A 2QORA 5LD2B 2ATXA 2P2LA 4BRWA 2ZRMA 3NBXX 4TQUS 4DXAA 3EA0A 1COWA 1U0JA 3MWYW 5EP1A 1A1VA 3ZD6A 1VYTA 1FP6A 2P5SA 2WKRA 5DYIA 5FPTA 3U60B 2QROA 2JLUA 3NDBB 3X1XA 1LF5A 3EC2A 4M1OA 4Q19A 3U5ZB 3B1ZA 4BWYA 4WZ6A 4XWOA 1DG3A 3W6NA 4YMUA 1GNPA 1BS1A 1CJVC 1JPNA 2VHTA 3W6PA 3ZQ6A 1CJKC 1N6IA 3EWAA 1LVGA 3LXRA 1YR7A 4OI0A 4UNPA 3K0SA 4IFBA 2WAYA 2A2ZA 2WTUA 1E2QA 1U99A 4QHTA 4C0BA 4H1UA 1TQ2A 2XTZA 1K5DA 2CLSA 5EUQB 3TSOA 1ZNWA 4A1FA 4MRRA 4LDJA 3KQLA 3SR0A 3KFXA 4QFMA 1CS4C 1XD2B 1DADA 1XFAA 1M7GA 3BJIC 4R98A 2CLDX 2IWRA 2FNAA 5JWRA 5GJWC 3PEYA 1CR4A 3Q5DA 3O8RA 1CLUA 3LVRE 4NCNA 5JECA 1CR1A 2ERYA 1R4AA 3HDTA 3SFZA 1N6NA 2VIIA 1Q22A 3AB3A 4UJ3A 1CXZA 3Q7QA 4PSAA 1D9ZA 1KK2A 2OG2A 2IUUA 1G1MA 4KLNA 4BECA 5C4MA 4B6FA 4C0SA 4GZLA 5JJKA 4KO8A 3WP0A 4IDHA 3IHWA 4D0NA 4DSNA 3FDIA 1OXTA 4RCYA 4B6EA 4BEJA 1WF3A 3R7WA 1P9NA 3KTAB 3X1ZA 2MMGA 4JLVA 4Q9JA 1JQJC 1II9A 3UG6A 5J40A 1KI6A 1I2DA 4LZZA 4DDUA 3DOEA 5FBQB 1FX0B 1DAMA 3AUXA 4Q5IA 1RW4A 5E4FA 5FBLB 3VR2A 3ZJYA 4D2IA 4ZPXA 1CJTC 1R5NA 2OLKA 3ICQB 1H8HA 3TBKA 1KZ7B 3M4YA 1UM8A 1D9XA 5FPKA 1OXSC 5D3QA 2G0TA 4QKQA 1NVVQ 1EXMA 1ZYUA 4TMZA 4DSUA 4QBFA 5KDLA 5KSOA 2WJGA 2E1RA 4A0RA 4ZIRB 2BHRA 2YOFA 1H8HD 1CKEA 4RCZA 2C77A 3TUJC 3K70C 1R8QA 2CL7X 3U3RA 2PJRA 1VG0B 3NHBA 3HU3A 3DM9B 2F6RA 3FTQA 1P2TA 1IJFA 4S2EA 2NO6A 3QF4B 4KITB 3GEEA 1JB1A 3W90A 2H7VA 2W58A 5CDFE 2ZI3A 4IXNA 5EE1A 4J0QA 2QMEA 3QBTA 2ZQ5A 4CEIB 2ZIAA 4A2WA 4JLDA 2ECKA 3E5HA 4JSYA 4B71A 3MG9A 4Q1DA 1QRAA 1CBUA 1NJFA 3O8DA 2RGBA 3PITA 1VG8A 3N2IA 4GI7A 1OE0A 3HU1A 1G7CA 4PC2A 2A78A 4NYIR 2ZI9A 1SKYE 3BXZA 1US8B 3SJAA 2D62A 3B82A 5DN6A 1QHGA 1U9IA 4B44A 4QBHA 3LQRA 2W0SA 4BFSA 2IXGA 3T61A 4G5QA 1OV4A 1G3IA 5J4LA 3GQBA 4PTLA 1Z8FA 1E79D 1GAJA 3QENA 2YWEA 1R0YA 4I1UA 1L4UA 2C9OA 2EU8A 3R9XA 2GJSA 4TMWA 4C0HA 5BN4A 1TUEA 2BBTA 3K0CA 2W6JA 1SVSA 1OIVA 1HT1E 1SVLA 2OCBA 3GP8A 3U44A 1DOAA 2NTYC 3OAAD 5DN6D 3KKMA 1JPJA 2IX3A 2ZANA 4EPXA 2QG6A 1GILA 4O3MA 4OHXA 4DZZA 1HY3A 4PR0A 5FI0B 2N46A 3U6KA 4NTZA 5TXGA 1DO2A 3WBKA 4R2IA 4XSHA 5K8IA 5F98A 2GRJA 4URUR 5F9HA 1T91A 3TH5A 3HYTA 1WQ1R 1U9IC 1ZCBA 3FKQA 1NIPA 2W6JD 4LPKA 3KQKA 3GLHE 2HYDA 1WMSA 2VBCA 4ARZA 1AK2A 3OFND 4KU4A 2ZJZA 1Z6AA 2OLJA 1KY2A 2GBLA 3K0CC 1E0SA 1SVWA 1W4AA 1J8MF 3TE6A 1IN5A 3NEJA 2YV5A 2BMEA 2Z0MA 2ZETA 4BRUA 2ZI6A 1D8TA 4NZYA 4HAYA 1S1MA 2GZHA 4Q1FA 4WVFA 4WIAA 3VU9A 1E2LA 1UDXA 2JASA 1W36D 1W48A 2WM9B 1Q44A 4PQYA 3T1VA 2QT1A 5KPDA 5ELXA 2DY1A 3BH7A 3RSOA 1JEDA 1KK0A 4PQFA 1NF3A 4AURA 3I62A 4NKRA 4PXAA 3B8HA 2PH1A 4AK9A 3B1WA 1I4LD 3FMFA 1W36C 2XXAA 2Z4SA 3B78A 1J90A 1DBSA 4XWAA 2VEDA 1AJEA 5FFMA 1X8KA 1NSFA 2GKSA 3TR5A 3QXCA 1E1RA 4F7WA 3BS4A 3BFKA 1Z06A 1W5SA 4GP6A 3FHOA 4PC3A 4UXIA 2P67A 2ZRIA 3TSWA 3FE2A 3MUFA 4DDVA 1BIFA 3LLUA 1G5PA 1KNXA 3EPKA 4P4SB 2O0HA 2Y8EA 4QJ3A 1VTKA 3TUZC 1GRRA 1PJRA 3AVTA 4I1OA 3IUYA 1DO0A 1TF7A 2IYZA 2O5VA 1HH4A 5CM8B 1CF4A 1JR6A 3BAFA 3GFTA 4CT4B 1XMJA 4B35A 3ZZTA 1W0JA 1SHZA 4JVSB 2NO9A 2RCNA 5KSYA 1JALA 1GOTA 2NPIA 3KX2A 4JZKA 2FV8A 5FOXA 3H2YA 4PZLA 1XTQA 1E2MA 2HEIA 5AJZA 2F7SA 1D6JA 2GWHA 5DI9A 3VKWA 1Z83A 2CHQA 4OJKA 1PLLA 3VR4A 1MO4A 2BMDA 2RB4A 2C2HA 4V02A 1W0JD 3C41J 1T0JB 2DYKA 3U7HB 3ZZ0A 2MSCB 3RRMA 1EFHA 2OBLA 2WICA 5HPYB 3U4QB 3GD7A 3QY0A 4DB4A 2G1KA 1JR3E 1SVOA 4NYMQ 1SXJD 3I1FA 4OKSA 3SZRA 2QY9A 5HKKD 2A9KA 1FFHA 2O8BA 2HLDA 4Q7JB 4NCHA 4DBLC 3SC3A 1QF9A 2CJWB 1FP7A 2IUTA 4IDQA 4YONB 4Q9HA 5KUTA 3FHTA 2NZ8A 4WAUA 1E6CA 2IXFA 3QKRA 4M9QA 2J0SA 4CT5A 1RE0A 4B48A 4F4JA 1SXJC 4FCWA 4ZCIA 1U0HC 4ERNA 1NLZA 4LYAA 1VHLA 3LV8A 1Z0IA 2QAGA 3I92A 1S4QA 1IXRC 4TWZA 3VTKA 4DLRA 2HLDD 4NP6A 3NC1C 2CHVA 1WDTA 4OK3A 2ZRCA 5H1YA 1Z0DA 2QPAA 5CITA 4A15A 3WXMA 3MJRA 3RABA 3DHWC 1N5KA 1M1YE 3WHLA 4E07A 1G4AE 4YXWA 4C0JA 3ADDA 1RJ9A 1G5TA 1V43A 2OHFA 3OEED 1SZPA 1KMHA 1P60A 2BKEA 3UWKA 2V3CC 1XEXB 3AUYA 4CIDA 4TLBA 1DEKA 1XWIA 2ZVQX 4LWZA 1W5TA 2KBFA 2Q9CA 1W47A 4WBSA 2GXQA 3WRXC 5L3QA 4LX0A 4YXWD 1G8GA 4TL8A 1JI0A 2FA9A 2JATA 4D4KA 3OZXA 3CWQA 4B32A 3Q85A 1QDEA 3NVAA 4HZIA 5BN3A 5JSZB 5P21A 3X2SA 2ZE8A 4N1AA 4NONA 2AK3A 1FUKA 2GEDA 3QKSA 1ESNA 3OE7A 2PX3A 3SS8A 3AV0B 3ZVMA 2VF8A 2AHOA 1OLOA 5FPSA 4V0KA 3LNCA 4TMXA 4GDFA 1C9KA 3IIKA 4C3ZA 2DB3A 3DZDA 3GJ0A 3EIEA 4TTQA 5JHHB 2DFNA 4TLDA 3RDPA 2D7CA 3R20A 4QOSA 1KJYA 1XP8A 4QGAA 3RS2A 1FPMA 1XXHA 2J41A 2V6JA 1NG9A 1TADA 2JLQA 5F3WB 2GETA 1X1RA 3OE7D 121PA 5SZKB 2WOOA 1DAIA 2ERXA 1FOEB 3ASYA 2ZR7A 1F2TA 3C4JA 1R0XA 2ZUDA 3QEJA 4DLTA 3M0EA 1FW6A 1W7AA 3RANA 5L8VA 4BPBA 4N0EA 4IOLA 2H5EA 3VNVA 1W46A 4B3BA 1AGPA 3PEUA 2I1QA 5H8WA 1M34E 2ZJ2A 3R7WB 3DM5A 4ASUA 3KFVA 3T06B 1E9DA 2FU5C 3K70B 1VCNA 2C5LA 1YR9A 2IW3A 2VHCA 2D7DA 4OI1A 1P2UA 4D26A 1W44A 4TQ9A 1RYHA 4I99A 4ESHA 1QHSA 1VHTA 2ZS8A 3ADBA 4ASUD 1ZM9A 3W8RA 4IOJA 1TF5A 1UKZA 2GJKA 3CNNA 2IYXA 5TB5A 1J70A 4TN1A 2DFTA 2V7QA 4M9XA 3HPQA 1Z2AA 3GJXC 2ZREA 4EFLA 4EPYA 1W4RA 2R65A 3R8FA 2PT7A 3ADCA 4UXJA 4A9AA 1LB1B 4Z1MA 1E96A 2Q21A 1G3QA 1HQYE 2A30A 2C8VA 2O8DA 1YJ5A 3ZQJA 1E69A 3OEHD 2CE2X 2HF8A 4ZDKA 3RC3A 2F43A 2RKOA 3K1JA 2G6BA 4G01B 1SQ5A 1ZU4A 4B73A 1EFUA 4I81A 4LY6A 4EAQA 3QE0A 2V4ZA 4HB4A 3QSYA 1MO6A 4NMMA 4F4CA 5EP3A 2QAJA 3EA5A 1XMIA 4M1MA 2QE7A 1VCMA 3GLFA 2XEXA 3MJHA 4Q18A 1GP2A 4AY2A 1OKKA 4NYJQ 2BBOA 3EPJA 4PSKA 2ATVA 4JLOA 3UG7A 1YZQA 1ZCAA 1KI1A 1JBKA 1OXUA 1YKSA 1WXQA 1ZAKA 1S8FA 3MGCA 3LY5A 2OBMA 4L8GA 2J0VA 2RGCA 2YINC 1KSFX 2WJJA 4WW0A 1OKKD 4R2HA 3B1VA 821PA 2HJVA 4M22A 2BMJA 3MWLA 3FPAA 3I8XA 3U44B 1XEWY 3CR8A 5D3MB 4KV9A 1TMKA 3A1WA 1MKYA 4A0GA 3LXXA 2WWGA 1SHKA 4OQFA 2O8FB 2WVJA 2FZLA 1E32A 1ZUIA 2F3TA 4C0LA 5JS8A 2A3RA 3BBPA 4Z8XA 3QBVA 2OXCA 3RNLA 1MOZA 4C0QC 1WB9A 2EYUA 4OJQA 3ZZUA 4OQMA 3GLIE 1NKTA 2W2XA 4TLAA 3AVYA 5ANRB 1KDTA 4ARZB 2AD5A 4Q4LA 1P73A 4W5WA 3REFA 5G40A 1E9BA 3KKOA 4Q9KA 1OHHA 4TQAA 4L16A 4ZDJA 1JEEA 3I5XA 1E2IA 2ZJYA 4UNQA 4JL8A 3WNDA 5FTLA 4BLOA 2ZROA 4RD3A 5FBWB 4Y0VA 3SHFA 1P72A 3DOFA 3UWOA 2QZ4A 2DWOA 1XD8A 2C78A 2V9PA 3IIJA 2PZFA 4M2LA 5AK0A 3KKNA 3MFYA 3VU9B 4GP7A 3QNUA 1PZNA 2WOJA 5JZVA 2QM7A 1OHHD 2YWHA 3NBFA 2BM1A 4IXMA 4EFNA 4HLQB 2KI5A 1FMLA 4UNSA 1G7TA 1FTSA 4JKYA 4U02A 4V0OA 2ZEJA 3GJ4A 3CH4B 4MRSA 4US1R 2RGXA 2XXAB 5CJ2A 1NN1A 2BJVA 1E2EA 1VKJA 3K0FB 4LHXA 1SVKA 2DHRA 4IFEA 5H70A 2NG1A 2HXYA 4LYJA 3LX8A 4KVAA 2IEZA 4W5JA 1UJ2A 2XB4A 3W3AA 2WHXA 1SVMA 2ODEA 5FOTA 1E94E 3AKCA 1R5BA 2I3BA 2X2FA 3FVQA 1OYWA 3Q5EA 3VAAA 5LB2A 2JLYA 4Q4HA 2ZRHA 3GLGA 1CR2A 3CRMA 1GUAA 3VR5A 1ZW6A 1YR8A 3A6PC 1GNQA 3LFUA 4NCIA 4OYHA 2BV3A 2CVFA 4GBMA 4YDSA 3SHWA 1TQ4A 2FF7A 3PEVA 4US0R 2ASEA 4EPTA 5JJLA 1UDWA 4QJ5A 1NY6A 2W00A 3VKHA 2AKYA 2W0MA 5K8LA 4CRWB 2CEAA 3DEFA 4K81B 3PG5A 2O8CB 4DCTA 1G5RA 3SU8A 5JWOA 4M53A 4GZMA 1EFRA 2AL7A 3DDCA 2BM0A 4PPQA 4LJ9A 1NI3A 2A7QA 5DE3A 1MRNA 2UKDA 1Q3TA 2FX3A 1KO1A 1BYIA 2PCLA 3MRSA 4OI2A 3ZVRA 2YKGA 3CR7A 2FSFA 1CJUC 3I32A 5KDDA 2ZRDA 1G64A 1LS1A 3EWSA 4DKXA 3FKSA 4HZUA 4XOIA 5CYOA 1GL7A 2FGJA 2FGKA 1UFQA 4TMKA 4TYYA 2NZJA 3IILA 2WKPA 3SYLA 3R9WA 3HJNA 2JLVA 1J8YF 4DB2A 2ZAOA 2OV2A 2ZE5A 2PZGA 3CONA 5GVSA 3PR1A 5J4KA 4HEJA 1YR6A 5SZHB 3W8NA 1QHIA 3B6EA 1GVNB 3QKRB 1XBTA 4C30A 1ZUNB 4POAA 1ANKA 2H17A 3FKSD 4BFVA 2QAGB 1FQJA 3IBYA 4MH0R 4LHVA 1QZXA 1P9WA 1GL9B 3D8BA 1GSIA 2CVHA 4QHSA 4WOPA 1AN0A 4DEYA 4ZI2A 1YE8A 1FNNA 1UBGA 5C4GB 1LNZA 2OAP1 2CBZA 1G291 4RFSB 4MKGA 2CLCX 1DTSA 2IHBA 2P6RA 2DPXA 1RJ9B 2JLXA 4Q01A 2ZI5A 1KJWA 1MABA 2IXEA 2PMDA 2FPKA 1KMHB 3CWZA 1P61B 5L3RA 4IDNA 4E5UA 1Z47A 5J47A 4GOXA 4KVGA 2F1IA 1YVDA 3H1TA 4H1VA 3MCAA 2IA5A 1LF0A 3KUDA 2FSIA 3A1TA 4XVRA 4DCVA 4B47A 2HXSA 4DSTA 3UMSA 5L3QB 1XPOA 3K0AB 2FPLA 2ZRBA 3QIAA 1KMQA 1T6NA 4P4TA 2IS2A 5FL3A 5GJVC 5KTYA 2A5YB 3T1TA 4ZCMA 1AQYA 3W6OA 3QXSA 5EZ6B 4BZXA 1PUIA 1ESMA 2OCYC 3TNFA 5IK2A 1AM4D 2VP5A 4PZZA 4B3XA 3QKSB 2PZEA 4CDGA 1XCPA 3CRVA 4MQBA 1KHTA 4UQOA 3N5CA 2FN4A 1KDPA 1F2UB 3BGWA 4X8OA 4M1WA 4ZO4A 4F92B 3QG5A 5LB4A 4DLXA 1ZM2A 3K8YA 3L0OA 2ODBA 2JJ2A 5EZ5A 5IK2D 4UJ5A 2QEQA 3O8CA 1R10A 1HURA 1NMZA 2L0XA 3L8ZA 2XZPA 5FTNA 1JXOA 4IRUB 3UATA 4IJMA 4RSGA 1RYFA 1G16A 4LJ7A 2J46A 5G41A 1JECA 1GKIA 3ECCA 4JL6A 2C95A 4CEHB 4PAMA 4AG6A 4F93B 1ZM4A 2JJ2D 1IY0A 2EVWX 1KI4A 2EQBA 2MMCA 2ZI7A 1EG7A 5AR1A 5AUNB 5F2EA 2G3YA 2P6UA 1N5IA 2ZUBA 4L9WA 3QKTA 5FPYA 4P32A 4NBSA 4KYUA 4LJ5A 1G18A 1R7RA 1V5WA 2J5XA 4Q1AA 4A8JB 4AG5A 4LC1A 4CVNA 1RIFA 1X1SA 2IF2A 4IKEA 4YMVA 1JJVA 4IEEA 5AUOB 5FUWA 2QMUA 3SBEA 2IUSA 3SI7A 1E98A 4U7DA 4CGZA 3Q72A 1KDRA 3IHLA 2NPFA 3WBJA 4TYNA 1MO3A 1XJCA 2IBMA 3JVVA 1XTKA 1YZKA 5KO2A 1XU4A 2X8AA 4LSGA 5JI2E 4B3FX 4HAWA 1XTSA 4W7SA 1GZSA 2C9CA 4G1UC 4X8HA 1YRAA 2R62A 4MRNA 5BYJA 4KFTA 1E9AA 3PUYA 3P4YA 2ZS7A 2ZE7A 1UAAA 5IF9A 1Y3AA 2V1XA 4QBGB 2QBYA 1G3UA 2J3EA 4M0LA 3GFPA 4JKIA 4MUBA 5EXSA 2ZRAA 2ONJA 2O8DB 3C7KA 4A82A 4LBZA 1G21E 3SEAA 2F43B 4V0NA 2RGDA 2OO7A 1R8SA 2H92A 3CB4A 2OFXA 4EIWA 3B1XA 1WCV1 1E79A 2CMKA 3V9PA 1CRQA 2WAXA 3WP1B 3TGPA 5B64A 3LX5A 2DR3A 1NMXA 4HAZA 5TARA 4YMSA 521PA 2Q3MA 4EPWA 4B74A 1CTQA 3G82C 5JMTA 3U6BA 1OH7A 2XTMA 4TSFA 3OAAA 4BFZA 2IS6A 4CF7A 5FPHA 4JYBA 4LC0A 4KHZA 2Z83A 5AWFC 1OFUX 4DLYA 2BMFA 4UNRA 8OHMA 4JLNA 2ZJOA 2CDNA 4CYMA 2GILA 5HCIA 2QA5A 3OIYA 3QKUA 1F60A 4O2RA 1E9FA 1G7SA 2O0JA 4TSFD 4GPTA 5E3HA 3PUZA 1JNYA 3CH5A 1ZNYA 1DELA 2GCOA 3CF6R 3IEUA 3OFNA 3CZQA 1GRNA 1KK1A 3HYRA 4JLAA 5FR1A 3C14C 1ZINA 3X1WA 2LCFA 2YYZA 2G88A 3KXLA 4LBWA 3THWB 1EFTA 4IW3B 2JLRA 2J59A 3SJZA 3OIUA 4H9GA 2ZXUA 2EFEB 4RFVA 1N6PA 2WWXA 4F38A 1EWRA 2J0UB 1YHNA 2ZS9A 1RRGA 3KL4A 1G8HA 2HJGA 2IF0A 4IDOA 4D80A 4M1TA 3AF1A 3Q8XB 4DHEA 1VYUA 3P20A 3DZ8A 3BFVA 3KKQA 1YZLA 4Y0AA 2WKQA 1G8PA 1ZUHA 4OL0A 3WNBA 1X3SA 2X1VA 1K8RA 1RRPA 2W6IA 4MYHA 5HZHA 2ZSAA 2YWFA 4WZAE 5GJBA 1E1QA 1N5JA 4Q47A 1E2JA 1HQCA 1I4DD 2D2EA 4Q21A 2UZ3A 1G17A 4DIDA 1VECA 2Z6VA 3JZAA 2RH5A 2HYIC 1QVAA 2CCGA 5JRZA 2PLFA 2AR7A 3K0EA 1ZIPA 4PC6A 2W6ID 4MGZR 1R6BX 4WXPA 4HYYA 2QP4A 1E1QD 1U98A 4EJSB 3THXA 4XJXA 1S0UA 3LQQA 2EFDB 3ND8A 4TL7A 1Z6GA 1ZC4A 4FWTA 5F9FA 2QM8A 2DFKB 1G4UR 3AH8A 4MYCA 2NO0A 4MDFA 1T3HA 2FH5B 5FOVA 1VDZA 1TQDA 1RRFA 1UF9A 1CIPA 4FMBB 5M04A 4NCJA 3T5GA 4Q4JB 1GRQA 4OHWA 4DLVA 2IS4A 4G5OA 2QSYA 4DCNA 1CJMA 5J4YA 3QF7A 1TL7C 1NSTA 1GKYA 1M2OB 1AA9A 4EPRA 2VSOA 3BWDD 3THYB 1VG1A 3GLGB 4KBFA 1XD9A 2QTVB 4A92A 6Q21A 4B76A 2QSZA 1KSJA 4HUQA 1KSHA 5L3SA 4KFSA 3K9NA 4AYWA 5BWMA 4MDEA 2VHQA 1Q20A 3F3YA 2IYTA 3CLVA 5FUYA 2FG5A 5EE5B 5AJVB 1O87A 4PZYA 3O8BA 5FUXA 2VPPA 4OBEA 1SXJA 221PA 5SZIA 5HKKA 3PV0A 4TT3A 1Q57A 2WSSA 3CRQA 1Q12A 2GZAA 3CX6A 3WMEA 1KK3A 3KZ1E 5LBIA 3B1YA 3ZGXA 3GMTA 4BLQA 1BO6A 1HEIA 3RLFA 3KDSE 5FBRB 2ZRKA 2CL6X 4JLMA 4HDQB 1SGWA 3L8YA 3TUIC 1Z22A 5KNCA 4YMWA 4TT3D 4B2LA 2WSSD 3B2EA 4DSOA 4M8NE 1Q3HA 1GFIA 1KKMA 4O0MA 3IEVA 3S1AA 1Q1QA 4HZUB 3LW8A 4TZ6A 1TQ6A 4LK2A 1DG1G 1Q1EA 2ZE6A 2YJTD 2ZITA 3AVPA 3EW9A 1G9XA 3IDQA 1U94A 3JVUA 4JJZA 3SYNA 3IO5A 3U7EB 4DJTA 2G1JA 2FOLA 3OEEA 1X8LA 5JHGB 2V8OA 3PIRA 1E9CA 2Q3HA 4DDWA 1P75A 1XEWX 1M8PA 2F1HA 2REXB 2WSMA 4IHQA 3KXKA 5TDHA 4AYXA 1WP9A 1QVRA 1KZGB 2FFQA 1GG2A 1E9SA 1T4GA 1XNJA 5FOSA 2XITA 1DE0A 4FCVA 4JVNA 5FR2A 1KAGA 2KSQA 4II7A 2HT6A 4HSEA 1LV7A 3K53A 1KAOA 4NYIQ 5DLQC 5B30A 2OXRA 5FOWA 2GJAA 1YZGA 1P4SA 4Q1CA 2BCGY 4KXFB 4KCGA 4HLDA 4JBWA 2C98A 2AFIE 1QG4A 4G5GA 2OE2A 5EXXA 1II0A 2ZRNA 3GEHA 2IC5A 4G5RA 4HDCA 4LI0A 5JS7A 3D7MA 5KU1A 4EFMA 3SJBA 3BORA 4OK5A 2IWHA 3B5JA 3FMPB 3KB1A 4JIMA 4JVMA 3IQXA 5EP2A 3GJ6A 3UXMA 3ZH9B 3D31A 3A4MA 4ACAA 4DRZA 4A36A 4LOAA 3NBYC 3G5UA 4DWJA 2MSDB 3DPUA 2C03A 4E03A 1YZNA 3K09A 1EK0A 2OCAA 1EWQA 2WIBA 3WMFA 5KHOC 1LW7A 2IHYA 2YVUA 1IXSB 2VQSA 1AS2A 4A4DA 1AKYA 4DIEA 4JT4A 1GITA 2SHKA 2ZPTX 3AVUA 1E3MA 4MGYR 1R5OA 2GXSA 4KODA 4MYTA 3BE4A 4MRPA 5LD2C 4V0MA 2WWHA 3ZVNA 3F8TA 4P0TA 4BLTA 3CNOA 3OIVA 1Z28A 1XD2A 2QQ0A 3BD9A 1KI9A 1PLJA 4GT1A 1Z0KA 2OAQ1 3A37A 4IOMA 2FSGA 1CU1A 5AUPB 2YNMA 3PCRB 2BCJQ 4BLPA 4CW7A 1R2QA 2WJYA 3LLMA 2PMKA 4XSGA 4KFUA 4YMTA 2ZVPX 1QHXA 1D2NA 3AKEA 3K09C 3TVDA 5BQ5A 2WJHA 1ODFA 1VCIA 4JL5A 1T8UA 3JZMA 4XVQA 3M6AA 2EWWA 4D0GA 1AIPA 5EE0A 1KI6B 3Q9LA 3BRWD 5FTKA 1I2MA 4XWKA 4PO8A 4IDPA 4TL6A 2OFOA 4D81A 3KTAA 3SQXA 1VCOA 1WBDA 4C0KA 5FTMA 2AXNA 5KSZA 2P5TB 1FX0A 5IRCD 2ORIA 2QMHA 3BH0A 1NBMA 3OEHA 2XGJA 1XEFA 4GL2A 2AWNA 1F5NA 1L7VC 1ZRHA 1FNMA 3ZS9A 2OFWA 2CXXA 2X2EA 3RS0A 3LO5A 4RD1A 4AI6A 1ZM3A 1O3YA 3A4NA 1ZIOA 5A0FA 3GFOA 5B57C 4DCSA 1KJZA 5JJIA 2ZJ8A 2G9NA 1NBMD 1UBFA 2P65A 4Q4AA 5TMPA 5JCPA 2LKCA 4X8LA 2NIPA 2Q3FA 4QRHA 4DDTA 2R6AA 1W4CA 5KNDA 3EPLA 3PXGA 2QP9X 3QOFA 4IVRA 2QBYB 3SYKA 3CX8A 4TTRA 1UKYA 5E95A 1NN3A 2JGNA 3CPHA 4UKDA 2GCNA 1ZNZA 1XRJA 3L82B 1XPUA 2QPOA 2W83A 3QF4A 4KFRA 1N0WA 4B2IA 4GMDA 1XCMA 3FWYA 1NLYA 1FZQA 3GJ5A 4CEIA 1S1CA 4TZ0A 3PUWA 2P0EA 2PL3A 5GJCA 3RS4A 1TUIA 1E99A 1EESA 1TU3A 2V54A 2C04A 3RVBA 3ICEA 3AEZA 1S9HA 1US8A 1II8A 4PANA 1C4OA 1NG1A 1NN5A 2AXPA 1N0VC 4JJKA 3TMKA 2XOKD 2N1BA 1A82A 1A4RA 4LBVA 2ZRLA 3I8SA 4URWR 2R6GA 4QM7A 2QUZA 1JJ7A 3AP1A 3KB2A 2OCPA 2G77B 2ZR9A 3LBNA 3GEIA 2BOVA 4FINA 2GEUA 4JLKA 2FPMA 1KGDA 1T0HB 1IM2A 3VMFA 3I5YA 3AVOA 3PEWA 1R0WA 3TW8B 4XIGS 4RY2A 3KQUA 1F6BA 2W2VA 4QXAA 1FUUA 1N6LA 3RWOA 3QPWA 1Z0JA 5BN5A 1R0ZA 2VF7A 4QC2A 1XCGB 3L0IB 2Z5FA 4QHYA 1UKVY 2RHMA 3IPYA 4RD2A 2RGGA 4D4JA 4DCUA 4QGHA 2EYQA 3AGPA 2PT5A 4QG7A 2ZRPA 3WMGA 1W36B 3HPRA 1NNEA 4FMCB 1ZMXA 4PHFA 2V55B 1L2TA 2WJIA 2K5UA 2I1VB 2ZUCA 4FIDA 2VP6A 1J2JA 1E0JA 1KO8A 1E4YA 4ZDWA 4LUCA 2F55A 1WBBA 3AM1A 2HUPA 5KYKA 2A5GA 2IYVA 4RD4A 2XTNA 1RRCA 3NH6A 2REBA 2QRZA 4LPSA 4GOKA 2VH5R 1KYIA 3E1SA 2WWWA 1U2RA 2GJ9A 5CK5A 4AIIA 3A4LA 3MWKA 1OIXA 2VYFA 4YC7A 2IT1A 4HLCA 3O47A 1XJ0A 3MSXA 4L5BA 4LJ4A 5DHAA 4JVLA 4DLSA 2QTFA 2YOHA 3QPVA 1JQLB 3QVUA 4ZDIA 2NO1A 4LV8B 1IBRA 4M4SA 3SE0A 2QENA 3CX7A 2H1LA 3LW7A 1RZ3A 5AJYA 3SQWA 4ZKDA 3THOA 1NVVR 1FQKA 4LJ8A 4URYR 4WXRA 4B3DA 1XTRA 4KAXA 4RVCA 5KNBA 2F9LA 2ZSEA 1XXHE 4DC9A 1UKEA 2DWPA 1NMYA 5AJWA 1MRSA 1IXZA 1WE2A 1NJGA 3R8CA 4URZR 2GAAA 3FHCB 1NVUQ 4TLCA 3KKPA 2FEOA 2VLIA 3QXXA 2VSFA 2TMKA 1U0LA 2VP2A 3HR8A 5CM9C 3UMRA 3ONWA 4PX9A 4RZ2A 2LKDA 2FMXA 4NL4H 5KDOA 2A5JA 5CDFA 3ZYCA 4A6XA 5L3SB 1XMSA 5BXQC 2O8EA 1DARA 2ZU6A 1L4YA 2KJQA 2XX3A 1FTNA 4MUAA 5EE3A 4AWXA 4BQSA 2F3RA 1E2KA 1SXJB 3D6TB 2GEVA 1ZBDA 3NHAA 2QN6A 3DO6A 4Q03A 3T5DA 3ZVLA 3PENA 3TKLA 5G3ZA 2IS1A 2BEJA 1P5ZB 1LS6A 3AF2A 3EX7C 2DFLA 1RPZA 3IIMA 1Z0FA 3REGA 5KSPA 2IYUA 1C1YA 4KBGA 3RWMB 3AVXA 5CYPA 4MITA 5LPNA 3U2QA 1NY5A 1OFHA 2XSZA 4GSYA 4OI4A 1KI7A 2R6CA 2V6IA 2ZYVX 3GJ7A 4R71A 4LHZA 3VHLB 3U3JA 5JEEA 2O8BB 1E2DA 2FWRA 1ETUA 2RHDA 3U4QA 2IEYA 2OM2A 1FL9A 2AWOA 2JLSA 4G5SA 1JAHA 2KE5A 1Z6YA 2VHJA 4MA4A 2AFHE 3AP2A 4XTRA 2KWIA 3B9PA 2CJWA 2XSZD 4HDOB 1OF1A 3KUCA 3R9IA 2E9SA 2GXAA 4PFSA 2VP9A 1MT0A 3BH6A 1RVDA 3E2IA 4R9UC 1B23P 4E09A 2B7CA 1TU4A 3Q3JB 2BC9A 2YWGA 2CCJA 4V03A 2JDIA 2ZR0A 3GLHA 4JS0A 4MRVA 3ZLJA 1P2VA 1OIWA 3KQHA 1W49A 4B2PA 3GLFE 3ADKA 4AYTA 1MR3F 1P62B 2C96A 1OXXK 2CK3A 1OFTA 3P4XA 3MWJA 3T1QA 3IPXA 3AKYA 4LJAA 3U7FB 5H68A 1A2BA 4FMCF 2JCSA 2FEMA 4DLZA 5CLLA 2Q0HA 1J7KA 2NOAA 2P3SA 5HTKA 1QG2A 2GA8A 4Q7MB 3WYGA 4HUTA 3T34A 2EWVA 3SOPA 2JDID 3TW4A 2IYLD 2QRNA 1F3OA 4OQLA 3TR0A 3T15A 1XEXA 4L4UA 4K8OA 2CK3D 3EC1A 3C16C 2J7PA 1OXVA 2OT3B 2CHGA 3WYAA 4YQFA 4NDZA 3W5IA 2ZJ5A 1NRJB 5HCNA 1XB2A 4QJ4A 4Z51A 1S3SA 1IY1A 4Q66C 1DAKA 1XJQA 3VHXA 2J0QA 1K6MA 5JSZA 1E2HA 3ZD7A 2OSBA 1COWD 4L9SA 2CL0X 5BW8A 2OEPA 1MO5A 2WZQA 2J7PD 1W1WA 1X6VA 4BFTA 5K8UA 3UPUA 1M7BA 1QBKC 3H0KA 5KOYA 3WNCA 3Q7PA 4RZUA 4XH9B 2VO1A 3CRW1 1XPRA 1XXHB 1A5TA 5EXPA 1UPTA 2EFHB 1ZVQA 5DGXA 3CO5A 3VR3A 4Q1BA 2GVDC 2VHUA 3FOZA 1XF9A 1F2TB 2GK6A 1U8ZA 5JWHA 2BVNA 1OJLA 4B43A 1G7RA 4M1KA 1VG9B 1D2EA 1VMAA 3QG1A 4Q9LA 5DYGA 4MGKR 1OH5A 5DISB 3BK7A 4NCKA 5FH9A 3QVVA 3TRFA 1OPXA 5DNYB 1G3RA 4C2UA 1QHNA 3HP1A 2QNRA 3GPLA 3CUEF 2BDTA 2WBLC 3QQ5A 4XTCS 2AD1A 3PQCA 3SN6A 3RRNA 4KLZA 2O0KA 5IT5A 2R2AA 3NH9A 2BIFA 3NEYA 3FFAA 1E2GA 1KTVA 1TX4B 2XB2A 1T3SA 3ASZA 4JSTA 4F91B 1H65A 1XMVA 3EZFA 2ZM5A 3CF2A 1J99A 3U7GA 2J45A 3AF4A 1VYVA 2ZTSA 3I72A 3AP3A 1EX6A 2GF0A 1DVRA 3B9QA 1JR3A 4EQ6A 1GM5A 3K70D 2EW1A 1UADA 4Q7KA 1IOZA 2BEKA 2DBYA 1AZTA 4EPVA 2I4IA 3EARA 4OK6A 2Z43A 4Q4AB 2ZYWX 3GLGE 4A0FA 1LTQA 3CRRA 3NKVA 3C5CA 2AKAB 4NYMR 3QPUA 3TLXA 3VQTA 3X1DA 4Q9IA 1OFIA 1G41A 2ZU0C 2KB0A 2GJ8A 1E9EA 4BZQA 2R9VA 3RC8A 1JR3D 1P3JA 2FFAA 3L0PA 5EUMA 2RMKA 2GF9A 4URXR 4BGDA 3VR1A 1KO7A 4HAXA 1RKBA 4M9SA 4RD0A 4US2R 3GLFB 2A5FA 1QHYA 4M21A 1XTIA 1IQPA 1HA3A 3N2EA 1S9DA 2JA1A 3LRPA 4UXHA 4PAQA 4DT1A 4GRAA 1KKLA 3BB1A 3LVQE 1A2KC 2XJ9A 3C5HA 5CIQA 2ZYTX 1TPZA 3EAQA 4JMPA 3N70A 2IYRA 2ODWA 2ZI4A 1N5LA 1KO5A 1II8B 4GMXA 2D3WA 2R6DA 4IEIA 5TY0A 4I1SA 1VPLA 4DUGA 2JAQA 1T5LA 3ZS8A 3A1UA 2B21A 2XZOA 4PAOA 1TEVA 3NTUA 5DIFA 1MV5A 2WWIA 3I4LA 1N3BA 2WIAA 1BH2A 3E70C 1ZJ6A 3MLEA 5D3MA 5GADl 2QI9C 1EX7A 4A0HA 3KJGA 4E22A 4DUGD 1JAIA 4PHTA 5CIWA 2O8FA 2QP3A 2QT0A 5FBVB 2GTPA 1AKEA 4ZCLA 4RKEA 3J81k 2YC2C 2ANBA 1N6HA 1XZPA 4EKDA 2PJZA 3LWNA 4MKHA 1OW3B 2QL6A 2WV9A 2FFBA 3GJ8A 3FFBA 3NDPA 1CR0A 3I61A 4LCBA 3HR7A 5DI3A 4OHZA 1G19A 2AK2A 3TQFA 5J4VA 4IVQA 5G53C 2QTHA 3MAAC 1NP6A 2WWFA 4I4LA 1G8FA 4QL3A 2GZDA 1Q0UA 3CPEA 2GAOA 3B60A 3NWJA 3RS5A 2GK7A 1HV8A 2PBRA 2OILA 4YDHB 1ZD8A 2YC4C 1DAHA 4JLJA 1Z6TA 3TQCA 3UKDA 4KJZA 5K8TA 3I3SR 4JT2A 3BB3A 1IN6A 1RC8A 2F1RA 2FZ4A 1Y63A 1NLFA 2R44A 3EIHA 2YZ2A 2YHSA 1H8EA 2O52A 4KI0A 1M6NA 1HYQA 4C7OA 2VRWA 1IN8A 1KY3A 1IJEA 2BBWA 4PSVA 3LA6A 5C1BA 5HE8A 3K0FA 2GBLC 3GJ3A 4JLPA 4KSCA 4QGGA 1GDDA 4B3CA 3EXAA 5JFGA 3H84A 3U61B 1H8ED 4Q4HB 4KSBA 3MD0A 3L0SA 4WZBE 3BC1A 4Z54A 4AKIA 4OQNA 5EP4A 1KNQA 2QPTA 4DEXA 1W2HA 4DLWA 2JEOA 5FOUA 1YZUA 3VR6A 1DS6A 2V1UA 1GTVA 2PLRA 1HE1C 3EIQA 4O2LA 1TEXA 4FMDB 1KO4A 3DMDA 4KYIB 3CKLA 1N6KA 3FMOB 1E1RD 1M74A 1QHHA 4QBIA 2QMOA 5CLQA 3RAPR 1HT2E 3CPJB 2LWIA 3CF0A 2D06A 4HB0A 3RRZA 1E2NA 4ZI3A 3GCGA 5HR5A 3CNLA 2O8EB 5C18A 4AKGA 1RFLA 2ZJAA 1BMFA 4C9BA 4TYWA 2R8RA 2IL1A 1OYYA 2JJ1A 1CRPA 4X8MA 1F48A 3A58B 4CEJA 3SJCA 3PUVA 2GVZC 2ZRFA 5IDVA 2O8CA 4NYJR 5C2JB 1OB5A 4QNRA 2FSHA 1SKYB 2NMVA 1Z29A 2FE4A 2XJ4A 3NXSA 1G3MA 1CP2A 2EFGA 1BMFD 4IVPA 3IO3A 2W2TA 3P32A 3K9HA 2JJ1D 3LD9A 3SDZA 5CJPA 1G6HA 3NIBA 4HB2A 1EFCA 1XX6A 1WRBA 1W0KA 3P26A 5SZJA 1TAGA 2CNWA 1T9HA 1KSGA 3PJRA 1G6OA 1GL6A 2BKUA 4BE7B 4LHYA 1P7CA 1S3GA 4A2QA 4FCTA 1DAGA 1K5GA 2WWYA 2IYQA 4JBYA 3RSLA 2A5DA 1KI8A 4RZ3A 4BFXA 2J7KA 4GOJA 4P33A 1ZNXA 2FFHA 2BJWA 2P6NA 4N0DA 2IYSA 4MGIR 4D82A 2ORVA 4W9MC 2F1JA 4TMTA 1W0KD 2CNWD 4B75A 5CB8A 2JLZA 2IK8A 2OBNA 1LY1A 2YOGA 3GLIA 3PFIA 4HB3A 4DVGA 3GLHB 4PC7A 4TTPA 1XTJA 3DVLA 3SNHA 2MSEB 5B58C 4M9ZA 3AF0A 1PLKA 3L2OB 3C15C 1PVOA 1MABB 4Q1EA 3A1SA 2J9RA 3W9YA 3BIFA 4P4UA 2RAPA 3EG5A 3BOSA 4RFSA 1Z2CA 3AVWA 2CCKA 2NO7A 3V4FA 3LBIA 4FD2A 5E7JA 421PA 1U8YA 3EZ6A 1Z07A 5AJXA 4QM6A 2PEZA 1T3LA 2C9YA 3IBGA 2QU8A 4PC1A 2ORWA 1LFDB 5AUQA 3X1YA 1Z3IX 5KPJA 3ZDQA 3UMFA 4A2PA 2ODNA 2H16A 2Q9BA 4RD6A 1ZD9A 4BLRA 2QAGC 3LH5A 3K0AA 2HV8A 1E9RA 1MH1A 3FMIA 3MMPA 4LV6A 1NN0A 3EASA 4RJLA 5G3YA 2JLWA 4S35A 4LJYA 2J1LA 4PHHA 1IN7A 5EE9A 4M1YA 4PHGA 4URVR 4PQRA 3ND9A 2DWQA 4NH0A 5A4JA 3WY9A 4FWIB 1YQTA 1NVXQ 2GCPA 1TTTA 4OQXA 4U00A 1P9RA 4TYQA 2WMNB 4BASA 5JCZA 1F2UA 5UKDA 1OSNA 5DHFA 3U3MA 2N42A 3A8TA 1ZD1A 3K9LA 2DCUA 3T1OA 1IAQA 1KI2A 1I4TD 1NIJA 3HWSA 3I73A 4JYCA 1UBCA 5JI3E 3CW2A 3KXIA 5J4HA 5JEDA 3LBHA 3ZIAA 1N0UA 2GXUA 1E0KA 3RHFA 3DKPA 3L43A 4BZPA 3BFXA 4LGMA 2REOA 2WMOB 5B2ZA 2JIZA 1JXMA 3AF3A 4FMDF 4OHVA 4BEBA 2VA8A 3NC0C 4CEHA 2HCBA 3T12A 1OH8A 1Q21A 5A5GA 1NKSA 3V00A 3F5FA 3NG1A 3RYTC 1BKDR 1E2FA 4MKIA 3ZIAD 1OB2A 3F0TA 4MYUA 2ZSBA 3QXJA 4QNMA 2QGZA 2ANCA 2JIZD 4A8JA 1UEJA 4IOKA 4QGFA 3U3KA 1PV4A 2VP4A 3G0HA 4ABYA 4ZIRA 3VFDA 2H18A 1Z5ZA 2VSXA 5FL7A 1BOFA 4RKFA 4EQ6B 1YU9A 4LBYA 3AVQA 4HAVA 5EXTA 1DPFA 4TMVA 1U8AA 3EZ2A 5JLJA 1GNRA 1ZM7A 3VNUA 3DMNA 4MKFA 1ZU5A 3DKVA 1T5IA 4O25A 1D5CA 3QXHA 5FL7D 5TV2A 3U3OA 2CE7A 4LJ6A 4WA7A 2F9MA 2XZLA 4HAUA 4A8JC 2XOKA 3LDAA 2C99A 1T8TA 1TF2A
chains in the Genus database with same CATH superfamily
2XNDA 3LCCA 5HDBB 1C3XA 5CP8A 4PLVA 2BISA 1G8YA 1XHFA 1VIYA 2OOKA 4W9RA 5KKCA 2X1HA 4EMUA 2CXRA 4P6VF 3MJCA 3HN7A 4Z1OA 4QZVA 4FDTA 3GLQA 2EGUA 4OXNA 2AX4A 3TSZA 4R7LA 4EKYA 4L9GA 2G1PA 1QC5B 1KMIY 1YB7A 3LZDA 4ZW3A 3I6MA 3KOWA 1KGGA 2JVKA 5HGXA 4ZV4A 2OHIA 4ARUA 4UEYA 5JS3E 3FF4A 4A73A 5KYTA 3QEOA 3V4RA 1XNQB 1LA2A 2XMPA 3TSCA 2JCBA 2IV3A 3AKDA 3ETDA 3RS7A 2XMRA 4WXMA 4BFUA 3QP2A 4JLBA 1KE1A 1LPNA 4E2FA 4M9CA 2CMFA 1VHJA 3X2EA 4ACBA 1IB6A 1AF7A 5ADUS 2VSQA 1JSRA 4MDYA 1PQUA 3DVRX 1M1NA 3E9CA 3R6GA 3E9MA 1PG5A 3IS2A 2Q7OE 4BO0A 3W5JA 3FCQA 4KQ2A 1AGRA 2WSIA 5FA7A 2EJCA 5FNVF 1D2HA 4HDNB 2GEBA 4EDHA 2BF7A 2XVZA 1WXDA 3TOVA 4H16A 1MWRA 3GPIA 4K08A 4HLUC 5E3IA 5A4AA 4Q3KA 5TMDA 3BZWA 4WMCD 3FNQA 4S1NA 3OY7A 4FCAA 3BSYA 1I0ZA 2IWDA 2GEJA 4UMFA 1K4KA 3A7DA 5DNCA 2UVDA 4OOYA 1U7ZA 4RTOA 5T4HA 4BRWA 4Q6WA 3UMCA 1IHXA 3VH3A 2VUUA 1SK9A 2QAIA 2C2YA 2JIMA 4EQIA 1BRTA 3H6GA 2FPSA 1GG5A 3A9RA 4C0BA 2XFSA 2QR3A 5DLYA 6REQA 2H0TA 4ZOLF 2IWRA 2E6UX 2Q6VA 5IKMA 4TKUB 3HCEA 4NCNA 3OC2A 2ERYA 4PYOA 2VIIA 4UJ3A 2PT9A 2PD8A 2UYOA 4BECA 3BIWA 1XTUA 4PO3X 5JY1A 3WP0A 4TTTS 2DY0A 4NV0A 3EVGA 1WF3A 5LKAA 1R37A 1PYYA 4DDUA 5FBQB 4IVIA 3MSHA 2XA2A 3WFIA 2C5WB 1OI7A 1PZXA 3CZAA 4JGQA 5F2OA 5BV2P 2GX6A 2WGIA 3LU1A 1U8TA 4RIIA 5BUSA 4AN1A 1D03A 2YHBA 5TR9A 4M83A 4U39A 1Z38A 2VH2A 3S1SA 3LEZA 5T64A 2Q5JA 1D2AA 4IJ5A 3IDSA 3O8DA 3RHZA 4KX9A 3LTNC 4NYIR 3LRTA 3SJAA 2D62A 3B82A 1OV4A 1CV2A 1E79D 2R79A 2P2SA 4AUMA 4N3GA 3QITA 4ZEMA 4KRXA 3FOEC 1I6KA 4YP6A 4GM4A 1XHEA 1YBHA 4G9BA 3GLHE 1CG6A 4D3SA 4IUCS 1P1RA 1AK2A 3WLTA 4DNFA 3P9YA 3O21A 4TGLA 3N2LA 3O7WA 1IN5A 2YV5A 3IOCA 2ZI6A 4NZYA 4I55F 4ZVQA 2JASA 1QF6A 4RZHA 4PQYA 3MBOA 4G1MB 2P4SA 2IP1A 1NC1A 3FR8A 5REQB 1DBSA 1O6ZA 1AJEA 2GFHA 2IY9A 5B4UA 2E49A 1B8OA 1YZ3A 3IQFA 3PDIB 3EPKA 1FJGB 4WY5A 1UBLS 3V1LA 2H28A 4RORA 1TS7A 1WTCA 2NO9A 2IUEA 5CB4B 3G6OA 2J31A 3ANMA 4XDYA 4BVJA 3IKLA 2HA7A 5DI9A 5LP6F 1ERMA 3ZZ0A 2MSCB 3ONFA 2Y55A 1EFHA 4QT0A 1N8TA 4OLDA 2A3NA 3ONNA 2HLDA 1YHYA 3LDGA 3QMVA 1AKNA 1OD6A 3HLDA 1KOJA 2JS7A 1KP2A 1S8AA 1Z0IA 5JXIA 3A3KA 3NHKA 5FI3A 3IJEB 1TDJA 1L4FA 4Z0PA 3WXMA 2ZOSA 4ZTZB 3IRVA 1ZK0A 4D91A 5A6SA 3F6SA 1V8BA 1C0IA 1RJ9A 3AEUA 1M76A 3W78A 1NE2A 3R7LA 3KYQA 3AUYA 1OILA 4M99A 1Y82A 3U09A 1U3VA 3B7TA 1WL8A 2C2KA 1L3FE 4CIWA 1OT6A 3PJDA 1DOHA 5FPSA 3G7UA 1VE3A 1DLIA 2WZXA 4BX9A 1VOTA 1HMPA 2BGKA 2C2XA 4TLDA 4QOSA 5ICEA 3O92A 1FPMA 5F3WB 1X1RA 3OE7D 3ZCPA 4PTYA 4ZI7F 2WJPA 3FGPA 3ZFZA 1TCCA 4IOLA 5JS1A 1UM9B 2WP0A 3U26A 3PKZA 4QYSA 5DM60 1VCNA 1GXSB 3VJRA 3E7FA 1PYDA 3JQ8A 3W1WA 3RVOA 3HXQA 3H7AA 1W34A 3DO8A 3HPQA 5LZ4A 1EXVA 4EPYA 5JNSA 4UXJA 4KP7A 1E96A 4NS4A 4NK5A 3NP9A 1FVFA 2ICAA 2QMYA 1A1SA 4G01B 2XYRA 1TEZA 3P0HA 1RFGE 3J7TA 1C8VB 2QAJA 1PVVA 1B6RA 2XEXA 2HMWA 4PSKA 3U3ZA 1ONGA 1YZQA 2QJWA 1KI1A 1JBKA 2OZVA 1QZZA 3V4SA 1RR6A 1QIEA 3UUWA 3B1VA 4AZ0A 1Z7GA 3MWLA 1IHOA 2KMLA 3U44B 4INZA 1RBZA 3A1WA 4Z8XA 2QLTA 1ZNQO 1LI4A 1QGUA 4ZARA 4EATA 1N0IA 5J3WA 2G4LA 4FLEA 4JP1A 4B0OA 3REFA 1TJYA 1XLTC 2GHQA 4Q9KA 2CDCA 2RBGA 2PUTA 2A0KA 1ZH4A 3SHFA 3DOFA 5ELMA 2VZ9A 5AVVA 4P4LA 2BM1A 1RYYA 2KI5A 1ZOSA 1UBSB 4F94A 2C9MA 4OMFG 2ZVJA 1NN1A 5ES3A 3V32A 1PV2A 3IXHA 4L0QA 2WM2A 4KGDA 1SVMA 3E98A 3AKCA 1BD4A 1N9KA 3WTCA 3IF6B 2I2WA 3NVKI 5BNFA 4C5BA 2HIMA 2QVBA 1X3LA 4FFLA 3LDFA 3GRUA 1H0HA 3T2IE 2CEAA 4AW9A 2Q0SA 3DDCA 4KMSA 1UFOA 2C0CA 3AEQB 3WO1A 3MNFA 5EJIA 4DE2A 1GL7A 1OJGA 2VGKA 3HJNA 1Q0TA 3PR1A 5HWVA 1GVNB 4POAA 4BFVA 1XZEA 3DQPA 5DTIA 5CCDA 2J09A 1AN0A 3F1NA 5HK8A 3RB8A 4EYQA 1XP4A 2FPKA 5HAQA 4GOXA 3HY4A 2JAWA 4NSNA 4GI1A 1OASA 1CJSA 4ZCMA 1Y3HA 4KXAA 3RYIA 3IX3A 3EIMA 5C53B 1QV9A 4J2HA 1L4BA 4H0FA 1ZH6A 5LB4A 3K8YA 4QYWA 4PLCA 3UC9A 1RYFA 5CVDA 3QNBA 5ERXA 2A2LA 1YLYA 2PUBA 2JJ2D 1IY0A 2EQBA 1WUKS 4L9WA 4BZZA 1O9BA 4LJ5A 3MJQA 2UV8A 1X1SA 3ZJ5A 5FUWA 3H6HA 1YV9A 1DQZA 4OLBA 2XDYA 4Z4QA 4C1NA 3JVVA 4KMMA 3GDIA 1LK5A 3HACA 1T1JA 4QBGB 3MIZA 1JNUA 5DTMA 1RLIA 1X15A 1N7HA 1V5GA 4DHWA 4XFDA 4RDHA 4FMPA 2W6ZA 5JMTA 2D2XA 5FPHA 3GPDG 3DNMA 4KHZA 4DUZB 4HWGA 5EUBA 3JCZA 1KFJB 3B33A 4DA7A 2CDNA 2PNJA 4LN1A 3EF0A 5DJUA 1Y8QB 3PUZA 5I4CA 5BNZA 4BO3A 1XDUA 1X0OA 4RVGA 3TE8A 2IF0A 2WP8J 3AFNA 4YQYA 3UB7A 3PK0A 1AWIA 1H23A 2EJBA 4B8YA 1A3CA 3I09A 4JP8A 2W6ID 2VDOB 2IHZA 2IEAA 4HG2A 3RV3A 1JG2A 4NBNA 5GGXA 3SXPA 4BGIA 3QP1A 3WB0A 4KDRA 1ODSA 2A4MA 2PO5A 2W2NA 5GINE 4EPRA 4DG8A 3GLGB 2ZBVA 5IVKA 2MSLA 1PT8A 2GPNA 2JAXA 3ZHBA 2VPPA 5HOEA 1WA9A 1NQVA 1N3YA 3MERA 3DWZA 4BGEA 2QL5A 1BO6A 1ZFNA 4CMIA 3QVJA 3O1JC 2PUGA 1SGWA 2LUOA 3MRTA 5T57A 1Q1EA 1Z12A 2DULA 2BYTA 3T4PA 4UU1A 2WSMA 5TDHA 2W4QA 4K6HA 4UASA 5JNWA 1T4GA 4LRYC 5FR2A 1SC4A 3TEFA 5AYVA 5DLQC 2IYEA 3ENNA 1P8JA 1T8WA 1EBFA 1CZLA 1Y8ZA 3DZIA 3KQQA 3SS3A 5EP2A 1M8KA 5HD5A 3HL0A 1EWQA 1W4LA 2VQSA 1PFVA 2SHKA 1GDHA 5LD2C 4V0MA 3IHTA 2D5IA 1AKQA 2QZSA 4L7VA 4XZ3A 3QNFA 2YNMA 2JHPA 3WGZA 4UQIM 4URHA 3BRSA 4XVQA 3MDJA 1YZYA 4D0GA 4R40A 1XU7A 2OFOA 3MEQA 5B37A 3DULA 3TOXA 4PICA 1U28C 2JGDB 4TSRA 4A03A 3O2QB 4C0KA 2GF2A 4PRYA 2GMWA 1TJ4A 4JJGA 3OEHA 4GL2A 1L7VC 1YAJA 4WZZA 1Z9GE 4MIKA 4KENB 3BICA 1Q2PA 3QMWA 1JIVA 1L3IA 3UFXA 2LKCA 2H48A 5E6UB 3W2HA 1YDMA 1T10A 3NETA 4X41A 5CYGA 4O29A 2PR7A 1A04A 4GMDA 3GJ5A 3IRUA 3PUWA 1SEVA 1UBRS 1XLWA 4C4ZA 4B8ZA 4L8FA 1TU3A 2PYZA 3GQBB 4RGYA 1XLTA 1VSUA 1J21A 3ZWDA 3I8SA 1M33A 4LXTA 4NBWA 1JV2B 1QE5A 3Q5GA 1QKKA 4XIGS 4RNDB 3SOIA 3PC8C 2QVGA 1R0ZA 3NP7A 4QHYA 3IPYA 4NJMB 1A50B 4KOAA 2EYQA 3WMGA 2CGEA 4BP3A 5CPFA 4YP9A 3DJFA 3K2NA 4V3BA 1CZNA 3GFFA 2F55A 4EB6A 3JAKA 4GC5A 1R6VA 1V37A 1ZEJA 3MILA 3CX3A 2R0QC 2ZVDA 5EGSA 3NW9A 3TVYA 3LFHA 4Y9TA 4BL2A 1L1FA 1X87A 3D2BA 1Z2DA 3F5SA 3K72B 3HVFA 4ZDIA 2ZLYA 1ZVVA 1TK3A 2C4UA 3T3PB 3LG2A 2H1LA 3THOA 5J5AA 3WS1A 5CM9C 3NKFA 3ONWA 3IAFA 3WOVA 4A6XA 2B37A 1K8XB 3QX9A 2IS1A 2YKFA 1U1GA 4WN3A 4GPZA 1ZX1A 2HI0A 2GM5A 3CSDA 1M72A 1OFHA 2R48A 2ETVA 3H9QA 2JBFA 1FPQA 1B15A 1P2DA 1Y4ZA 1JAHA 1GPKA 2XSZD 3MELA 3OPHA 5H9VA 4JBLA 5L3UE 4BX8A 3NU1A 3S3TA 3LQKA 2E8IA 4AYTA 3JD2A 1OFTA 4R01A 3IPXA 4RVNA 1QWSA 4A3SA 2P3SA 4O5OA 2VF2A 5EIBD 3DG9A 2BP7B 2CK3D 3UMMA 2A94A 3BL6A 1OWPA 2LCQA 3WK7A 5JSZA 1E2HA 4I4NA 4PHCA 2I9KA 2C8LA 2DQSA 1IFXA 3OJ0A 1VA5A 5KOYA 1VLLA 3TNYA 1NZOA 4YB8A 4KE7A 2VK1A 5ES4B 3O4RA 1RQPA 1PJLA 4M89A 3UW1A 3KKLA 9MHTA 3ANNA 1GU1A 1JI3A 3TRFA 1OPXA 4C2UA 3F46A 5GIOE 1CVLA 2KLBA 3HCWA 4WUVA 1TX4B 2ORED 2XB2A 3MKFA 1UQUA 1PEYA 3U7GA 2XF8A 4U2DA 5IN4A 3MWEA 1Q0QA 2GF0A 1XDGA 3GDGA 1NJ2A 3N0VA 2IPMA 3KB6A 1BG6A 3Q8LA 3FNHA 5D1NA 5KHAA 5D3KA 1CEFA 4E30A 3BJMA 3PE4A 4QUIA 4FFRA 1IZYA 2NQTA 5K09A 3VR1A 3BFEA 2A5FA 3AONB 3G32A 1UT5A 3WSVA 2YQZA 3BB1A 1IYQA 4IJVA 4MQLA 4GDNA 1ZKMA 5C8VA 5LHDA 1JT9A 2JI9A 2F90A 3A32A 3DZGA 3HZRA 2J9ZB 3H5WA 2KM1A 1KEZA 5KTOA 4BU1A 4UUQA 2YBDA 4OXYA 4F2WA 5CD9A 3FTFA 5K0JA 1N34B 2DPLA 1DRMA 2FFBA 5IFLA 2R7MA 3U37A 5K4HA 1SKOA 3N6RA 2JKVA 4KH1A 2WWFA 4QBTA 3RRXA 3RS5A 1BROA 3QA3E 3UKDA 3BB3A 4LRTB 2EWMA 3OTIA 3FSEA 4C7OA 3UDXA 5D5PA 2AYXA 3L92A 4U7WA 2NO5A 4OPRA 1KNQA 1GZ7A 5IANA 3DHYA 3JQ6A 1DC3A 1C1HA 4QU8A 1HE1C 1GPDG 4JUIA 4KQDA 3PNKA 4KC0A 1ZGBA 2QUJA 1QP7A 2CUTA 4GDBA 3EXEA 1IELA 3T5PA 2DFDA 3QLUC 5DULA 1OB5A 1Z29A 2O1WA 4FKMA 2FE4A 1CHDA 4QO7A 1LDBA 3O8QA 3SDZA 3C39A 1EFCA 1OAAA 3HE3A 3JQGA 3ROQA 3FTUA 1KQGA 1QJCA 3RSLA 1VMEA 2YIMA 2NSYA 2O2YA 4Q3AA 5CB8A 2X5XA 3HA5A 2VTBA 1VE6A 3DVLA 3WRVA 1PVOA 1OCEA 1L4MA 3BOSA 4RFSA 2IVZA 2V8FA 3C43A 1A0OA 2XDQA 5AUQA 3S6JA 3GROA 5DYYA 3T3IA 4A2PA 3WK5A 1KRXA 2R86A 4UQLA 4TV9B 2BGUA 5G3YA 2JLWA 1U28A 5G0VA 4C3VA 2AJLI 3UOGA 1SC3A 2FY8A 5IJZA 5FX2A 1P0ZA 2WMNB 1K3UB 2PPVA 5UKDA 3RUEA 2BG1A 3RSFA 5B7PA 2QJTA 1HEYA 3CVYA 4JYCA 3CW2A 4MB2A 3HDQA 4RA6B 5EJ2A 4BZPA 3ZI6A 4AZVA 1TTHA 5GZ6A 1D4OA 4CEHA 5ESXA 1NKSA 2AVDA 1FMCA 2NP6A 3CLOA 3BTSA 3SH9A 1T4BA 5K8JB 3OCJA 3WSWA 4X1KB 3TTVA 2VSXA 5BOSA 1XCLA 1GGMA 1JHXA 1U8AA 1QCCA 4I36A 5JH7B 3O7MA 4GIBA 1YTLA 2PH5A 4V1CB 2C99A 2W6CX 5CFNA 4XN5A 3G8CA 3I2KA 2BZ0A 5AM4A 3QHQA 3TK1A 5HOQA 5T8KC 5EQTA 1XTZA 5IHPA 5K3SA 1KORA 2B2NA 2BMVA 4JI8B 3MOGA 4Z8YA 3LA8A 1GLGA 3L1HA 3GNSA 2PBZA 3GJSA 4QLAA 2ZCVA 5ILOA 4XB2A 2OG1A 4QTZA 1EQ2A 5JD3A 1E3EA 4CQMB 3E48A 4P3YA 2VQFB 2V0CA 2X19A 2JH3A 1BYUA 4OHPA 1RHUA 1RADA 4EHKA 1IONA 1MFZA 4FN5A 1BJTA 4HX5A 1Y7LA 4HN9A 2XUJA 3ERCA 1H6DA 2Z4RA 1CEEA 1OTYA 1IBLB 3D3QA 3G0CA 1TJPB 5LNK6 3IKJA 4GF5A 5TBMB 3JQAD 1WSDA 1E4VA 3VMMA 1ADFA 1VIAA 3QJYA 2WSLA 4FW9A 5CT5A 5HFJA 1UFVA 2RGNC 4LNUA 1UP7A 4ILEA 3VU1A 1BWPA 4P4SA 1Y3FE 5HF6A 2HR1A 2ZPAA 3FU6A 1NBWB 1OH6A 3QV1A 3E8SA 4TWAA 5L8PE 5CHJA 1VE1A 4GS9A 5ALNA 4CDMA 1C14A 1GU0A 4CEJB 3EGEA 1KP9A 1Z08A 4QXRA 4N0PA 4GKAA 1CZRA 4TWRA 1FSGA 3OP4A 3RFCA 3ZWOA 1X7HA 3RS3A 5CFQA 2CFOA 3F4BA 4ON9A 2WHRA 3GWZA 2Q2WA 3K15A 1N6RA 1RHJA 5HFAA 3M5WA 1C9EA 3I04M 4CZ2A 3VOLA 3HKCA 2JFXA 3QKIA 1DPGA 1T2VA 4TQUS 2AW5A 1COWA 3ZD6A 5B2FA 3FYDA 5EP1A 2WKRA 5DYIA 1Y1KE 2NXWA 4GQBA 1LF5A 4HWTA 3HB5X 5CFPA 2PU5A 2A2ZA 3VC7A 2WF9A 4EK9A 4IV0A 4C22A 1CS4C 1C4WA 4ID4A 3D59A 4H08A 1Q22A 4G24A 3VHQA 2C7PA 2PAVP 4OXKA 4B6FA 2H63A 1L7AA 3L0YA 3B7UX 2WR8A 3OEWA 5EVEA 3LPMA 3P5SA 1KI6A 4WNAB 1FX0B 3OCZA 4LMAA 1RW4A 1L4EA 5THQA 4QTTB 3WWPA 3ANTA 3M4YA 5F5NA 1EE9A 1BQEA 3VBCA 3GRAA 2G04A 3PX3A 3U3RA 3BFJA 1OWNA 1X7WA 2PY6A 5AHKA 2YX1A 4FDAA 1PR9A 3DTNA 2PUWA 2JANA 2QMEA 1HTTA 4RMIA 4B71A 3MG9A 3ZHUA 3OOSA 1WWKA 3UY6A 5FUBA 2K7SA 3WLIA 1IKIA 1QIIA 4QXOA 5BWLA 4E15A 1GFWA 5DN6A 1ZH2A 1Z8FA 1J24A 1Y1SA 5K0NA 5DHSA 3D4IA 1SVSA 1QG0A 1JPJA 2ZANA 1BU5A 2J67A 3PE3A 2YZNA 4NTZA 4CLRB 3IF5A 4FSFA 2W6JD 2Y2KA 2FTKE 4KU4A 3WGHA 3BD7A 3T8FA 4EKNB 4L6IA 1KY2A 4R16A 4QHCA 2XRYA 4DMKA 3HNRA 2Z0MA 1RGYA 1KP3A 1B00A 1GQFA 1QHFA 4OB6A 1VIVA 4G5XA 1UDXA 2CWDA 3ZG7B 1UODA 1SBTA 3ZK9A 3H5LA 4PXAA 1I4LD 1XA1A 2BKXA 3ZX5A 1U6KA 1IBKB 3K73O 3CZDA 4O1HA 4MA0A 4F7WA 2P04A 1PAUA 5IM5A 1OVGA 3P7VE 5D2CA 2CLLB 3D8TA 5AW0A 5EY5B 1QAOA 1WAMA 3KX2A 4L1KA 2BFDB 4JBSA 4LRUA 3T3DA 5AJZA 3MM4A 4C6SA 1RLTA 2BY4A 1W2WB 1W0JD 4V02A 2IHJA 3RHSA 4F2DA 1TD9A 4ES6A 4DB4A 5DGDA 4OKSA 1NX6A 1P3DA 4R1LA 4L74A 4FCWA 3QSGA 3AY3A 3RKUA 3TTXA 4F85A 2I3GA 3NC1C 5JYCA 4XMVA 2H2DA 1YU6A 3UAZA 4HN4B 5B3KA 1SZPA 1R15A 3A2MA 4HX2A 1SOWA 2KBFA 2IPAB 4WBSA 2YW2A 2OWEA 3M1LA 2C5BA 2EKZA 1VI2A 1QO0D 4TWJA 4BKQA 3ROZA 1L7OA 3CTPA 4C3ZA 1F51E 1RDFA 1VKOA 4AF6A 3VZCA 4CCWA 2G2WA 1JIQA 2NT4A 121PA 1SHUX 3H82A 1E7WA 4FM9A 3K3PA 3N2KB 4ALIA 1B8PA 3FH5A 1C2TA 2ZQCA 1KYXA 1JEQB 4POOA 2VHCA 4JAVC 2V5AA 3UT6A 2X01A 2GN6A 3IT0A 1ZVJA 2CNDA 3M49A 3ADBA 1UKZA 5BP7A 3FLFA 2OHXA 1Z2AA 3HJUA 1W4RA 1Z0SA 2AEEA 3DBKA 2JKRM 3QPAA 1LSVA 5EMKA 3DQZA 2RKOA 3D6HA 1NVFA 2I7XA 1K25A 2EEZA 3COVA 4O4JB 4YAGA 3BQAA 5DNUA 4ARVA 4WLVA 3WRWA 1OKKD 3ZHRA 4FGKA 1R64A 3GX1A 5CJJA 5HFNA 3FPAA 1XEWY 5KX5B 1TMKA 1FTWA 2I65A 4HDSA 1SHKA 3DR3A 4OQFA 4D3DA 1ZUIA 2WJZB 3I83A 3DONA 1XZLA 3BBPA 2EYUA 4OJQA 4DRXA 4TLAA 4OX9B 1Z5GA 3RF6A 2J7VA 3LKVA 5BORA 4TQAA 2R9WA 3MWDA 3UWOA 1XD8A 5AB0A 3IIJA 5JO0A 3KKNA 4R5HA 5JZVA 1OLUB 4U02A 3ZWBA 4C04A 3EIUA 1E2EA 2EA9A 4AFNA 1R16A 1E94E 3O38A 3H9WA 4OP2A 1XN1A 1CR2A 5LOVF 4LKOA 5LXTA 5JVDF 1RE1A 1CR6A 1QFZA 2EX4A 3KV1A 2I8LA 3CNQS 1Z39A 4DCTA 1G5RA 2ODPA 3ADPA 1JMVA 4KIJA 3W5AA 2PFSA 5ARBA 4BLWA 1U0GA 3G9TA 3O4HA 1G64A 1EXWA 4XOIA 1JZQA 3WYEA 3R9WA 3H42B 2FQQA 4YTEA 5TE9A 1GCAA 2X58A 1EUQA 4X64B 3ESBA 1ZUNB 3GU3A 2H0QA 2X8BA 3NT5A 5DFAA 3D8BA 2MR6A 3V2GA 4QHSA 4ZI2A 4C7MA 4RJTA 5CHMA 2HPAA 2PKWA 1FYEA 1YSQA 2IHBA 3DC2A 3EBOA 4LE0A 2PMDA 5KVSA 5FYDA 4M60A 3L7CA 4KVGA 4H1VA 5JG7A 5B1DA 2WTMA 3OEYA 4DCVA 4ZMRA 3O84A 1HQDA 4JU9A 2QN7A 1FRFS 4FKBA 2Y1GA 4MAFA 3WMRA 4X1IB 5IXSA 4F92B 1XZCA 5CX4A 2QEQA 3TBHA 2J9GA 4B7UA 4IJMA 3H11B 4L50A 2ZJFA 2C95A 2Z08A 3JAWA 2BR3A 5EGNA 1KOGA 1HX7A 2DHEA 2D5LA 3K6RA 4FT4A 1MVNA 1RIFA 3E9EA 4CLCB 4QQFA 4NPAA 3HCDA 4OXXA 3EGDB 1H2FA 5JI2E 4YBZA 3MK31 2C9CA 4BD0A 2ZS7A 1JTEA 4MUBA 5EXSA 4BB0A 3KSBC 3MQFA 1G21E 3CU5A 2CMKA 4HQFA 4LFBB 5HX9A 4ER7A 521PA 4YMSA 2Q3MA 1O6BA 3G82C 2XNHA 5JT9E 4LV0A 2A7XA 2R7AA 1OFUX 4BNHA 3W1EA 2O0JA 4WJZA 5LG6A 1TAUA 1F8XA 3TW8A 1EGVB 2GOYA 4RFVA 3ZCQA 4DM3A 3KYJB 2RHRA 1VYUA 5C5IA 3JSXA 1WOMA 1X3SA 4MS1A 3B5EA 2FPRA 1VECA 2Z6VA 2RH5A 3N4IA 4MVYA 1KIFA 1ZIPA 4RIGA 1MOPA 2C3MA 4ZCSA 5BWCA 4IIEA 2M7UA 4EYOA 4EJSB 3ZPXA 4IF6A 1HM5A 4S05A 2YS7A 1TMOA 3WC4A 2BPOA 1WHTA 5JASA 3GRZA 3V97A 2R1TB 1ZHHA 1Z35A 1VCHA 1NSTA 1BLPA 2VSOA 2VK2A 4FOLA 3HUEA 1VSQA 1KSJA 1DCFA 4HUQA 1V41E 3CLVA 3BVPA 4ZTBA 4I5FA 4TTVA 2I29A 2OQ2A 1TVCA 4EQZA 1G66A 4LXQA 3V48A 2FHPA 3ZGXA 3F7TA 4MMXB 2Q7DA 2H52A 3KDSE 1UWKA 3DBLA 2Q9NA 2OWDA 3FVWA 4Y30A 1XU9A 4B2LA 4M8NE 2C6WB 4O0MA 2HBZA 2CFSA 2VPQA 4PM4A 4DJTA 5DCLA 3JQBA 2KLIA 3R3ZA 2ZATA 1GG2A 4JT9A 1XNJA 4YLYA 2KSQA 3LP6A 1QUFA 4HXYA 3EFHA 4I9UA 1VP3A 4G5GA 5E2GA 3TNLA 1U7UA 2IWHA 5BRJA 3MD9A 4A36A 1NVMB 1Z62A 4OJYA 1QBGA 2EKDA 1R27A 3BM6A 3LI9A 4EYKA 4PSDA 1BXRB 3C0KA 3GNLA 5LIFE 4KODA 1KU0A 1GSAA 4DR4B 1BE0A 4P0TA 2K31A 4L2IA 1DRJA 4LJKA 1B1AA 2X7HA 1XD2A 3E4CA 3C38A 5JS6A 3AESA 4BLPA 1CQWA 2P6OA 4LTNA 3JZMA 5DNWA 3VU0A 3VP1A 3OM8A 1DIGA 1QMEA 4TL6A 3RAFC 4D81A 5K9ZA 4RW0A 2I8CA 3BEDA 1THTA 3N8LA 1B6SA 1BA3A 3GFSA 2Y2HA 3G5MA 2VRBA 5EJAA 2W22A 4Q3DA 3ZDEA 4HR7A 4GLJA 5HMLA 3GEMA 4ZQHA 2AN5A 5JJIA 2ZJ8A 4GKUA 2FPIB 5TMPA 1IUNA 4YQZA 1G4HA 1NVBA 1DKLA 4I3JA 2QP9X 3BAZA 4PN3A 3S99A 2ZUFA 3L82B 2QPOA 3DO1A 5KNDD 3MQQA 4TZ0A 1WF6A 5HMMA 3RS4A 2R6HA 4OFXA 3F2PA 1UUFA 2WG1A 3AZOA 4PM9A 4EEKA 4Z4HA 2AUNA 3QU5A 3VRHA 1F98A 4J4HA 3GHHA 2VATA 1NN5A 1T36A 1A8PA 3TKYA 1KY4A 4ZVVA 4URWR 5LWHA 3TIXB 3TF5A 2ZR9A 3G0IA 3LBNA 4ITUA 2ONCA 1T5SA 3RVRA 3PEWA 4JIGA 2BL4A 1ZWKA 4AP5A 1BS9A 4XCVA 2WIJA 3HKDB 2Z5FA 1Z75A 2HA4A 4GX2A 2RGGA 3WIUA 5ESDA 2QF7A 2ZQ7A 3KZOA 5T7BA 5M3BA 2QVYX 3ESQA 4DQKA 4Y6RA 2K5UA 3DTVD 3FVRA 5TJJA 5AQAA 2ENUA 4MQ5A 2A5GA 1DWPA 2XTNA 4I6EA 3NH6A 5LP1A 2Q6IA 3S28A 4J49A 3NGMA 4AIIA 2GJ9A 3RAEC 1NXVA 3I9V1 3O5AA 1C3OA 2QRLA 4D42A 1HYGA 1IIBA 4MWTA 4GNUA 1FYFA 4LZPA 4WBNF 1NVVR 4WXRA 3WL8A 1SRRA 1A97A 1HGXA 1HEUA 3R8CA 2C2ZA 2FZEA 2GAAA 1M10A 3G2QA 4Z7OB 3U1TA 3V42A 1Z6PA 4R41A 5KDOA 4KRFA 2A5JA 1FTNA 3ETHA 2GEVA 4GCZA 3RT9A 3D7SA 4K1LA 4ZICA 3H8JA 3CI6A 3J7AC 1HOXA 4OA5A 5FD8A 2X9VA 1A9XB 1NBAA 3EUEA 4DGQA 5E2IA 4TSKA 4MA4A 4P2BA 4O1MA 3RYFB 4HDOB 4PFSA 4U3JB 3FXSA 3GGPA 1IG0A 3LE8A 1Q7EA 3QLJA 2I6SA 2ZCUA 1FNBA 2W9XA 4TZKA 1KJJA 3ZLJA 4NZZA 3DW1X 4TRRA 2XB6A 2FSUA 3P4XA 3FYUC 3L79A 5H68A 3UAOA 4E7PA 1J7KA 1QG2A 4DLNA 4Q7MB 3JZFA 2PLWA 4G67A 4QEKA 3V4OA 1ODKA 3WS7A 3DDUA 5J59A 1XB2A 1NATA 1DAKA 3IAAA 4KQQA 2OSBA 3R23A 1L5WA 3A4YA 1XAGA 4N4EE 4MWBA 1XDSA 2GK6A 5FDFA 2J3KA 1U8ZA 4Q24A 3T4XA 4XR4A 3UBTA 4IRMA 1CQJB 1VJCA 4NCKA 4I3HA 4GLFA 3RRNA 4JI1B 5K0TA 1JIJA 3QFHA 3E61A 4FOFA 1BGXT 1J99A 3HLFA 3GFVA 4R1QA 4KAFA 1AZTA 4UM9D 1TTPB 2G5CA 4OY3A 1LHYA 3JQCA 3PYLA 2FFAA 1XQ6A 1RKBA 1FFXB 1XYYA 4US2R 5EZYA 1QHYA 1SM4A 3LRPA 4OA8A 4CF6A 3WBFA 3IELA 5CG2A 5BW6B 1UJ6A 2ZKIA 3IS3A 1KROA 4IHJA 3W4OA 2RHCA 3RC9A 1Z36A 4C4OA 4N7RA 3UJAA 5D3MA 3V1TC 3QVGA 5DIZA 2BAGA 1RJEA 3NM6B 1E18A 1OW3B 4RPJA 3GNQA 3NDPA 1Y6FA 4YALA 3I61A 1TM1E 5J4VA 1FQWA 1SCKA 1NP6A 2WQ6A 1PYOA 1XELA 3ACCA 1AT1A 3QVLA 4NK3A 4N9WA 2DMRA 4JT2A 1AXRA 3N7TA 2CZCA 4HNHA 3OZRA 1KAQA 3D02A 2BBWA 3HYCA 4BC1A 5HE8A 1ADGA 3LPDA 3H84A 4OBBA 1HE4A 3DAOA 5G4KB 2C97A 4Q4HB 5A71A 3VI3B 4WZBE 1T5BA 5CTJA 5IBPA 1NXTA 3P9QA 1DKOA 4PFKA 2PTGA 3MAGA 1E1RD 3UHAA 5A3YA 3O8OB 4LV1A 2C5AA 3QBJA 5C18A 4J7XA 2JJ1A 4LC9A 4AQDA 4MWSA 1Y8CA 1S3IA 2YJ5A 1DX6A 1B2LA 3RASA 4YJ3F 4WECA 4NNPA 4R9SA 4RVBA 4MA5A 2NYUA 3WI7A 1P7CA 1DAGA 4K9NA 1PJ2A 3HA2A 1G60A 1N2EA 2W8BB 5K6RA 1GUBA 3HBJA 2ZUEA 1LW6E 2QB5A 3C97A 3OU2A 1NVKA 4IQ0A 3RIMA 5EPOA 2L0WA 4GX5A 2HOQA 421PA 3DXZA 2PEZA 2H16A 2QUBA 1VB5A 3NJ8A 4BLRA 1KL6A 2CDAA 1BOOA 2IDKA 1CY7A 3MMPA 4L2LA 2DUJA 3UJNA 1LFAA 3CNEA 1TTTA 4OQXA 3OX3A 4UUNA 1PZEA 3A8TA 3KKZA 5ICMA 3HWSA 1DC5A 3LBHA 4TRNA 4ENSA 1HFJA 3FCOA 3OIDA 1KR2A 1ORDA 1YFKA 3EXHC 3EODA 3T12A 1OH8A 1Q21A 4EY5A 5E43A 5IAJA 3ZIAD 2HZ5A 4YASA 2Z8XA 4HSGA 3G1UA 2QGZA 2JIZD 4R8SA 4GVXA 4J29A 3U3KA 1PV4A 3BT7A 4W5TA 4ABYA 3ZQUA 4R23A 1EM8B 1A5BB 2B8NA 3Q9SA 4DWVA 1V1MA 4HGOA 3EWKA 4MVJA 2CE7A 2E4UA 3SXJA 1E3WA 3F6EX 4GUDA 1RWKA 1U1DA 3G5AA 1TNDA 5JXGA 3T7TA 3TYXA 1O6FA 1M5TA 4XQ0A 2DRWA 2CLOB 3E9NA 3K9QO 1SKQA 1SUIA 5LMZA 4GN2A 3L9KA 4IX1A 4DGSA 2Q9AA 2ZAMA 3S27A 1NUQA 2O2JA 1ODIA 3QLTA 4M1QA 2NP7A 1N6OA 4O4LB 3MXTA 5ARDA 3W5HA 4WLOA 4HQRA 3O3CA 4ARSA 1T9BA 1S2GA 4U6NA 3D5TA 2EKQA 4Q7EA 5JSKA 2YYAA 1WE4A 3D4PA 3JASB 2CHFA 3VM6A 2Q3EA 1Q6YA 5HYVA 3KYIB 4DA8A 3THXB 3KSGA 3HUTA 3TW6A 4R3BA 5JAOA 4GFDA 4E1BA 2OESA 1WZIA 3UKOA 5C51B 4AJ9A 1JAYA 1U1IA 2PCJA 3H7WA 1AS0A 4EJ2A 1B74A 2NQ2C 1M2KA 1IN4A 2RCXA 1HE8B 3ZVKA 4HLUA 3OOHA 5KYWA 2NNWB 1SRQA 3PWSA 2IV2X 3VSBA 3IDOA 2VNIA 3B6JA 3FZQA 4ER0A 3DZBA 3A1CA 4KO2S 4IH9A 2F59A 1A96A 1P45A 1JIUA 4LY3A 3FYUA 2B8TA 4Z2AA 3IC5A 2YJ4A 4ND8B 3RRYA 3G68A 3H3FA 2FSPA 2R96A 3QYJA 3ZUPA 4BL5A 2I4LA 5AK6A 2GNOA 1GGHA 2Q2OA 1KDOA 4E6XA 1IY2A 1U7TA 3ECAA 4OKPA 4FC7A 4RVDA 4WZAA 3JZIA 1IQUA 1H69A 3LDUA 5EKUA 4CKCB 1VLHA 2CMDA 1ZXLA 3N0WA 4OQ0A 4RPIA 3P98A 3LCRA 2UYCA 5HDDA 4WBGA 3EC7A 3ZWXA 3H0EA 5GM2A 4PAUA 1NQWA 1CR1A 2EEPA 1N6NA 3B3AA 1CXZA 2QYHA 3F3KA 3ZI0A 1HDOA 4C01A 3IHWA 3P9KA 2AC4A 5KWJA 2NAFA 1I30A 1JQJC 1VPDA 1TKRA 2MR5A 1DAMA 1WYBA 4KUHA 1VLQA 1BULA 3ZVTA 6CHYA 1WEHA 1CETA 1DY6A 4DLLA 3BMOA 1HDYA 4I50F 1AOXA 5ABPA 4P93A 2OKGA 2ZGVA 4NU6A 4N47A 4D41A 4B85A 4HNSA 3W90A 3PP8A 3G2OA 2W58A 3FUWA 3VOBA 4I9NA 4UVDA 1QR2A 4Q1DA 5D7NA 1XJ3A 4R6XA 1VA4A 5IJ0A 1VG8A 1MZUA 4AAYA 4QBHA 5CDYA 3TX6A 5GGYA 1HORA 2H2AA 5JARA 4BLUA 2GPTA 1NUHA 2QG6A 4RQTA 1UXOA 4HVCA 1KVMA 1T91A 3OCXA 1NRWA 3O4FA