4IHQA

Archaellum assembly atpase flai bound to adp
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
512
structure length
512
Chain Sequence
b'SFVEDYLTKLQERPTIIENPNILKGSKIFNAIYRVDDFVYIHIQSIKSEDGYNQYNVIEPPRPTHDEMEEIEEKFALSIGDKEPPEDTKEKEKLIRSILDKILLRMRLSVPKEYVIYHFIRDKLYTGSLEPLIRDPYIEDISIPGLGHVYIVHKVFGPMRTSIKFENYEELDNLIVSLSEKSYRPVSHNRPVVDASLPDGSRVNFVYGVDISRRGSNLTVRKFSRVPTSITQLIMFGTLSSMMAAYIWTMLDEGMNLFVCGETASGKTTTLNAITAFIPPNLKIVTIEDTPELTVPHSNWVAEVTRETGGEGTIKLFDLLKAALRQRPNYILVGAIRDKEGNVAFQAMQTGHSVMATFHAANITTLIQRLTGYPIEVPKSYINNLNIALFQTALYDKKGNLIRRVVEVDEIIDIDPVTNDVVYIPAFTYDSVQDKMLFAGKGSSYLIENKIAVKRGIDRRNIGLLYDELQMRSRFLNLLVEKKIFNYYDVWDYILRARQMGLEEAIKYVSNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FlaI ATPase
publication title Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
total genus 165
structure length 512
sequence length 512
chains with identical sequence B, C
ec nomenclature ec 3.6.1.4: Transferred entry: 3.6.1.3.
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.390.40 Mainly Alpha Orthogonal Bundle Neutral Protease; domain 2 Neutral Protease; domain 2 4ihqA02
3.30.450.370 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ihqA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ihqA03
3ETLA 4V0OA 3K53A 1EFHA 1FQJA 1KI7A 2AXPA 4LHXA 5EUQB 4CW7A 4WBSA 4UNSA 4EQ6A 5KNBA 2CHQA 3GFOA 1NI3A 1IY1A 1ZBDA 2WWFA 3C4JA 3I73A 4IDPA 4II7A 1FTSA 4MKFA 4AY2A 5KO2A 4QKQA 2QROA 2UZIR 1JEEA 3I32A 4LOAA 3LX8A 2D7DA 2ZJAA 2QMEA 3T1OA 1G8FA 4L4UA 1J8MF 1XBTA 3GFTA 3OESA 4UQOA 3DHWC 3ZVLA 2EFEB 3Q3JB 2OILA 3SQWA 1M7BA 4DZZA 5KSOA 1G7RA 1ANKA 1G1MA 4RD3A 3SYNA 1G291 3A4LA 1IBRA 5B58C 1P2UA 1P62B 2V55B 1ZNXA 3EIHA 2HCJB 3BH6A 5CJ2A 1W2GA 3GJ6A 2ZSAA 1TAGA 2XX3A 4M1OA 1HTWA 1X8LA 1DPFA 3K09A 2XOKA 1TU4A 1GFIA 3PITA 3H0KA 3NBFA 4URWR 5LPNA 1C4OA 3ND8A 4R9UC 4PC2A 5DGXA 2NG1A 4R98A 4MYTA 4OQNA 1CLUA 3MSXA 4PO1A 5D3QA 4B73A 2IYLD 2FX3A 1ZYUA 4ACBA 1FMLA 3CPHA 2F9LA 1P4SA 5JWHA 1HUQA 1KO4A 4PHTA 4Q18A 1GNPA 1JR3D 3RRMA 3HR8A 3FMOB 4V0NA 4Q9LA 1UADA 1F2UB 4ZDWA 1Q57A 1XFAA 1NSFA 3EX7C 2PEZA 3TUIC 3VX3A 1DO0A 4JZKA 5AR1A 1DAEA 1X6VA 1IY2A 2FFBA 3QF4B 2FA9A 2HV8A 4HDOB 4TWZA 5DE3A 3VAAA 4DSNA 4OK5A 3CF0A 1VCOA 2VEDA 2CE7A 5H8WA 5CK4A 3AVOA 4W5JA 3TQCA 4BRWA 4L15A 2YOGA 1KOFA 1MO5A 2ECKA 3NVAA 4NCHA 2WAYA 1PUIA 4MYCA 1E1QA 3A1TA 4B2PA 1DTSA 4FMDB 4DSUA 1X1SA 2CBZA 4QNMA 1ZM9A 2GEVA 4DIEA 3B9QA 4E5UA 3K9GA 5C4MA 4KSCA 3RANA 4DWJA 4KLNA 1NMZA 2X2EA 4NYJR 2RB4A 4TMXA 1UBCA 5HE8A 3DPUA 5JWOA 1UDXA 4B48A 2OESA 2ZRHA 5KSZA 5KPDA 5JJKA 4LHVA 2XAUA 4C0BA 1H8ED 1LF5A 4LJ7A 3U3JA 3THYB 2ZJZA 1RRGA 5FOXA 2BJWA 2CK3A 4NONA 3D7MA 3WMGA 1G5RA 1A4RA 2RGXA 1W47A 2JIZD 3S1AA 3QBTA 4NBSA 3UG6A 3MWJA 1GRQA 3CONA 2IXGA 2WSMA 3CF6R 4Q1DA 3U4QA 2OFWA 2D62A 5BN5A 3C8UA 2PCLA 3MD0A 5L3SB 3BXZA 1J99A 3WNCA 3CZQA 4NL4H 1E94E 1KZ7B 2ZR7A 1II8A 3GPLA 5H1YA 1EFUA 3GFPA 5FH9A 2VLIA 1AM4D 2ZYTX 1GUAA 1P6XA 2X8AA 1Z0KA 4B3GA 1DOAA 2BBWA 1Z8FA 3UATA 4PQRA 5EXXA 3SHWA 5AUQA 1XB2A 1FP6A 2CJWB 4P4TA 4GZMA 4O25A 3WYFA 5FTMA 5E7IA 1N6NA 1GG2A 3RWOA 4PHGA 1OF1A 5GJCA 2MSDB 2PL3A 1TUIA 3MWLA 2GZAA 4QJ3A 4A2QA 4RKFA 1IJFA 2VSFA 3CW2A 4LZZA 4DT1B 2OBNA 1HEIA 3SJBA 3HDTA 1CBUA 4AYWA 1N5KA 1KMQA 2O8FB 3OEHA 2ZSFA 1MABB 2WAXA 1G21E 1S0UA 1E3MA 4NDZA 2JLWA 3GLGA 3U3KA 4CVNA 1CR2A 2X77A 3ZGXA 1DVRA 1OH6A 4QHTA 4ZIRB 2DPXA 3KJIA 2QTFA 2R8RA 1W36C 1OFIA 1VMAA 4ITRC 5KTYA 3CRMA 1W36B 3K0FB 1KJYA 4QHYA 1SVMA 1JBKA 2O8CA 5IRCD 4RKEA 1OPXA 3AM1A 3FYHA 1JB1A 3FOZA 2GCOA 4BASA 3UMFA 2GF0A 3C41J 3I8SA 3BRWD 1R2QA 3AVXA 2DYKA 1U90A 2C9YA 1Q3TA 4DHEA 1NP6A 3BH7A 5C46F 2NIPA 2PLRA 5HPYB 1VKJA 5BXQC 4F4IA 3GD7A 1CS4C 4QOSA 2CVFA 1R0YA 2DFLA 4Q1AA 1R8QA 1RYFA 1ZNWA 3BOSA 4QBFA 3AKDA 4N0DA 3DDCA 4NYJQ 3T61A 4ABYA 1XF9A 1VTKA 4L5BA 1WB9A 2R6GA 2WPDD 3X2SA 1OXTA 4M1WA 1R5BA 5AJWA 4PHFA 1S2MA 1QHHB 5J4KA 2QAGA 1E2IA 2JJ1D 2PZGA 3QKSA 4GT1A 1MRNA 2CMKA 4AG6A 2V1XA 3IILA 4GSYA 2XSZD 3RS2A 2A9KA 2NMVA 1OJLA 5JWRA 1EK0A 2EFHB 1EESA 4RFSB 2ERYA 3X1DA 2VL7A 4B6EA 2CXXA 1RFLA 5JSZB 4RCZA 3AVUA 4TLCA 1OXUA 2ZRLA 3NEJA 2GBLA 1F48A 4FMDF 1NKTA 1CEEA 2J9RA 2P3SA 1PVOA 4WVFA 4QL3A 2VHQA 4D25A 2NTYC 2V7QA 2E9SA 2FFHA 2AFIE 2YWHA 3H86A 3LW8A 3QXJA 4CT4B 3I5YA 4Q4JB 1Q1QA 3SYKA 4B3XA 4A15A 1Q44A 4M1YA 4PSKA 5JHHB 1TQ2A 3EZFA 3K0AB 4B34A 1R0XA 2DFNA 2LKCA 4HB0A 1R6BX 4C30A 4OHWA 5E4FA 2VHCA 5AUOB 3BB3A 1J7KA 5IT5A 2CCKA 1LF0A 1IXZA 2JAQA 4I99A 1G16A 2P65A 4LJ4A 1K6MA 4Q03A 2QGZA 5F3WB 2RGNA 4HAUA 3QSYA 4TYWA 1FQKA 2R2AA 1OE0A 5EE9A 2IYUA 4LHZA 4KJZA 3VQTA 1G8YA 3QBVA 4OQMA 4IEEA 4JLMA 1XTQA 1PLJA 2KWIA 1M1YE 1KZGB 1UJ2A 2O0KA 2BVNA 1BMFA 2GETA 1VG9B 3K70C 4QGFA 2WJGA 4JLJA 1XTRA 3K70B 2R6FA 5CDFA 4A6XA 1TL7C 3JZAA 3A6PC 1C1YA 3RRZA 2G0TA 1II9A 1VG0B 3SU8A 1M34E 3LXRA 1UBEA 1AN0A 1YZLA 2JCSA 1E9CA 2EW1A 2Y8EA 1R5NA 4DRZA 4TN1A 4BZPA 5JEEA 4LSGA 2LKDA 4V02A 8OHMA 4C0SA 1ZMXA 4NE2A 4PPFA 2CL7X 2ZU0C 5KSYA 4X8MA 2A5JA 2ZROA 4EUNA 3MRSA 4FWTA 2A5YB 1XD2B 3LDAA 5H68A 1YHNA 2YYZA 4JJZA 1ZM2A 3SOPA 1AK2A 1M7GA 2XB2A 1HH4A 4G3XA 4IDNA 2XNDA 1YU9A 1LFDB 3MUFA 3GJ0A 4JBYA 1Q21A 4BLPA 2KJQA 4KITB 4HDCA 3WY9A 1SVOA 5P21A 5EE3A 1HQCA 4GOJA 4DC9A 2CNWD 2F43A 2WJHA 1CR4A 2PJZA 1T3SA 3TKLA 1Z0AA 3EXAA 1GKYA 1COWA 4A0HA 3KXLA 2VHUA 1RZ3A 1DAKA 3W6PA 5KUTA 1R0WA 2YWGA 2C78A 4MDEA 2EWWA 2KSQA 4ZI3A 4AURA 3UIEA 4C0KA 1NLZA 5C4GB 1OHHA 4H9GA 4K46A 4EPYA 1ZM7A 4LX0A 3QKRA 2X2FA 4FMBB 1P2VA 2VA8A 1BH2A 1JI0A 1BO6A 2OLJA 3AP1A 4DUGA 4DB2A 1O3YA 1GL9B 2PT7A 4MGIR 1Z6XA 3TUJC 2J87A 1KNXA 1YR9A 3DKPA 3JZMA 4P4SA 3T5GA 3TH5A 4EJSA 3LLMA 1SXJB 4JLDA 2FPLA 5IK2A 3VR6A 1T6NA 1T5IA 5AUPB 3OE7D 4NPHA 3EA5A 3Q7QA 5GJWC 5JEDA 1YZNA 2BKEA 2QL6A 3Q7PA 3LVRE 1GL7A 4MRRA 2AD5A 4URYR 3ZH9B 1JXOA 1WQ1R 421PA 1NVVR 4ASUA 3VNUA 4B35A 4HAWA 4ZDIA 2L0XA 2Z6VA 3RS7A 3HWSA 1L8QA 4JJKA 1OXXK 3ONWA 4UNQA 4JIMA 3C7KA 1W46A 3IKJA 2ZUBA 5FUYA 4CEHA 3IEVA 3GLHA 3BE4A 3GLIB 1H65A 1VG8A 2Q21A 4LDJA 1H8HD 4QGAA 3VR3A 2K5UA 1RC8A 3CX6A 4Q9HA 4LBWA 2G77B 4YQFA 1D6JA 3NHBA 3AF1A 3U3RA 4HAYA 3GJ7A 2IK8A 3ADKA 2NOAA 3AKEA 3HU2A 3E1SA 5BW8A 2IS4A 4B32A 1A82A 3SR0A 1WF3A 3IQWA 2JDIA 3AVWA 3PUWA 1P2SA 1SULA 3NH6A 4HSEA 1DAFA 2R62A 3UANA 3P1JA 1UAAA 2EYUA 4Q9JA 1W36D 4L9SA 3E5HA 1IAQA 3W8RA 1UM8A 1Z08A 4Q4LA 1IOZA 3PENA 3KQKA 4HAZA 3TVDA 2G1KA 2A5GA 5IDVA 2V3CC 3BERA 3QOFA 4N0EA 1E2MA 4W5HA 3PV0A 1G6HA 1QVRA 2C5LA 1YR7A 4JYCA 1JQJC 4M9QA 3KKOA 2ZAMA 3NWJA 3RLFA 2PX0A 1NMYA 1XJCA 4TLBA 1SVSA 3KKPA 1EWRA 3WYAA 2J41A 4XVRA 2I1QA 2YNMA 4JLVA 4DLVA 2WHXA 1NJGA 2OZEA 5FPKA 1E2DA 5CLQA 1EFCA 2OEPA 2GXQA 2YVUA 4IW3B 3TSWA 2FEMA 2OCAA 3D8BA 2QENA 1QF9A 1NKSA 4TLDA 3QUSA 1U8ZA 4PQFA 821PA 5HKKD 3FB4A 4TMVA 3GLIE 4ZKDA 1W4CA 2W2VA 4F92B 2FE4A 1IXSB 2EU8A 3NIBA 1DG1G 2QA5A 4URXR 4I81A 1M2OB 3DM9B 4GOKA 2CEAA 3L0OA 4WXRA 4XIGS 1KJZA 5EP4A 3I92A 3I5XA 1GRNA 1S96A 1Z28A 1B23P 4BFVA 3VMFA 2J7PA 4EQ6B 5FL7D 4UJ3A 5SZHB 3TW4A 1ELOA 3C15C 1NVVQ 2YC4C 5GVSA 2HYDA 5K8TA 5DNYB 5LDDC 3PUYA 3TNFA 4GRAA 4HAVA 3HP1A 3CH5A 2OM2A 1E4VA 1QBKC 2AD1A 3SDZA 2XGJA 2HF8A 3K0CA 4KVGA 2Q3MA 3N70A 3GMTA 3FHOA 1G8HA 4M22A 5FI0B 2QQEA 4ZDKA 2BEKA 5BQ5A 2VSOA 3UKDA 2GDJA 3ZVMA 2IBMA 2RGAA 3T06B 2FG5A 2IXEA 3CPEA 3AVVA 2AR7A 1NLFA 3OAAA 1XMJA 4UNPA 3RS0A 3SBDA 2CDNA 5J5CA 2ZSDA 3REFA 4OHVA 1KAOA 4DB4A 5DI3A 1U99A 2A3RA 1US8A 4GP7A 4F4CA 2GJKA 1YZQA 1NBMA 1UPTA 2ZSEA 1I4DD 3K09C 1G4AE 2WJJA 4MGYR 4PAOA 3C16C 1XEXA 2JJ2A 5KU1A 3K70D 2BM0A 1QZXA 5JFGA 2V8OA 1QVAA 1E1RD 1OH8A 3MWKA 2Q9BA 4RZXA 5FTNA 1KY3A 3KB1A 4EFMA 5F2EA 2PT5A 3BIFA 2QMUA 1LV7A 1NY5A 3CWZA 4XD7D 3L0PA 3CX7A 1QG2A 4PC3A 4YMWA 3QENA 3EWSA 5E3HA 3AVTA 2CLSA 4Q9IA 1SVKA 2FWRA 1L4YA 3NEYA 2FNAA 1P72A 1AS0A 1OIVA 3KUCA 1OLOA 3U7EB 3IHWA 2OO7A 2VP0A 4MGKR 4HB4A 5KDDA 1HT2E 1E6CA 1E9AA 4YXWD 1KSGA 5BWMA 2DWPA 4D4JA 1MT0A 3IEUA 1RRCA 4D0NA 3V9PA 4NCKA 1UBFA 4RVCA 1KYIA 2QSZA 1LB1B 3TAUA 2B8TA 2REBA 4NMMA 2ZE6A 2B6HA 2GXUA 2WWHA 3IO5A 3I62A 2R6DA 2GEUA 2NZJA 2DB3A 4EPWA 4HZUA 1VG1A 2ZR0A 3VU9A 3O8RA 1OH5A 4JLAA 3L8ZA 1E9RA 1D9XA 2P67A 2ZANA 1QHXA 4FI3C 1HY3A 3HR7A 3Q72A 4NCIA 2GWHA 3EPHA 4NU0A 2QORA 2QP4A 1Z2AA 4B3BA 2O0HA 3A36A 2ZQ5A 4IFBA 4JBXA 1N3BA 2ZJOA 3EPKA 3UG7A 2IHYA 1FUUA 4QHSA 3ZLJA 2H18A 4C0QC 3S1AB 1GM5A 2O8EA 4MUBA 1TF2A 1R0ZA 1W7AA 3PUZA 2JLSA 4Z1MD 3U4QB 4BE7B 4HUQA 4QFMA 3TE6A 4X8LA 3TBKA 3BK7A 1I2DA 5FUVA 2JLVA 2DFTA 3HU3A 4DSOA 3TUZC 2ODWA 1FZQA 3D31A 3LO5A 2BEJA 2IEYA 3NH9A 2OCBA 3QG5A 1KI9A 3F3YA 3RS4A 1II8B 1TMKA 1DBSA 2RCNA 1OFHA 1XX6A 1E4YA 2WMNB 3CRVA 1KIMA 3U6BA 3VKGA 3AVPA 3QXCA 4Q66C 3VHXA 3GEHA 3FDIA 2CVHA 4HATA 3M0EA 4RCYA 2DWQA 2ODBA 2PEYA 1NSTA 2P2LA 2C9CA 3U5ZB 3B78A 2QE7D 5JMTA 5EE0A 3MMPA 1JPNA 1NLYA 1CRQA 3ZVNA 1AA9A 1U2RA 1IN6A 5AJXA 4TYQA 2F9MA 3M6AA 1ZJ6A 1XZPA 3THWA 4TZ6A 2HT6A 5EXTA 3KKNA 1XCMA 3AQ4A 4JT2A 3QVVA 2XXAA 1VHLA 3N2EA 4PSAA 3FPAA 2WV9A 2OAQ1 3AF0A 1FX0A 3DEFA 3B13B 3PEUA 3QKUA 2YZ2A 1QHGA 3CNOA 5DN6D 5JECA 1Z6GA 1T8UA 2WOJA 3QY0A 2CHGA 1P7CA 2BM1A 2JLYA 1XCGB 4KYIB 3T5DA 4ZCLA 3BFKA 3LQQA 4IOKA 4WOPA 4Q1CA 1T0HB 1X1RA 2HJGA 4OI1A 2C99A 2ZM5A 2XTMA 2QU8A 1BS1A 4JBWA 4P4UA 1RE0A 1TUEA 4BGDA 2O5VA 4QJ4A 4CDGA 1OIWA 2GCOB 2O8DB 3DOFA 3EZ9A 1L2TA 1R5OA 4LJ5A 3GEIA 1D8TA 4Q4HA 4B3FX 4A36A 2ORVA 1CP2A 2JIZA 1UBGA 2TMKA 3IDQA 3LAWA 2V1UA 2G9NA 3RRYA 1DS6A 4DCSA 3F8TA 2VP6A 2RGCA 3X1ZA 4TYNA 2J46A 3AVYA 3P20A 3OEEA 1YR8A 2IYTA 1RYHA 1XNJA 3EC1A 3LV8A 1XPOA 2NO6A 3RABA 1CULC 4Q19A 1ZCAA 2C77A 1KGDA 4QBGB 3I1FA 4DDUA 3KJHA 2QAGC 2V4ZA 1U0HC 2OFOA 4PZYA 2QAGB 3QKSB 4IOMA 4AK9A 1E9BA 1LY1A 2ZI6A 3X1YA 1U8AA 4FCVA 2ZE7A 4G5QA 4KFTA 2OXRA 3R9XA 4D4KA 4D2IA 2MMCA 4H1UA 1E79D 4PC1A 2W6IA 5FL3A 4F38A 5HZHA 2REOA 4MDFA 4BFYA 3AUXA 2GBLC 3KUDA 4HB3A 1Q1BA 1P9NA 3EIQA 4I1SA 4TSFD 4ERNA 2J0QA 4B33A 1YZKA 3K8YA 4ZO4A 2DFKB 1P73A 2YKGA 3T12A 4F91B 2G6BA 1HA3A 1L4UA 2FPMA 1ZNZA 2ANBA 1XTSA 5CB6A 4B2LA 4MA4A 4FCWA 1N5IA 1F6BA 5FBWB 4KFRA 4PC6A 2HT1A 3EWAA 1F3OA 3VHLB 3ZD6A 1WMSA 2LWIA 4JL6A 4URZR 1E69A 1DEKA 5AWFC 5L3VA 3Q5DA 1U9IC 2N1BA 1ZD9A 2FN4A 3CZPA 4CYMA 3TGPA 1U81A 1OV4A 2W6JD 3OHMA 2RGNC 4B71A 5J4LA 1U8YA 2J1LA 2G83A 2XB4A 1JPJA 1OB5A 1TQ6A 3DMDA 2ORIA 5J4YA 3SJCA 3BWDD 2FSFA 3OFND 4A0FA 1W48A 1XDBA 5FR1A 4KAXA 1Z0JA 4AD8A 4Q01A 1FFHA 4BLRA 1WRBA 4B2IA 3PIRA 4B3DA 2GHIA 2XOKD 3AB3A 3FHTA 2VP4A 1JAHA 4IJMA 3MG9A 1KI1A 5TARA 3D6TB 4M4SA 3ICQB 2IF0A 1KI2A 2YWFA 1K5DA 2ZRKA 2NPIA 2PJRA 2W83A 4BFUA 2J0UB 1SKYB 2UZ3A 4OHZA 5A5GA 3Q8XB 3R9WA 3LA6A 4HUTA 3NBZC 2O8BA 2GZDA 4IXNA 4DLWA 1SGWA 5KPJA 4C7OA 1XTIA 3UWOA 2FPKA 1NN0A 4URUR 4US0R 2NO7A 4KODA 5CLLA 3ADCA 1XZQA 3R8FA 1BIFA 2WWWA 2C96A 1XMVA 1XD8A 1OSNA 2VP2A 4AI6A 1NL3A 2NGRA 3WHLA 2KB0A 5BN3A 1KDRA 4ARZB 2G88A 2RGDA 4WA7A 5KYKA 4LK2A 4EKDA 1XTKA 1Z83A 1DELA 3H4MA 1U98A 5LD2C 1E1QD 1GOTA 5FPSA 4B74A 4D4MA 5LD2B 3KQUA 4PX9A 2JLXA 4NKRA 4OI0A 2F43B 5DYIA 3NTUA 2B21A 1G3IA 2FSIA 3WMFA 2ZS8A 4TYYA 4TYPA 3K0SA 3BB1A 2O52A 1Z63A 5K8LA 3EASA 2IYYA 1KHTA 1N6IA 1QHIA 4TMTA 1JALA 2ZI4A 4I1UA 2ATVA 3ASZA 3O8DA 1KO5A 2B7CA 4V0LA 3U44A 5KHOC 4V0MA 4X8HA 5CDFE 1N5LA 1UDWA 1W5TA 2ZVQX 4NTZA 1AIPA 1XD9A 3EIEA 5HCIA 2F6RA 1TQDA 1U94A 1SKYE 5K8UA 1E2HA 4UNRA 1ZNYA 3W9YA 4EJSC 1C9KA 3FGNA 3KQNA 4P4SB 1D9ZA 1Z2CA 2HUPA 4EJSB 4UNNA 5J47A 5FPHA 3WXMA 3LRPA 1P2TA 1XEFA 3AP3A 4DLUA 4R2HA 4W7SA 1XMSA 4W5WA 3VR5A 2ZVPX 2GK6A 3IPYA 2VBCA 4Z8YA 1CF4A 2GRJA 2F1IA 4JVLA 1FTNA 3EA0A 4C0LA 3TAHA 3QG1A 4GP6A 1JECA 1G4UR 1X3SA 3OIUA 4LGMA 1QDEA 3SS8A 1GWNA 1WA5A 2ZRJA 3FVQA 1I4TD 2NPFA 3QVUA 1N6HA 1XCPA 2WJVA 1OT3A 5GADl 3CLVA 1M6NA 4DIDA 2IYXA 2GCNA 1PUJA 4MH0R 4CEHB 4PZLA 4LJ9A 1G8GA 3GLHB 3MWYW 3U2QA 3NG1A 3OZXA 1YQTA 2EFCB 1TEXA 4XOIA 5SZIA 1VCNA 3RC8A 2QNRA 2MSCB 5A4JA 4NZYA 1OFTA 1E99A 2F1RA 2Z0MA 1MRSA 1NG9A 2ZXUA 3ECCA 3OEHD 1NN5A 1J90A 2BKUA 2D2FA 4CZ2A 1CRPA 1OKKA 1AS3A 4JKYA 1E2KA 3G5UA 4CEJA 3B60A 1JR6A 2QTVB 4BFXA 1DAMA 3T1QA 4BEJA 3V4FA 2ZRAA 1WDTA 2FSGA 3VTKA 2HYIC 2KI5A 4CEIA 1KNQA 1E2FA 2C9OA 4TTRA 1L7VC 2GESA 4BFTA 5DIFA 2BDTA 3LWNA 4PHHA 1ESMA 4MQBA 1AJEA 4RSGA 5DISB 4LHWA 3NBYC 1CJVC 5GJVC 1TU3A 1F60A 4JS0A 1ZM3A 2P5SA 3SFZA 3W8NA 3VR2A 2ZAOA 1DO2A 2AWNA 5FOWA 1VPLA 2J7KA 4TLAA 3TW8B 1E2EA 3RSOA 1RPZA 1YVDA 4JYBA 1KK3A 3U7FB 4TL8A 3GJ4A 2BBSA 4LBYA 3AH8A 2ZRMA 4ZV4A 4PAQA 3SE0A 2PMDA 5CIQA 3EPJA 1ZIOA 3AV0B 3IPXA 1MO4A 3I72A 1G19A 3OE7A 3TVTA 2HLDD 1E0AA 4D4LA 4JLBA 5JS8A 5F9FA 5EP3A 3PVSA 5D3MB 4Q00A 4XH9B 4EPXA 2BV3A 5TVKA 3NKVA 2WWGA 1UEIA 1KKLA 4OHXA 2RKOA 3GLHE 3ZIAA 2CJWA 2ODEA 2Q3FA 1XTJA 2RGGA 1HURA 2IUUA 4U5XA 2WSSD 3HPRA 4ZDJA 3TQFA 2IS2A 2IC5A 1P3JA 3MAAC 3FE2A 5CK5A 2OLKA 4UKDA 2WVJA 4DLXA 1E2QA 3U61B 1FL9A 2VTKA 2FJUA 3B8HA 2XJ4A 3SFVA 1SHKA 1W49A 4MYHA 3ZZ0A 3DMNA 5AJZA 5EZ5A 3O47A 2YV5A 3VR1A 4JKIA 2XZPA 1W44A 2JGNA 1Z29A 4XVUA 1MABA 1ZP6A 2AHOA 1XEWY 2V9PA 2FH5B 5KNCA 1F2TA 4NYIQ 2WZQA 4JLOA 1M7HA 4LBVA 5E7MA 3CO5A 2GJAA 3CRQA 3QEJA 4GMDA 3K0CC 3K0FA 4KO8A 3UXMA 4QGGA 1IHUA 1YZGA 3B1YA 2ZPTX 4FMCF 2F7SA 1KDOA 4JVSB 3WRXC 4MRPA 2ZREA 1D5CA 2AKAB 1SXJC 2V54A 3IQXA 3EZ7A 2FSHA 2XJ9A 4G01B 2VHJA 5EUMA 4XJXA 2OE2A 2LCFA 5DI3B 5BN4A 1US8B 1W1WA 2I4IA 3O8BA 4OK3A 2OBMA 3R7WA 1BMFD 1B0UA 1GKUB 4OJQA 3CR8A 4HEJA 2C2HA 3ZJYA 1NN3A 4EIWA 1WP9A 1ZCBA 2JLRA 1A2BA 2G0NA 2QI9C 5J4HA 3L2OB 1BYUA 2YOHA 3H2YA 1DAHA 5DHFA 2EWVA 5HKKA 1UF9A 3OF5A 1FNNA 1KMHB 4I4LA 2IUSA 4MKIA 2Q9AA 4OJKA 2Q3HA 3BFXA 3WP0A 1RRFA 2F3TA 2A2ZA 3BH0A 5JSZA 3IO3A 4NHOA 3ZZUA 1FNMA 2ZR9A 2GK7A 3QQ5A 1CJTC 2A78A 1U0JA 2A7QA 2CLCX 4WW0A 3R20A 4MITA 5CM8B 4DLSA 2SHKA 4E22A 5A0FA 1DAIA 1SKQA 521PA 3QXSA 4QBHA 5EP2A 5JI3E 2QPOA 2GVDC 2OG2A 3RS5A 2XNDD 3T35A 2J0VA 1EFTA 3DKVA 3L8YA 2AK2A 5CYOA 3TSZA 1VHTA 1J2JA 3B5JA 3B1WA 2EVWX 4UXIA 4LRWA 3BORA 1YE8A 3UK6A 4A92A 1ZC4A 1HV8A 4HZUB 3W3AA 2XEXA 4BLQA 3FKQA 2WKRA 2J0SA 1ZINA 4Q1BA 4XSGA 1SXJE 1D2MA 5G40A 221PA 4QXAA 1COWD 3VU9B 3W5JA 4XWKA 1QRAA 5JRJA 4DKXA 3U6KA 2QT1A 3GJXC 1T3LA 1J8YF 3GQBA 2QUZA 3RS3A 5GJBA 3ZQJA 3PJRA 1J70A 1E9SA 3LH5A 2AKYA 3I4LA 2ZJBA 1OHHD 5G53C 2FZ4A 4YMUA 1G18A 1CJUC 3PUVA 1ZM4A 2D7CA 2W0MA 3UMRA 4GDFA 2ZI5A 4PTLA 2IUTA 4UJ5A 4WZBE 1D2EA 2JLZA 4AWXA 2O8EB 4QG7A 3JVUA 4DUGD 2H7VA 2WWXA 1CKEA 3B1ZA 2BCGY 3F0TA 4G0NA 3BS4A 3NHAA 1EX7A 4HUQB 3WYGA 1S4QA 4R2IA 2JLUA 3ND9A 3SQXA 3C14C 5IK2D 4AKGA 5FOVA 1DE0A 2OCYC 4WAUA 4AKEA 1E0JA 5JCZA 3AKYA 3KZ1E 2QRZA 1P60A 1SVLA 2HXYA 4LV6A 1TEVA 4TT3A 2AX4A 2R9VA 1XPRA 2ZRNA 3C5HA 1XXHA 5FUXA 2QBYA 4FD2A 3ASYA 4P3YA 1Y3AA 2FGJA 2ASEA 3X1WA 1K8RA 4OI2A 4OQXA 1II0A 2YINC 5JCPA 4JLNA 1LW7A 1N6RA 1XD2A 4F7WA 2YWEA 1N6PA 4KHZA 1AQUA 1IQPA 2ATXA 3NXSA 2Z4SA 3PFIA 4R7ZA 2IEZA 2WMOB 3AGPA 4HDQB 1MO3A 2OFXA 3THWB 4BPBA 3WBKA 4TQAA 4B6FA 2P6UA 3AVQA 1LTQA 5F98A 2ONKA 2IHBA 5EJEA 4M1TA 1FX0B 1EG7A 3CWQA 3MJRA 4FN5A 4TTQA 3AGQA 5AJYA 5FTKA 5L3QA 3PEWA 1W0JA 4XWAA 5J4VA 4OQLA 2JDID 5EE5B 1YZUA 3IBGA 1NVWQ 2W2TA 3FKSA 1XMIA 2Z83A 2WJIA 4OQFA 1OFUX 3D3QA 2ZRDA 3HYTA 5EZ6B 1IJEA 2YC2C 4LV8B 3GJ3A 4LBZA 3FHCB 2ZRPA 3A37A 3E2IA 1G3MA 2IXFA 4Q02A 4R71A 3V00A 1CR1A 2RHMA 3KJEA 4Q4HB 4QM7A 1EFRD 1XRJA 3RYTC 4D81A 2VPPA 5J40A 1KI8A 1E0KA 4A6PA 4ESVA 1I4LD 2ZSBA 1GSIA 4IVPA 2GJ8A 3BC1A 3I8XA 3Q9LA 1HQYE 2GEDA 1R8SA 2GJ9A 5HE9A 3SBEA 4E07A 4OYHA 4P31A 5DI9A 2NO0A 3A1UA 1YZTA 4DLTA 4ZCMA 1N5JA 1E32A 4OI4A 1GVNB 2V6IA 2BJVA 4BLSA 3KQHA 2R6CA 4S2EA 4F4JA 2WIAA 1G7SA 4M9SA 1UFQA 1AS2A 4RD4A 4AYXA 2NQ2C 4A8JA 3CPJB 3K0EA 3QF7A 1Z6AA 2J5XA 1TADA 2ZYWX 1EXMA 3LBNA 3SEAA 4IDQA 2BMEA 5FBLB 5FPYA 4EFLA 3R9IA 3EZ6A 3MCAA 3THXA 4WXPA 2PMKA 2WWIA 3RNLA 1Q22A 1RKBA 2CLDX 5FOUA 1GITA 3I3SR 4HYYA 4A0GA 4GOXA 5B2ZA 4D82A 4WZAE 1XJQA 3KTAA 1EX6A 4OBEA 2FMXA 5EE1A 2BCJQ 4DDVA 5FBVB 1P9WA 2WKQA 5ELXA 1MV5A 1YRBA 3CNNA 3CF2A 4RZ2A 3G0HA 4YDSA 1WE2A 4NCJA 2WBLC 4G1UC 2RGEA 3CM0A 2E87A 4PO9A 2IS1A 3VX4A 3KFXA 3IIMA 2VYFA 4LI0A 5UKDA 5CIWA 3AEZA 3ICEA 3SZRA 4HLUA 1G3RA 2WICA 4KU4A 3E70C 4RD0A 4K8OA 4EDHA 3OAAD 4V03A 1KK2A 1SXJD 2DR3A 2HCBA 3HPQA 2H92A 2OV2A 4IDHA 4D26A 3SJAA 4C2UA 1HT1E 1TF5A 2A5FA 5HR5A 3TRFA 1RVDA 3RC3A 5FR2A 4B75A 4LYJA 3VR4A 5HZKA 1MH1A 1ZRHA 2BMJA 4POAA 1DAGA 1ESNA 5TDHA 2MMGA 2PBRA 4XSHA 3NC0C 1JR3A 2IYZA 3QXHA 5C18A 4TL9A 2P0EA 3ZVRA 5CM9C 1UKYA 2GA8A 5HCNA 3EPLA 1MOZA 1K5GA 4FIDA 1OIXA 4KVAA 3FMPB 3V4RA 4Z8XA 3C5CA 4WZ6A 2O8BB 3VNVA 4C7OB 1KKMA 3A1WA 1KO1A 2UVQA 3P4XA 4BECA 1NF3A 3ZDQA 3Q5EA 5KDOA 2NO1A 2DBYA 4US1R 1HE1C 2QZ4A 1YR6A 3CBQA 4LYHA 3N5CA 2PZEA 1UKVY 3DZ8A 1I2MA 1IM2A 3PG5A 4IOJA 4HZIA 2R44A 1Z5ZA 3GLGB 3B85A 1W0KD 1E0SA 3SC3A 2WOOA 1XJ0A 3CR7A 2IYVA 3LW7A 2HF9A 2AWOA 1X8JA 2HEIA 2ZUCA 2XNSA 2ZJ2A 4A9AA 1KTVA 2ORWA 3AP2A 1TPZA 2O8CB 2B7BA 2QP9X 1H8EA 5E95A 5KNDA 1WBDA 1YRAA 2FGKA 2ZYUX 3B7GA 3HU1A 3WMEA 4DLYA 3OIWA 3GJ5A 2NZ8A 4LHYA 3KDSE 4JSTA 4DEXA 5M04A 1VYVA 4JSYA 4KBGA 2W6JA 4N1AA 4AYTA 3WNBA 4PAMA 2O0JA 3GLFA 4MKGA 1S1MA 2DWOA 621PA 3U44B 1XEWX 1G8PA 2CHVA 3OFNA 3QEOA 1GZSA 1MR3F 2VF8A 3NBXX 2CL0X 1JJVA 1Z06A 3P32A 4LJ6A 1T8TA 2EFGA 2OCPA 1ONBA 2JA1A 5E7JA 4B43A 1KI4A 1Z6TA 2VIIA 3MFYA 1W2HA 4GMXA 1ETUA 1OH7A 1G6OA 2H16A 4C0AC 2QGNA 3UMSA 4DJTA 3WBJA 2H5EA 2WKPA 3H1TA 3TK1A 1JJ7A 2C98A 1VDZA 1P9RA 4EFNA 4MYUA 3UPUA 2XTNA 3KXIA 1T9HA 4U7DA 2ZI7A 4XTCS 3REGA 1R7RA 4BZXA 1NVXQ 2VF7A 5BYJA 3ZS9A 1KI6A 4XWOA 1G7CA 1E98A 3GLGE 4TQ9A 4GZLA 3L0SA 4Q1EA 1RJ9A 3BFVA 3CRW1 3WNDA 1NMXA 1V43A 4A82A 4HI0E 3SN6A 2E1RA 2GKSA 4S35A 2G3YA 3EAQA 4PPNA 4US2R 2OSBA 1A2KC 1Z6YA 3L82B 4JL8A 4EAQA 5L8VA 1VIYA 4LPSA 2GXSA 4ILEA 2ZTSA 5L3RA 4ZCIA 1D2NA 4DSTA 3B2EA 3FMIA 2ERXA 4IVQA 3A58B 1P61B 4PZZA 3U60B 2FZLA 4CEJB 3WHKA 2QAJA 4Q7LA 5KOYA 1T5LA 3IIKA 4V0KA 5K8IA 4Z51A 4A0RA 1PZNA 4V0ME 1ZU4A 3K9NA 5LB2A 4CEIB 4Q4AA 4BZQA 2BOVA 2IL1A 3M4YA 4PXAA 3J81k 3K1JA 2ZRFA 1N0VC 1NNEA 2JASA 2GAOA 4O3MA 2F3RA 2ZJ8A 2IYRA 1Q3HA 2OAP1 1ODFA 2FU5C 4DXAA 3GCGA 2WPDA 1VIAA 4XVQA 4O0MA 3PXGA 5IHPA 4TMWA 1S9HA 5C1BA 1XPUA 3WP1B 2JATA 2JJ1A 1KK0A 3QIAA 3TLXA 4YC7A 2J3EA 2XSZA 1CR0A 4IOLA 1JQLB 1GIAA 3FTQA 1AGPA 3OEED 3SNHA 4A4DA 5FTLA 3PEYA 3B9PA 4PPQA 1G5PA 3TSOA 5LBIA 2W00A 1BKDR 5FPTA 4E03A 1NIJA 2PX3A 1G3QA 4G5SA 3ADBA 2P6RA 1G41A 4Q48A 3FMFA 4IFEA 3QE0A 3W34A 4TQUS 2R6AA 4LJYA 1SZPA 1VCMA 1ZU5A 1W4BA 4MUAA 2W6ID 2ZRBA 2ZRCA 3KJGA 3QXXA 2D74A 4Q5IA 1Q1ZA 3CIOA 2JJ8A 3LLUA 3OIYA 1CTQA 4IEIA 4PO8A 1VCIA 2C03A 3DVLA 4YMTA 4J0QA 3IIJA 2PCJA 4L16A 4YONB 3TR0A 3B1VA 1E2GA 4KBFA 2XZOA 4CT5A 2Z4RA 1CU1A 1QG4A 2BMDA 3LVQE 3SI7A 1EWQA 1V5WA 4AC9A 3BGWA 3O8CA 2C95A 4QC2A 3KFVA 5LB4A 2PZFA 1Z22A 4PPGA 4KV9A 1TF7A 2EYQA 1JNYA 1F2TB 3HJNA 4M1SA 4JT4A 3IGFA 2FFQA 4DCNA 2VRWA 5B57C 2P5TB 4DEYA 3CB4A 2J59A 2XITA 4D80A 1E2JA 1NRJB 5JI2E 2F55A 4ZKEA 2CK3D 3QKRB 5FBRB 4TMKA 3GP8A 5JJLA 1TX4B 4JL5A 3MGCA 2A5DA 2O8DA 4HLCA 2YOFA 1G3UA 2ZU6A 3B82A 4GL2A 1NJFA 3BBPA 4FMCB 2GJSA 2QPAA 3P27A 2QMOA 1GTVA 1XP8A 3UWKA 2P6NA 1P5ZB 1M8PA 3A8TA 3CNLA 1TNDA 2R65A 3LFUA 1N25A 5C2JB 2QPTA 4C9BA 4TZ0A 1N2CE 1Q12A 3R7WB 2VP5A 2ZJ5A 3DL0A 1NIPA 4JVMA 2C8VA 4C2TA 4ON9A 2IYSA 2CCJA 5AUNB 3CX8A 5B64A 4DLZA 4UXHA 121PA 2HLDA 4KI0A 2PLFA 3QJYA 4NYIR 3N2IA 1NY6A 2REXB 1F2UA 1KDPA 3KL4A 4BFSA 3BD9A 1DADA 4KLZA 1OYYA 3A4NA 5G3ZA 1JAIA 3QF4A 2QM7A 3RAPR 3L0IB 3ZZTA 4P32A 3BJIC 1ZD1A 2HXSA 1IN5A 1P75A 2WSSA 4YDHB 4MRNA 5KSPA 2QT0A 1LVGA 2FF7A 1PLLA 2IF2A 3FFAA 4Q7KA 1G64A 2QRNA 4I1VA 4LV5B 4RY2A 2CNWA 3DO6A 2OUKA 4BFZA 2KBEA 5GVRA 2OXCA 4QM6A 2G1JA 2UKDA 4HLDA 5EP1A 2ONJA 1QHSA 1FPMA 4TL7A 4ESHA 5JHGB 3VKHA 1KDTA 4GNKA 5HTKA 1R10A 1UKZA 4BLTA 3ADDA 2ZUDA 3KB2A 3KX2A 5SZJA 2VSXA 3A4MA 4NCNA 1QHYA 3B1XA 5FOTA 4OK6A 1WCV1 3M1IA 1LS6A 3PCRB 3Q85A 3THYA 4BFWA 1RIFA 2ZIAA 1Q0UA 1A1VA 2ZEJA 2IWHA 1U9IA 1UKEA 1CXZA 2VP9A 3LNCA 5JLJA 3IHLA 2AXNA 4ZPXA 4E09A 4FCTA 1Z3IX 1S3SA 3U3MA 1GRRA 5L3SA 4GI7A 3EZ2A 2ZI9A 1S8FA 2BWJA 1E2PA 2GVZC 1Q20A 4BLOA 3AUYA 4JLKA 1N6KA 1XU4A 4QRHA 4EPTA 4DVGA 4G5GA 2QP3A 3QPVA 1Z07A 2RHDA 4M21A 1JXMA 1X8KA 3I61A 3SHFA 1GILA 2FEOA 4BUJA 2FV8A 3LBHA 2MSEB 1HE8B 2J0UA 2B92A 3P26A 4P33A 4PSVA 1VECA 1SHZA 3NC1C 2ZRIA 721PA 3W3ZB 1XXHB 1OYWA 3FWYA 4G5RA 4IRUB 2QBYB 2QQ0A 1H8HA 4XTRA 3LBIA 3PR1A 2YJTD 2V7QD 3PEVA 4LWZA 2BHRA 4DT1A 3RVBA 4GPTA 1IN7A 5JJIA 4KCGA 3MLEA 3QPUA 2O8FA 3RHFA 4DCVA 4OHYA 3LQRA 2IS6A 4PQYA 2H1LA 4RD6A 4H1VA 4ARZA 1KI3A 4ZIRA 5B30A 4A2PA 2OT3B 2AK3A 3P4YA 4RZ3A 4MRSA 1Z0DA 1S9DA 2H17A 1ZD8A 4FW9A 3ZD7A 2ZJYA 3TIFA 4Q21A 5G41A 3W6OA 5L3QB 2QN6A 4KSBA 3T1VA 1OKKD 3VKWA 2PH1A 2IYWA 5FI1B 4HB2A 4M1MA 1T0JB 1OXSC 4MGZR 4RD2A 2BBTA 5TY0A 4CF7A 1BYIA 1M74A 2QSYA 2D3WA 4Q47A 2Q6TA 2HDNB 1EGAA 4PANA 2ZETA 5FFMA 4AKIA 4RZUA 3AF4A 3GEEA 3W90A 4CGZA 1SQ5A 3CH4B 4A1FA 3A1SA 1Z0FA 1E9DA 3F5FA 1XEXB 3K9HA 1W4AA 4JMPA 2IX3A 1KY2A 3DOEA 3QKTA 4PFSA 2HJVA 1QHHA 4M0LA 4DBLC 2Z5FA 5KDLA 4AG5A 3NDBB 3TJZA 1FP7A 4AIIA 4MRVA 4TTPA 1XXHE 1N0WA 4AKHA 1W5SA 4RFSA 1DG3A 5CYPA 2D2EA 2XTZA 4GBMA 4KXFB 1JEDA 1IONA 2KBFA 4YMVA 4X8OA 2EFDB 2BC9A 4UXJA 2I3BA 6Q21A 1PJRA 3K9LA 4B76A 1CJKC 4BRUA 1E2LA 4EPRA 1KSFX 4C0JA 2WTUA 3LX5A 3ZIAD 2VHTA 2X19A 3BAFA 4A8JC 4FWIB 2H8KA 4OKSA 2GCPA 4A8JB 4BWYA 4DDTA 1BOFA 1MO6A 2QY9A 2CE2X 4Q4JA 2I1VB 1FMJA 1ZC3A 3A1VA 1FUKA 3K0AA 5FL7A 2N46A 3THXB 4LY6A 3QPWA 3X1XA 1GAJA 3IUYA 2JLQA 4DLRA 1GKIA 4D0LB 2ZE5A 4TL6A 2IWRA 3T15A 1N0UA 2NO9A 3EW9A 2Q9CA 5DYGA 2W2XA 4O2RA 3KTAB 2J45A 3QI2A 1E96A 2DY1A 4MKHA 1WXQA 2Z43A 1NBME 1ZUIA 3B6EA 4TMZA 3WRYC 1PLKA 2W58A 1NN1A 2VH5R 2ZS7A 3AKCA 4QGHA 4URVR 1NVUQ 2YHSA 3LXXA 5G3YA 1AKYA 1GNRA 1Y63A 4HLUC 3JVVA 1N6LA 4KFSA 2OHFA 1VYTA 4CIDA 1EFRA 5BYKA 1E1RA 3BB4A 4Y0AA 3CKLA 1KSJA 4I1OA 1UEJA 1KK1A 1GP2A 2H57A 4IKEA 1E9FA 1DARA 4HLQB 1W4RA 2CL6X 4DCUA 4XD7A 1KAGA 4IVRA 4N3NA 5TXGA 1XWIA 1OW3B 1HYQA 4IHQA 4RD1A 3TR5A 4ASUD 2QEQA 4L9WA 1QHNA 2RGBA 5IF9A 4W9MC 5D3MA 5DH9A 5DSZA 1X86B 1IN8A 4TLEA 1RRPA 2ZITA 2IA5A 4YXWA 3DZDA 2WWYA 1MKYA 3CRRA 4B44A 2GZHA 4P0TA 2Q0HA 2WM9B 5EQTA 5JS7A 3AF2A 2GNOA 4A2WA 1LNZA 4LYFA 3PQCA 5H70A 2X1VA 4DDWA 3RSLA 4BEBA 2XXAB 2ZRGA 4C0HA 4K81B 1IY0A 3LD9A 5JRZA 1E2NA 3LY5A 4LPKA 3RDPA 1T91A 2ZS9A 3ZQ6A 4U02A 2DCUA 3AF3A 4D6PA 2D06A 1OB2A 2QMHA 1A5TA 1AKEA 2QG6A 1AZSC 3IBYA 2JEOA 4Y0VA 4LC0A 4C3ZA 4QJ5A 3MJHA 5EXPA 4FINA 4KYUA 3KXKA 2BIFA 5CB8A 2QM8A 1RW4A 1TQ4A 3SJZA 5AJVB 5FOSA 4YMSA 4GFDA 3DM5A 4RJLA 1GNQA 5FTJA 5TV2A 4NYMR 5EXSA 4HAXA 4CRWB 4Q1FA 2IT1A 2GF9A 5JBQA 1ZUHA 1YKSA 4M8NE 4F93B 1YJ5A 3L43A 2ZYVX 4L8GA 4Q7JB 4Z1MA 2AN9A 1G5TA 4ACAA 1KO7A 3GLFB 1SXJA 4LC1A 4OL0A 1KO8A 1KSHA 3RWMB 1F5NA 1E9EA 5TMPA 1JR3E 2GILA 1CIPA 2DHRA 3W5IA 1SVWA 5ANRB 2RH5A 2OBLA 2IW3A 1O87A 2F1HA 2VO1A 5CJPA 3FFBA 1NG1A 2KE5A 4DCTA 2FDCA 1KJWA 1ZUNB 4M53A 4WIAA 3QNUA 4BQSA 1TTTA 4Q9KA 1S3GA 3SYLA 3PUXA 4LUCA 2FOLA 2A30A 2W0SA 2QE7A 1PV4A 3HYRA 4Z54A 1IXRC 4TT3D 1T3HA 2GTPA 1G17A 1KMHA 1ZAKA 4LJ8A 3THOA 2C04A 3GLIA 1G20E 1LS1A 1FW6A 1KI6B 1R4AA 3T1TA 2AFHE 2AL7A 4LJAA 2QTHA 5DO9A 1AGRA 1S1CA 1GL6A 4EPVA 2EQBA 4NH0A 5DHAA 4KFUA 4NP6A 2J7PD 1RJ9B 1AZTA 2F1JA 4LCBA 4JLPA 5DN6A 4B47A 2WIBA 4M2LA 1W0KA 1T4GA 1CJMA 1GDDA 3EG5A 3OIVA 2D4HA 4LYAA 1A7JA 4QBIA 4ZI2A 3EC2A 3VFDA 3T34A 1W0JD 3KQLA 4JVNA 2GXAA 1SVIA 3KKQA 3CUEF 4Q7MB 4B3CA 3R8CA 3GLFE 1FOEB 4G5OA 3FKSD 1AQYA 4RFVA 2XZLA 4IXMA 2BMFA 4Q4AB 2VQSA 2GAAA 2B8WA 2CCGA 5JZVA 4YLGA 4QNRA 4M1KA 2N42A 4C4PA 2ZE8A 3U7GA 1NBMD 3EARA 1WBBA 4PC7A 3U7HB 5FUWA 2JJ2D 1U0LA 3ZS8A 2FFAA 2RAPA 3RRNA 3U3OA 1Q1EA 1N6OA 3G82C 3H84A 2WJYA 4D0GA 4NYMQ 5AK0A 3KKMA 1ZIPA 4FXPA 2IYQA 2ZI3A 1ZVQA 3W6NA 4IDOA 2BBOA 1E79A 1OXVA 5F9HA 1VYUA 1IN4A 2ANCA 1Z47A 5CITA 1Z0IA 5TB5A 2RMKA 3GJ8A 1ZW6A 2ODNA 4M9XA 4M9ZA 3TMKA 4PR0A 4U00A 4TSFA 1G7TA 1G9XA 2V6JA 3NDPA 4O2LA 5SZKB 5FBQB 3ZYCA 5DLQC
chains in the Genus database with same CATH superfamily
5DOVA 4I5FA 4GWGA 3I01A 5A3SA 3DGEC 1PEYA 2VH2A 4ALKA 2J9YB 1J8MF 2ZKIA 5JJCA 2ZIEA 1YL7A 2AX3A 2WABA 4MWDA 4IUBS 3GOHA 3OZGA 3OLWA 4WESB 1QE3A 5AHWA 2WM3A 4J0EA 3LF1A 1DG9A 1TU4A 2B6NA 3ZGLA 1Y5NA 2FX3A 3OF3A 3VR4D 3LECA 1EB9A 5EIEA 3MYYA 3FMOB 1JHPA 3LPNA 4ZU6X 4GO1A 4MQEA 3QF4B 3Q1KA 3OP4A 4BO9A 3NBKA 3AVOA 4NCHA 3VP3A 1E1QA 2GYVA 4FMDB 2C5EA 4A03A 3FFXA 3T9EA 5DNEA 3A6DA 1RTKA 4ZT7A 4JYAB 4D3XA 3ZXUB 5JJKA 1H8ED 1U7DA 4IICA 2ZBBA 3WMGA 2P40A 3TZKA 3O9ZA 5ITWA 4ZVTA 5G4KA 4I1IA 1WU8A 3PXAA 5L3SB 5CCBA 4H6XA 3ZWNA 4NL4H 3OQIB 1C81A 2PD6A 2I9VA 2VJOA 1N6NA 4JP3A 1C4XA 1V16B 2VNSA 4CLDA 4DC1A 2MSDB 3ESYA 4NZZA 2NYUA 3MWEA 1IBCA 3OETA 3OEHA 2OMEA 3N0VA 4HWPA 1PJ4A 1I01A 3WGMA 1JB1A 2SKEA 3S27A 3CAXA 1RC0A 1HZOA 1Q3TA 3AHFA 3DWGA 3T4TA 3UMBA 5DBHX 5C53B 4UUPA 4FOPA 4CMKA 4N6OA 1I7LA 1VTKA 1LBTA 3KWMA 4QULA 1U3DA 1SXIA 2BFCB 1OI3A 2NMVA 3CKKA 3OU7A 2I8CA 3QGOA 2V8BA 4ARAA 2AJDA 4EK9A 3H87A 2D6FA 6REQB 1CEEA 1YRQA 1OWLA 2I7DA 4XFJA 1MVNA 1V9ZA 3C5VA 1MWSA 4HWTA 1QLHA 2Q3BA 4Y18A 1Z36A 3K0AB 3O86A 1N2BA 1D2CA 4TPKA 4JDUA 4DF6A 2FPXA 5EG5A 3ED1A 5A06A 2D2XA 4XUXA 5FP0A 2N9UA 4XASA 1DMRA 4OQMA 1Q7CA 5D7NA 4LY9A 4WBXC 1NUHA 3QU7A 3IQHX 1C1YA 4Q9DA 2RCXA 4GZ3A 1UZUA 4OLFA 3I5UA 1VETA 2OB1A 4MAFA 1M7GA 3VR4H 2PYPA 1TD9A 3I2IA 1PGJA 5JZBA 2ERCA 1C30A 4OQZA 3WLLA 4CKEA 1T9DA 2P4SA 1LSOA 3FNRA 5LQAA 3UDXA 2WTBA 5KUTA 5IZCA 4PVBA 1WZEA 4AN4A 4G26A 4OMUA 2H5IA 2J5BA 2OLUA 4IDEA 3T3GA 5B3JA 3OT1B 1QF6A 4WOKA 5H3LA 4KUOA 4FH2A 3Q7PA 1RQPA 1X92A 2PGAA 1NVVR 4H18A 3PR3A 2AQ8A 2B69A 3C7KA 3UH0A 3NQXA 1JA1A 2Q21A 3VZRA 2K5UA 1AHPA 2R5FA 4CFYA 1CZNA 1QRRA 4FKKA 5C97A 1I4EB 3GQVA 1KZ9A 2F48A 4Q9JA 1FSZA 4L9SA 1QH8B 3HFJA 3QELA 5LZ7A 3L8HA 1LRJA 2H2WA 5FUQA 4Y9DA 3WLMA 4XT2B 3DONA 4X95A 3WL3A 4NZ9A 3FHLA 3G0GA 1GGJA 4U0JA 3IWQA 3D81A 2YNMA 5FEMA 2EX4A 2OEPA 1CDEA 5JVIE 5AW8A 5K1VA 3RJTA 4PZ0A 1U8ZA 1N5OX 5CXXA 4BMXA 4JI2B 4JGPA 4MVJD 2QA5A 1BHO1 3TLMA 1NJ8A 2PKCA 4EFKA 5JPIA 2PR5A 1T5HX 3VMFA 3A6EA 3EVDA 2HYDA 5HK9A 5FQMA 3HP1A 3JWEA 5EVCA 3MC1A 2LD4A 1DXYA 1UMBB 4ZDKA 3EGCA 3CPEA 4PCAA 3SBDA 4WZAB 4OHVA 2W22A 1FXWA 5DI3A 3SHTA 1US8A 4GERA 5A05A 2WJJA 3AUFA 2JGLA 2QOEA 2MCFA 1W88A 3JYNA 3ZNYA 1TEHA 4S2KA 2JI8A 1WXGA 3ZHCA 3IJ5A 1F9IA 3QLEA 2VWQA 5CX4A 3KLBA 3IEUA 3V9PA 3QHAA 3E4PA 5A71A 3IO5A 5ENDA 5TPWA 2GEUA 2NZJA 4CG2A 4C21A 4PX5A 3DUFB 5GIOE 4DGSA 2IGTA 4EBFA 2QP4A 4DE5A 1OZHA 1T9GS 2OUIA 4FUTA 3HL4A 2QN7A 1OLSB 3N86A 5ALYA 1OOEA 2O8EA 4MUBA 4V38A 4WXMA 4Q0MA 2VOJA 4D8XA 2JLVA 5EYPB 4RV4A 1SKUA 4EMUA 1KIMA 2EXBA 4Q66C 1QPBA 5DLLA 4D3DA 3M0EA 1WNTA 4EUZA 3DUWA 3RUEA 3LM8A 4PIPA 2PKYX 2B4RO 3IPRA 1JU9A 4B6QA 1NW7A 4GS5A 4BS9A 3EDCA 1WMDA 3VKFA 4J3BA 4D8TA 4XJVA 1J00A 4UMFA 1YL6A 2GN2A 1O6GA 1QR6A 2VDOB 4KYIB 1CY4A 1DBQA 3JXEA 4QELA 1M6VA 3G2OA 4N3BA 1B15A 3DVAA 4BX3A 1ZOLA 3CNQS 3ETEA 1DL5A 1PS8A 4EQZA 1DS6A 3I12A 4K6KA 1EE1A 3CUSA 5JMWA 1Q50A 2V4ZA 2OFOA 4ZJZA 3UENA 4D91A 5ALSA 2GHTA 4G5QA 3R9XA 5DTQA 3OPXA 4RPIA 2HJSA 5AYVA 1N34B 4R3WA 1JSLA 1B2RA 1YCFA 5IJ0A 2H3EA 4EITA 2G6BA 2W4QA 2RK3A 4IKPA 1NAHA 5BWOA 1VQQA 2X5OA 4FCWA 3JY6A 4MVJH 3T7DA 4J2TA 3MXRA 5C52B 2PDRA 2GN1A 3DTNA 4B71A 1Q15A 2A67A 4EBNA 2C0CA 2Z2MB 3GGSA 1SUAA 2WHEA 3BWDD 4EHDA 3OFND 1BXZA 1XDBA 2X0RA 3RVDA 4MR9A 4FR0A 2XOKD 4HNSA 2H7YA 2VP3A 4IJMA 1E3EA 3JR3A 2JKRI 2W83A 4K89A 2G36A 2FHPA 3NQYB 3VP0A 4MV1A 4URFA 1XQXA 1RR6A 2Z98A 4L9RA 2M98A 4LDQA 1FDWA 2IHJA 3OTOB 3DE3X 4O0PA 3EVBA 5K6TA 3FKVA 5TMNE 1U98A 1KZ4A 3ZGAB 1DAPA 2C2BA 1EUCB 1G3IA 2FSIA 4TMTA 4TKVA 5KWEA 1OR8A 2O0YA 4HWOA 1JWAB 2ZVQX 1PZPA 1CW2B 4U3JA 1DBPA 4KG2A 1A96A 3FGNA 4OO3A 1KXJA 2Q9NA 1JP7A 1P2TA 4E36A 2ZVPX 4D6XA 3DYIA 5HA5A 3KBOA 1RI3A 4PTZA 3R3HA 3UBTA 1U0OC 5I4IA 4D79A 1I4TD 3WADA 1F2DA 5CA0F 3NIAA 3MWYW 3L0BA 4ZPJA 3IH5A 1B74A 3EGXB 3ZHSA 4BQNA 3OCWA 2TSYB 3MJQA 5JAIA 3G5UA 4CQHA 2OD2A 5A4DA 1FFXB 2V7TA 1S8NA 3R4KA 2QL9A 4CEIA 3ZYTA 4TTRA 5ILQA 2XQFA 5HXAA 4QUHA 5A4FS 2QKYA 1K54C 5FJIA 2VN8A 4B3JA 2DPYA 4BO5A 1VPLA 4MLPA 4MROA 3H05A 1DC5A 4H1WA 3AH8A 3I0NA 3SZUA 1HL7A 2G1AA 3AW9A 5D3MB 2YYSA 3CMCO 1KFCB 3K7EA 3A11A 1YLZA 2CJWA 3BDVA 3JASA 1LNSA 1OXKB 4GD6A 3OZCA 3HKBA 1WXHA 5F1FA 3ZI0A 3U61B 1HDZA 1W49A 2PQ6A 4M0KA 4MX8A 2G07A 3E53A 1ZP6A 1XEWY 1F2TA 4M6WB 2XFSA 1UANA 1WPRA 4K87A 1GCIA 2QVGA 3ZU4A 3K15A 1D5CA 1N8TA 2B4KA 4C03A 1YJXA 3CEHA 1XJ6A 4OHCA 4DA9A 3R3JA 4CQMA 2WYXA 4ZAMA 3AR3A 3ZJYA 1CIJA 1ORIA 2ZOSA 3R74A 4WZBB 4DREA 2EWVA 3J7TA 1F8FA 2FG7C 2Y4NA 2YDYA 3OPPA 2GI4A 3RIHA 3B51X 1GPWB 5JSZA 3IO3A 2H2DA 1U0JA 3VO9A 4X1KA 1RM3A 4B4VA 5EP2A 1EFTA 3PNKA 3Q9UA 1QE5A 3FKQA 1D2MA 1NW3A 2F8SA 2YJZA 2E55A 3PJRA 4XQCA 3C98A 2X0DA 3QUAA 4W7IA 4O08A 4DJ2A 1DKUA 3JVUA 3SSAA 2H7VA 3WYGA 2CYAA 5FOVA 1Z7YA 3F1PA 5BV2P 5M34A 2XQVA 2EBWA 3PFHA 4QO8A 2XYPA 1II0A 1CUBA 1N5RA 4P0QB 1N6RA 2DBVO 4JU9A 3PFIA 2WMOB 3OZUA 4EHKA 3KKKA 1GYRA 4E2XA 4EY3A 1W7FA 4B6FA 1HETA 1SZVA 1EG7A 1FFWA 3P9RA 4C43A 1YZUA 3DE1X 5JS1A 1HOTA 4OQFA 3QVGB 1OFUX 4GXNA 4KXWA 1T15A 4R71A 3CVUA 4DMMA 3KJEA 1MWUA 4CN9A 2RHRA 3E7DA 1UOOA 1NVTA 4K9RA 1LQ2A 1LKZA 3VVLA 4IHJB 3UV3A 3OKFA 2J8ZA 1PR2A 4E2ZA 1K3UB 4BLSA 4U63A 3WLKX 1PQ4A 1FR1A 1P39A 5SY9A 4D44A 3HV2A 3CPJB 3QVSA 1P7ZA 1ABBA 1TADA 3HA5A 3TIIA 1S4MA 3DL2A 5FA7A 2HZ5A 2HIAA 5C8YF 1IEQA 1MV5A 2QX6A 3I05A 4BO6A 4G1UC 4E3MA 4NAQA 3NORA 3AMVA 4P8QA 2PNJA 5HPFA 2HGVA 2OTCA 4MDZA 4F1KA 5AB0A 1TF5A 3TBFA 2JIDA 1E6LA 3FU6A 1QLWA 2PBRA 5CM9C 2HPHA 2WFAA 5FHQA 1OIXA 1NX9A 3ZW7A 2GD2A 4Z8XA 4WZ6A 2NUTC 3DAOA 5ADHA 3L0DA 4UEJA 4DR2B 8GPBA 1JTVA 4DA7A 5KYYA 3HA2A 3TCXB 4II3A 3UHJA 2R44A 2I66A 2RGWA 5ELMA 3L4JA 2JIPA 2NZ8A 4UC0A 2FPPB 3BMQB 3WNQA 3GLFA 4GL4A 3U44B 5IABA 5ICCA 2JEYA 1N3YA 1BCRB 2Y68A 4OLDA 4NJMB 4M0FA 1JJ7A 4HFJA 2VOEA 3WIBA 1P9RA 2E3JA 5CRIA 1YC2A 3HJFA 5HD5A 3P0EA 4TQ9A 4NENA 3OPNA 4LRYC 4UEYA 4WCVA 3ICPA 3K8OE 4BTVA 3F1KA 4US2R 4JL8A 4ILEA 2OLVA 2ZTSA 3A1DA 4S1VA 3A58B 4JBGA 4CEJB 2ODQA 3T1QB 4XMXA 4IBRA 3RFFA 4Q4AA 4I9NA 3IXHA 3VUEA 1IUNA 3EQZA 2ZJ8A 3CVOA 4C08A 3V39A 3MWGA 3GCGA 1QGDA 4ZAFA 2I2AA 1OV6A 3UAWA 1XPUA 1TJPB 4EJ2A 1E4EA 2P2SA 5EWJA 3FTQA 4FYQA 3KPYA 4PPQA 3OJWA 2XA9A 5TS2A 1YA8A 1NQAO 1NIJA 3SZ3A 4IFEA 1L7PA 5FXMA 3LZCA 3ZDBA 4YAFA 3GLRA 3KLMX 3CIOA 4KLAA 3U4HA 4YMTA 3V7FA 4ER3A 3DEJA 4G1CA 4ZJ1A 3W06A 1LLUA 1YA4A 3LC7O 1Q7TA 2FOIA 1QFZA 2NAFA 3ZHVA 3GXBA 5ALKA 2XUAA 2I3AA 5EMJA 4JL5A 1I3OA 2FJ0A 2QPAA 3DTEA 1EUDB 2J0EA 2UZ1A 4C9BA 5LMZA 4RK4A 1X9IA 3FTFA 3QHPA 3HEAA 4F2PA 3ZBTA 1L5RA 2PGLA 2I6TA 4BFSA 3G35A 4Z5XA 2YVKA 4L3VA 4K40A 1JV2B 2WSSA 3KQVA 5EIWA 1PW8A 1TUGA 2GKOA 3ZE0B 3BJMA 2HIHA 5ARCA 4I9GA 1KTOA 1ZXXA 3B1XA 4OK6A 1S2IA 3DQQA 2VP9A 4BNTA 4KIWA 3DZKA 4GHIA 5FV4A 1IEMA 3IPLA 3GUVA 3GY0A 2QP3A 1PYOA 1X8KA 1UQTA 3O0DA 3CLTD 3SHFA 4CKBB 2QR5A 3G85A 1TJ3A 3WGKA 3CPTB 3P26A 2J0UA 3USES 2DHEA 4CODB 1PFQA 4LFUA 5A91A 4IGIA 3RFUA 2E21A 2O48X 4R9RA 2M1XA 3CG0A 2ZC7A 3JQGA 3KT6A 3ACDA 3AR7A 4F3CA 4XB6B 2V0NA 4MW1A 5DLPA 2Q4TA 3KVNA 3JARA 2ZZMA 3JWHA 1AKWA 2B3TA 2VAPA 1AF4A 1JDTA 3JQAD 1KBZA 1SQ5A 3PICA 1E9DA 1Y7IA 3F5FA 3CXUA 1XEXB 4HDMA 4MZNE 3JD2A 4UTXA 3OD5A 1BCSA 2VH1A 4TTPA 3EMVA 4F45A 1EDBA 4FWBA 1N0WA 1C9MA 1IHPA 4GBMA 3S8YA 4X8OA 3JD1A 2BC9A 4UXJA 1PTJC 1L0FA 2CUZA 3GGJA 5T8KA 1BOFA 1KOJA 4Z9BA 4MR7B 3SK0A 1EAMA 5EWLA 3WL5A 3THXB 2GERA 1GAJA 1XV5A 1Y3GE 3PPXA 1YJCA 4PSCA 2W2XA 4O2RA 2VI5A 1ZISA 5ILGA 2ZM6B 4GNUA 3E6AA 4KK4A 3QPDA 4ZCQA 4NATA 3NY4A 5LN1A 4HLUC 1UBRS 4GLOA 2FUEA 5B37A 5BYKA 1HI9A 1I2BA 3OOWA 5CB4A 3AUSA 1Y5LA 1U4NA 4IKEA 1USGA 1EIWA 3TSAA 4N3NA 3TR5A 3PXEA 4W9MC 4N6GA 3WAKA 3KV3O 2QMQA 1FJGB 3OH8A 3D1JA 5EQTA 2YHIA 4Z9XA 1T6ZA 3FWKA 1KR2A 2ZS9A 1SUDA 1AKEA 4O2BA 2NV0A 1AZSC 1DINA 1TQ4A 3L7NA 4IWYA 1GNQA 5FTJA 3L4KA 4IDDA 2I99A 3IVXA 3E05A 2HDSA 1JZTA 4DAOA 1KJQA 3MXOA 1IHOA 4CU2A 1JSRA 2VO1A 3FR8A 3BFCA 4UULA 2OZLB 4TMFA 1MO2A 3QYFA 5ITZA 3PUXA 2PD3A 4DBZA 3QE2A 4BVBA 3OPRA 2XNJA 2VJMB 1LHYA 1UL1X 5HJ2A 3UQYS 3P7NA 3WK4A 4CIVA 1RPNA 4KFUA 4ALIA 3UN7A 4IFIA 1F6WA 1FEZA 4JJIA 1ZR2A 2Q6OA 5HP4A 5BOSB 4DE0A 2P79A 4KG6A 1Y1PA 2OHVA 3ZHQA 3KPUA 4Q7MB 1FOEB 3OZVA 1JWVA 1WB4A 3LVBA 3VDNB 1V47A 2ZIXA 3AC0A 1WO8A 3G4PA 1WBBA 1IBMB 4KIFA 4HQOA 2F8TA 3S0JA 4KWHA 4UVDA 3SOZA 4WNIA 4GQIA 1DXQA 4NJEA 1J06A 3MCTA 3H0EA 3F7MA 4D7AA 2R25B 1BMQA 5LYYA 4ZEWA 4PF1A 1LDGA 1ULAA 4HNGA 2PSJA 4WBSA 3GFOA 1NI3A 3K5PA 4II7A 1X7WB 5FBZA 1GW6A 3H7AA 2YW2A 1UMDA 2W2KA 3IVMA 3M5WA 4OONA 4QDKA 1KAQA 3SYNA 3MGKA 5IMSA 4HBTA 2V55B 3D6JA 4LE0A 4BUZA 1W29A 2F62A 4LV1A 3DCIA 3PITA 4F9GA 5DGXA 4FKEA 4OQNA 3EUFA 4B73A 1BXGB 3P2EA 2FLKA 5FD8A 5KVAA 5TT0A 3WLIA 3ER8A 4D9WA 3ITEA 3S5JA 2CFSA 4NBKA 2F17A 3TUIC 1Z82A 2C2WA 2FP4A 4JZKA 1DAEA 3QVKA 2FN3A 4IRXA 3RLIA 3UAVA 4MYCA 4PM8A 1M5TA 1VM6A 2GEVA 2JBHA 4X97A 4YT5A 4JJ8A 4QO7A 1TM2A 1IJBA 3S1YA 4L7QA 4NBSA 1NLMA 4PCVA 1RQ7A 2XEPA 3GV0A 4RYDA 3VJLA 4WJZA 1NBHA 3W1EA 4RTPA 1GUAA 1QO9A 3ROEA 1QK3A 5ALWA 3N7UA 3ZNOA 5LM3A 1NQWA 4RKFA 3WLTA 1MPXA 3F7OA 2Q6LA 5JR3A 2X01A 1OBFO 1E3MA 4YQYA 3GLGA 4CVNA 5I4CA 2QTFA 3W4PA 2DUUA 1SVMA 1Q2QA 5JXIA 2ZIFA 4P58A 1YZVA 1Z7WA 4H7IA 4Q3CA 1GA9A 4HV4A 1L1QA 1Y0BA 3TX6A 2CVFA 1R8QA 4TVOA 1Z0SA 1WZUA 3OSUA 3DWIA 4JP8A 1R5BA 4ALLA 2OK8A 2PZGA 4M9CA 4AG6A 2CMKA 4ZTUB 5I7SA 3H83A 1TECE 2HSDA 4OPRA 1OXUA 3INRA 1WQ4A 3L8MA 2J9RA 1SC3A 1T8WA 3QXJA 2ECPA 4B3XA 4C75A 3UHFA 1NXOA 3ENWA 4FZRA 1KHHA 1QCDA 1Z6ZA 5IT5A 4DNPA 3L0YA 3M5DA 2Q5IA 1CY7A 3INYA 4KV7A 1EVLA 4CQJA 1QVZA 1YR1A 3K71B 1PLJA 3LWBA 1XDGA 1BMFA 3U9SA 2WJGA 2CBXA 3GRYA 4JXJA 3VR5D 2JCSA 4V02A 2EX8A 3TEMA 3ZOZA 5EUBA 2ZWOA 3RC2A 3IUQA 3B7RL 3A1FA 5H68A 1RAEA 1AK2A 4TVKA 5HL1A 4BLMA 2ISCA 3Q1LA 5K3FA 3DVQX 4HDCA 3ZCQA 5EJ5A 1SU7A 5LP6A 3OOSA 4F4UA 3VPCA 3T4PA 1E18A 3E8MA 1XALA 1SM4A 3AERB 2DCMA 3H97A 1MF7A 3H3JA 1YR9A 1NOIA 3ZFZA 3IB6A 3VYUB 2J3MA 4WLAA 1USWA 5BNIA 2P27A 1K4EA 4K6HA 4ASUA 3GMDA 4B7ZA 4O1HA 4BO3A 3VP2A 4ND8A 3KWFA 4QGAA 1OLXB 3EF3A 3G8BA 1D6JA 4GJ4A 1K68A 2OYRA 5I7UA 3D0KA 2G5TA 3FYCA 5BW8A 2R62A 3C8HA 4JC5A 1Y8RA 2DUNA 1IHYA 1UM8A 3LP6A 5HIJA 5IDVA 1JQJC 3JRWA 2H08A 4WASA 3UWPA 3PQ8A 3WQBA 2PQMA 3JD3A 3CT4A 4PNZA 5AVFA 2C8KA 2VK2A 4LW8A 1EP2B 1FU8A 4R6LA 2IPOA 2FEMA 1HYBA 5DTRA 4R3NA 4MVJI 1T2EA 2DNSA 1G8KA 5L7YA 4KE6A 2A59A 2FLVA 2JBWA 3BJEA 1ZAYA 4Y1RB 5EP4A 1SC9A 1EBUA 3KVVA 1B23P 3FUKA 1Z4QA 1B41A 3LIBA 4AR1A 2EWMA 1QBKC 3GMTA 5AM1A 2BFFA 2IBMA 3WRXA 3M81A 1IKGA 2K7ZA 2WYVA 1RACA 2G5CA 1SK8A 3T38A 5JMOA 3C16C 4Z4HA 3HUEA 2O6LA 3BLSA 3N0RA 5KOIA 2LE0A 5LC1A 1L4YA 5AXBA 1P72A 2IOFK 3WYCA 4OFXA 1L2SA 4I9HA 4MGKR 4YAWA 4E14A 4D4JA 1JL3A 3DBVO 3P0FA 1HZZA 1VE9A 3VDQA 3IBCA 1JQKA 3RYFB 4EPWA 5IU1A 3QP6A 3KM0A 1UFOA 1QHXA 4EAAA 1M2VB 1Z2AA 3B34A 4JBXA 4YMHA 3D2BA 1N36B 4WLUA 3S1AB 1YDWA 2MDTA 1JVJA 4Z1MD 4IIFA 3G02A 5IW8A 2DFTA 2BEJA 2W6ZA 2R47A 1Q95A 1E4YA 3LBFA 3U6BA 2ZDGA 2CVHA 2K7FA 4BCBA 5EHGA 1MOPA 1G38A 3EGWA 4HFNA 4IQGA 1AA9A 2F9MA 5IEJA 1XZPA 4J3JA 2H4FA 4DTCA 3KKNA 3AQ4A 3MILA 3N2EA 4LISA 3NQZB 1G20A 3CNOA 4RF2A 3VH2A 3C3KA 3WK7A 2BM1A 4ZCLA 3IF6A 2DLCX 3U7RA 1SA0A 4FGSA 2QUIA 2XTMA 1YUNA 4IDFA 1A9XA 4CDGA 4BMDA 3EIWA 1NXWA 1WOMA 4M0PA 4DCSA 1WHTB 2ZUWA 4FD8A 4Z7QB 4ZHQB 2C77A 1J9GA 2NZYA 3Q81A 5E6UA 3E5RA 3X1YA 3MTAA 3DAPA 5SYMA 5FL3A 3EGEA 2AZDA 1YV9A 3IODA 4TWIA 1Z88A 1W8IA 1JQBA 2Z1NA 3FKJA 1IYQA 4ZO4A 4LIPD 1E3SA 1KYZA 4MCWA 1SQ0A 5AFSA 3T8VA 1JWZA 2X40A 3F6BX 4P7KA 1DSSG 1L5GB 5AMXA 4ZOCA 5L3VA 4KWCA 2N1BA 5CHUA 5KVQA 3QMPA 3DH0A 4FH4A 3IX4A 4A0FA 2YICA 1NBEA 4R0NA 3AB3A 3T0IA 2CLEB 4CQLA 5LIRA 4C2AA 3TL2A 5GQSA 4GM4A 3O3NB 3K9WA 1PT5A 1YS2X 4OHZA 2I1LA 5GTDA 2GZDA 3P9KA 3M1AA 5KPJA 3PGA1 2N1MA 3RUHA 2VP2A 3UK1A 5DBFA 4I8XA 4B1FA 1WX1A 4D4MA 3KQUA 4NKRA 5B4UA 5AXDA 2CXUA 2ZWPA 4LFAB 5J3JA 5A04A 3AEUB 1VKHA 5TGDA 4V0MA 5BQ3A 1FRNA 4L57A 2VYVA 2OO5C 4M8IA 5HCIA 4GS9A 1U5AA 2P9EA 1ND5A 3QX7A 5FPHA 3VE4A 2Y76A 4DLUA 4BTEA 1CQIA 5L7TA 1LNAE 3CW8X 2VJQA 1SUWA 3Q6MA 3DC7A 4DPLA 1V11B 4DIDA 3S5UA 3H5WA 4JV5B 4PZLA 1TD1A 1T3GA 1AG9A 2CYBA 2I2CA 2HPVA 3FZGA 1VKZA 4U0KA 4NOLA 2PSHA 1E2KA 2FZ0A 3TRIA 2A57A 1E2FA 2C9OA 2FQYA 4NBNA 4BFTA 2AG8A 4W8GA 3QEAZ 1NV9A 1HFEL 1YVEI 2MR5A 3SVZA 4K90A 3U7QA 2R5WA 3G59A 3EPJA 1ZIOA 3TVTA 4C6RA 3SS4A 5FTWA 1N2CA 3V7YA 4N40A 5TVKA 3HVUA 1F0YA 1ZLYA 1SRQA 2Q3FA 2QJRA 3X0DA 3DMGA 2FPGA 2UXCB 2E1PA 5CK5A 3CE6A 3E58A 1Z2PX 3PI7A 1EHCA 3RW9A 4MZDA 1NR7A 4X55A 4DLBA 3ZI4A 3VP4A 1RP7A 1YIOA 4NULA 1THMA 4QU8A 2Q62A 5EUMA 3DNMA 4DCOA 2FRDC 2FPUA 2OBMA 1O5TA 3PD0A 3WLNA 3T95A 1UINA 4EX6A 4K28A 3AESA 4RADA 1F14A 3H42B 3W2ZA 5IANA 1YTLA 1HLDA 1HDCA 3QQPA 3QXSA 2B02A 3RS5A 4JJGA 2ZDHA 1WUJS 5REQB 4DM3A 1PQWA 3BORA 1W0CA 4ILKA 2NP7A 4KLCA 4XSGA 4Q1BA 4AUKA 1EAYA 3U6KA 3LEZA 3IEPA 4B6GA 3L02A 3UMYA 4DQXA 1OHHD 3EIOA 4GPEA 1KGFA 4RTJA 3UYKA 3TSYA 3CBGA 5FWXB 4IV0A 4AKGA 3RFTA 4WAUA 1NKVA 3IR5A 1XPRA 1ZSVA 3C5HA 1YWGO 3VOBA 4FD2A 4GGMX 1Y3AA 4RGBA 2YRXA 1XD2A 3WK8A 3QFRA 4HGQA 1K57A 1YNSA 4PWZA 1EINA 2C83A 3U31A 5DX1A 1UPBA 4M1TA 5HRUA 5EE5B 5A8BA 4FN4A 4DXDA 2YC2C 4G1MB 3WFIA 3V00A 3MTIA 1I0IA 5JNSA 5EERA 3GRCA 4BDTA 2Z8YM 5HE9A 5A7HA 1U80A 4OYHA 2DXIA 2P41A 1PK9A 3EVFA 1JH9A 1BD3A 2PBYA 2VZWA 3FN4A 1AS2A 4RD4A 3AO0B 3MCAA 2QHXA 2Z30A 5FOUA 1XNRB 3IDZA 3T12B 4Y2PA 3ZG7B 2WI8A 5FNVA 4RELA 5IM4F 1X7DA 4QYSA 3DR3A 1GG8A 4ROSA 2R00A 1NURA 3M2TA 4K9MA 3SZRA 2NU7B 2XSSA 2WICA 4NBVA 1RMTA 5F4ZA 3BQMB 1OTHA 5DKFA 4X1IA 2WHZA 4UE2A 5ALGA 2GHRA 4LZWA 2P1RA 3VJRA 1P2GA 2QE6A 2VK1A 1KKMA 6GPBA 4MCJA 4TOIA 1T9CA 3FYTA 3MWEB 1AXRA 2D1RA 3KYCA 5HG0A 2X0JA 2FWNA 1G5UA 3B85A 2V1ZA 1Y8QB 3CR7A 1KS9A 5JVDA 2B1QA 1X87A 3G3EA 4P35A 5E95A 4A16A 2RBEA 5IT0A 3JQPA 4L9FA 1JBEA 3D4FA 3DTVB 2GRUA 3I76A 1LBIA 4CNBA 3NMUF 1G8PA 2VHEA 3W5UA 2E5LB 4Z7OB 1JJVA 5F3DA 1MNAA 3P32A 4LOIA 2JVJA 2H4ZA 5E7JA 2Y2PA 1UBSB 1CJSA 5BN1A 5J59A 4YI3A 4LGYA 2P6OA 2IJGX 2QUHA 4HMQA 2EW8A 2O1SA 1UBNA 2QXYA 3DV2A 3Q15C 5CDGA 1R9GA 3D4PA 1FP1D 4MI9A 3EEFA 1QDUA 2OSBA 1L5FA 5HF9A 4XQ9A 2BE9A 1JIVA 1S1ZA 1C8BA 4IVQA 3WIEA 3C7VA 5JPCA 3T94A 3LHIA 1T0PA 3QK7A 1MFZA 2Q4OA 3FWNA 1JEJA 4DXAA 1N9ZA 2O6HA 1VIAA 4YYEA 4YC7A 4YNRA 1L5ZA 2P75A 5LBIA 2W00A 4NFSA 2OQIA 3I2FA 3C97A 4HP9A 1DQPA 1KEWA 3DT9A 3FMFA 1WQ3A 4LVNA 1P33A 2I29A 2JCBA 4TQUS 3QU9A 3A0UA 2DMRA 3OIYA 4IEIA 4TRRA 5DKLA 4LF8B 2PUGA 4CTNA 3SX2A 2Z4RA 4XUCA 2BMDA 4I1RA 2CJXA 1TF7A 4YCBA 1SC6A 1YGYA 2J59A 1RWXA 1TLTA 5H5JA 1UMKA 3EIFA 2P6NA 2XI4A 3D3NA 4E5NA 1ZZGA 3PKJA 4YAOA 5COBA 1IBSA 4UXHA 121PA 4BV3A 1GA6A 5K45A 1OT5A 3T3HA 2HWXA 5JRDS 3DT8A 3TI9A 3E3AA 4MS1A 4ZOEA 3EJWA 1YB2A 4RY2A 4XB2A 1CF0A 2JGRA 2ONJA 3DFKA 3VSAA 2XPCA 4BENA 3PRYA 3VA7A 1EWKA 2VV7A 3FCUB 4QYMA 3PCRB 4P4GA 4LJKA 1O0BA 1JDUA 3KQMA 5M29A 3IOEA 4HESA 2R1ZA 2WIJA 3WIOA 4BLOA 9ABPA 3WTCA 3U4LP 2VZ9A 1SIWA 3OM0A 2BASA 4MS4A 2D5CA 2FV8A 1HE8B 5KYXA 1VECA 1AQIA 3G7SA 3HU5A 4XTRA 3NJ8A 4GPTA 3TW0A 2Y77A 4B93A 3WL7A 4DCVA 5YASA 5IF3A 1W9MA 1SQSA 4HS4A 2WKEA 4S2LA 1M0WA 5TLIA 2VK4A 2QN6A 3Q12A 2Y27A 1ZN7A 5AK5A 2HJEA 5TY0A 1DP4A 3B38A 4YJKA 2MTBA 2VDPB 4WKNA 3EH2A 2ILVA 3QY9A 2FWAA 2X7XA 2C7PA 1KY2A 3QKTA 1QHHA 3NONA 4XCQA 3QLVA 3T4XA 1DIOB 4L8YA 5KWSA 4OHRA 2D2EA 3C3XA 2I3BA 3VH4A 4OKSA 1T18A 4Q4JA 3ICVA 5HF6A 1T1EA 1BX0A 3KOXA 2PUJA 4K6GA 3W5CA 3UHPA 3T15A 3D9QX 1QMPA 1F9AA 4ZVUA 1SBTA 2ZWIA 3LUHA 1QBGA 1ZRSA 3ND6A 1EFVB 4FJ1A 3PDHA 1NVUQ 4IEDA 1SU8A 4PSDA 4QU9A 3DAVA 2B1GA 3BWXA 4RZHA 4Y0AA 1WUIS 4Z53A 3NVMB 2PQ0A 4DCUA 1L9KA 1POXA 4FE7A 3JSXA 1MOSA 3GVIA 4RK1A 3HP4A 2VUTA 3EEIA 5BV1A 5HAQA 3A4TA 3BZWA 1CQJA 4O4HA 3FTNA 4GDNA 4P3PA 4XN8A 2YN0A 1Z4PX 5JRZA 1NMQA 3V33A 5IDQA 2ZZKA 4HY3A 1OB2A 1WAMA 2W3EA 1MMFB 4M0MA 2Z6UA 1Q6YA 1QAMA 3D8UA 4QOIA 3KOZA 1A72A 2O9CA 4GQBA 4YMSA 1QCYA 2DMWA 4NYMR 4MMZB 3IXGA 2PGXA 3H99A 3L7AA 2Y2LA 2R7AA 4R1SA 2HDUA 2AN9A 1A8HA 1ENZA 1SXJA 4HTFA 1ADGA 1KSHA 3LBYA 1SOAA 5IDWA 1U1CA 1OBHA 2KE5A 3RRJA 3HRIA 2PSFA 4B85A 2TMDA 5HYVA 4BVKA 1U6JA 3KUKA 4TV9A 1R4AA 1N9KA 2EQBA 1VP3A 4BNVA 3LPCA 4JLPA 2O2EA 2WIBA 1Z5PA 2D5AA 3MF0A 3RNOA 2C7RA 4P7FA 2RHJA 1A7JA 4XDYA 1Q0TA 4JVNA 1AQ6A 1D4ZA 2HSZA 1IN1A 4RC9A 4UDYX 2EG5A 1QRUA 2B8WA 4HF7A 3I01M 1QONA 5JS6A 1V35A 4Y9SA 4MR9B 2DQKA 2BFAA 4YUXA 3IAS6 2X1LA 3WQRA 4KE8A 1USKA 1ADYA 4DCCA 4FXPA 3W6NA 2BBOA 2ET6A 1OXVA 1U1IA 3TGWA 3V4VB 4I4TB 1GQSA 4U00A 2VF5X 4AT1A 2JBAA 1MGOA 4PYJA 4N5DA 4BV9A 1CUAA 2WWFA 3SBXA 3HB0A 4CM9D 4DRTA 3M1LA 3S4XA 1RPTA 1P4AA 1IBRA 4NFLA 1VIDA 3PP8A 2I2WA 2QJOA 1C2TA 3AGFA 2MIIA 2QDKA 3HN6A 1RXCA 4QTUB 1WEKA 4Y6QA 3E23A 3HXOA 3P9PA 4K05A 1ZYUA 4HQKA 4ACBA 4EYKA 4WN9B 4CMGA 1P4SA 1OC2A 4TLLB 4UM8B 2HBQA 3QJGA 2UV0E 1ILEA 4UHKA 1IY2A 2FFBA 5DE3A 5K3DA 2HOQA 4MWCA 1KE4A 3HACA 1NPDA 5K4GA 1MO5A 2QZJA 3BILA 2O99A 3GROA 5JYEA 2ZJ9A 1J3WA 3RM3A 2L4RA 4KLNA 4RX3A 3O82A 1O5OA 2RB4A 4MW2A 5BSVA 1UDXA 4B48A 2VPZA 4E5KA 1EJ6A 3WB9A 4KWTA 1PJTA 4NONA 1CUDA 3PR6A 4XGNA 4Q1DA 2IP1A 2D62A 3DB1A 3NXKA 4EUSA 1E94E 3H2JA 5TBMB 2VLIA 2JKZA 3JQEA 3FOAA 3IE0A 1DOAA 4MOWA 1IHDA 2A88A 2CJWB 2PR6A 4JEHA 3PXDA 1U3VA 4A8TA 2J7VA 2IQIA 4QEZA 2VSFA 1V4NA 1Z18A 2WAXA 1G21E 2H9AA 3I2KA 2YV1A 3CVWA 3P0RA 4QHYA 1P1KA 1OPXA 2CWDA 3WTBA 3IP6A 3FOZA 1R8XA 4P8RA 2J6HA 1CERA 3FDJA 2HADA 1NM5A 5IAOA 2NX2A 5JYCA 3GD7A 2DECA 3II6X 5HD3A 1OXTA 1S2MA 4S3MA 3G2QA 2AYXA 1P31A 3IUEA 1LDEA 3F3SA 1ZKMA 2C5WB 4WPGA 2EFHB 4KQGA 4D92A 4FC6A 3CUTA 1PZXA 2X9QA 1RFLA 5JSZB 3C48A 4FMDF 2J6BA 4I5EA 2YWHA 5F77A 3H1AA 4H3VA 3W4QA 3QX8A 3MSHA 1QZTA 1ZDMA 2O59A 1E5VA 2P9VA 2CCKA 3FM9A 2BGWA 1NHGA 4YAUA 4HNAA 4F6RA 2GYUA 2C8LA 2IYUA 1BDJA 1U2ZA 3IJPA 4LFBB 1HM5A 1FJ3A 4OXYA 3COPA 2PV7A 5CIYA 1VG9B 1I14A 3JZAA 8OHMA 1CJCA 4M83A 2C57A 1U28C 3GLKA 1IDN1 2FK7A 1Y34E 3V7NA 4E51A 1OBOA 2B5WA 3SX0A 4EHIA 4J2HA 1KEIA 4CTKA 3EXHA 4HXGA 4UUNA 3ETNA 3O2NA 2P2CA 3UIEA