1DO9A

Solution structure of oxidized microsomal rabbit cytochrome b5. factors determining the heterogeneous binding of the heme.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
94
structure length
94
Chain Sequence
b'DKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPDDRSKLSKPMETL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B5
publication title Solution structure of oxidized microsomal rabbit cytochrome b5. Factors determining the heterogeneous binding of the heme.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Electron transport
total genus 19
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 1999-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.120.10 Alpha Beta Roll Flavocytochrome B2; Chain A, domain 1 Cytochrome b5-like heme/steroid binding domain 1do9A00
1MJ4A 1AW3A 1AXXA 1F04A 1LJ0A 1X3XA 3NERA 1IEUA 1U9MA 1IETA 1AWPA 1B5AA 1M2MA 1T0GA 1I87A 1HKOA 1M59A 1ES1A 1ICCA 1B5BA 4HINA 1J0QA 1LQXA 3X35A 1LR6A 1DO9A 2OZ0A 1SOXA 1BFXA 3X32A 2I96A 4HILA 1U9UA 1LCOA 1MNYA 1KBIA 1M20A 4X8YA 2AXXA 3X34A 3MUSA 1I5UA 1LTDA 1M2IA 1F03A 1SH4A 3OZZB 1NX7A 1EUEA 1AQAA 1LDCA 4B8NA 1CYOA 1J03A 3LF5A 1CXYA 2KEOA 2IBJA 3KS0A 1EHBA 1JEXA 1BLVA 1FCBA 3X33A 1IB7A 2M33A 1B5MA 2I89A 1I8CA
chains in the Genus database with same CATH superfamily
1MJ4A 1AW3A 1AXXA 1F04A 1LJ0A 1X3XA 3NERA 1IEUA 1U9MA 1IETA 1AWPA 1B5AA 1M2MA 1T0GA 1I87A 1HKOA 1M59A 1ES1A 1ICCA 1B5BA 4HINA 1J0QA 1LQXA 3X35A 1LR6A 1DO9A 2OZ0A 1SOXA 1BFXA 3X32A 2I96A 4HILA 1U9UA 1LCOA 1MNYA 1KBIA 1M20A 4X8YA 2AXXA 3X34A 3MUSA 1I5UA 1LTDA 1M2IA 1F03A 1SH4A 3OZZB 1NX7A 1EUEA 1AQAA 1LDCA 4B8NA 1CYOA 1J03A 3LF5A 1CXYA 2KEOA 2IBJA 3KS0A 1EHBA 1JEXA 1BLVA 1FCBA 3X33A 1IB7A 2M33A 1B5MA 2I89A 1I8CA
chains in the Genus database with same CATH topology
1MJ4A 1AW3A 1AXXA 1F04A 1LJ0A 1X3XA 3NERA 1IEUA 1U9MA 1IETA 1AWPA 1B5AA 1M2MA 1T0GA 1I87A 1HKOA 1M59A 1ES1A 1ICCA 1B5BA 4HINA 1J0QA 1LQXA 3X35A 1LR6A 1DO9A 2OZ0A 1SOXA 1BFXA 3X32A 2I96A 4HILA 1U9UA 1LCOA 1MNYA 1KBIA 1M20A 4X8YA 2AXXA 3X34A 3MUSA 1I5UA 1LTDA 1M2IA 1F03A 1SH4A 3OZZB 1NX7A 1EUEA 1AQAA 1LDCA 4B8NA 1CYOA 1J03A 3LF5A 1CXYA 2KEOA 2IBJA 3KS0A 1EHBA 1JEXA 1BLVA 1FCBA 3X33A 1IB7A 2M33A 1B5MA 2I89A 1I8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJ4 A;  1AW3 A;  1AXX A;  1F04 A;  1LJ0 A;  1X3X A;  3NER A;  1IEU A;  1U9M A;  1IET A;  1AWP A;  1B5A A;  1M2M A;  1T0G A;  1I87 A;  1HKO A;  1M59 A;  1ES1 A;  1ICC A;  1B5B A;  4HIN A;  1J0Q A;  1LQX A;  3X35 A;  1LR6 A;  1DO9 A;  2OZ0 A;  1SOX A;  1BFX A;  3X32 A;  2I96 A;  4HIL A;  1U9U A;  1LCO A;  1MNY A;  1KBI A;  1M20 A;  4X8Y A;  2AXX A;  3X34 A;  3MUS A;  1I5U A;  1LTD A;  1M2I A;  1F03 A;  1SH4 A;  3OZZ B;  1NX7 A;  1EUE A;  1AQA A;  1LDC A;  4B8N A;  1CYO A;  1J03 A;  3LF5 A;  1CXY A;  2KEO A;  2IBJ A;  3KS0 A;  1EHB A;  1JEX A;  1BLV A;  1FCB A;  3X33 A;  1IB7 A;  2M33 A;  1B5M A;  2I89 A;  1I8C A; 
#chains in the Genus database with same CATH topology
 1MJ4 A;  1AW3 A;  1AXX A;  1F04 A;  1LJ0 A;  1X3X A;  3NER A;  1IEU A;  1U9M A;  1IET A;  1AWP A;  1B5A A;  1M2M A;  1T0G A;  1I87 A;  1HKO A;  1M59 A;  1ES1 A;  1ICC A;  1B5B A;  4HIN A;  1J0Q A;  1LQX A;  3X35 A;  1LR6 A;  1DO9 A;  2OZ0 A;  1SOX A;  1BFX A;  3X32 A;  2I96 A;  4HIL A;  1U9U A;  1LCO A;  1MNY A;  1KBI A;  1M20 A;  4X8Y A;  2AXX A;  3X34 A;  3MUS A;  1I5U A;  1LTD A;  1M2I A;  1F03 A;  1SH4 A;  3OZZ B;  1NX7 A;  1EUE A;  1AQA A;  1LDC A;  4B8N A;  1CYO A;  1J03 A;  3LF5 A;  1CXY A;  2KEO A;  2IBJ A;  3KS0 A;  1EHB A;  1JEX A;  1BLV A;  1FCB A;  3X33 A;  1IB7 A;  2M33 A;  1B5M A;  2I89 A;  1I8C A; 
#chains in the Genus database with same CATH homology
 1MJ4 A;  1AW3 A;  1AXX A;  1F04 A;  1LJ0 A;  1X3X A;  3NER A;  1IEU A;  1U9M A;  1IET A;  1AWP A;  1B5A A;  1M2M A;  1T0G A;  1I87 A;  1HKO A;  1M59 A;  1ES1 A;  1ICC A;  1B5B A;  4HIN A;  1J0Q A;  1LQX A;  3X35 A;  1LR6 A;  1DO9 A;  2OZ0 A;  1SOX A;  1BFX A;  3X32 A;  2I96 A;  4HIL A;  1U9U A;  1LCO A;  1MNY A;  1KBI A;  1M20 A;  4X8Y A;  2AXX A;  3X34 A;  3MUS A;  1I5U A;  1LTD A;  1M2I A;  1F03 A;  1SH4 A;  3OZZ B;  1NX7 A;  1EUE A;  1AQA A;  1LDC A;  4B8N A;  1CYO A;  1J03 A;  3LF5 A;  1CXY A;  2KEO A;  2IBJ A;  3KS0 A;  1EHB A;  1JEX A;  1BLV A;  1FCB A;  3X33 A;  1IB7 A;  2M33 A;  1B5M A;  2I89 A;  1I8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...